F465268

General Info

Members Datasets Scaffolds Average Seq Length
574 254 567 84

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10107932|rootL2_101079321
Length 98
Sequence MVISILAPSNFNPKMAKFIAHIDVMPLKALLDPQGKAVTGSMKNLGLPEIENVRIGKHITLEIDAASKDAASAKVDEACKKLLCNQIMEGYEFHLVEA

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
17 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
140 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
161 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
162 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
207 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
208 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
232 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
233 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
241 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
245 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
246 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
249 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
250 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
251 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
252 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 2.44
Isolates 1.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.32
Nodule 0
Rhizoplane 1.39
Rhizosphere 85.89
Stem 0
Stem Tuber 0
Unclassified 5.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001799 3300001904 Bacteria 3847
2 JGI24740J21852_10005301 3300001979 Bacteria 5471
3 JGI24740J21852_10058568 3300001979 Bacteria 1071
4 JGI24740J21852_10128584 3300001979 Bacteria 632
5 JGI24739J22299_10087288 3300001989 Bacteria 953
6 JGI24739J22299_10091857 3300001989 Bacteria 923
7 JGI24737J22298_10003401 3300001990 Bacteria 5627
8 JGI24737J22298_10025610 3300001990 Bacteria 1864
9 JGI24737J22298_10027875 3300001990 Bacteria 1778
10 JGI24735J21928_10000004 3300002067 Bacteria 381713
11 JGI24735J21928_10009496 3300002067 Bacteria 3122
12 JGI24735J21928_10258196 3300002067 Bacteria 508
13 JGI24738J21930_10140607 3300002075 Bacteria 532
14 JGI25162J39368_1000017 3300002737 Bacteria 281385
15 JGI25162J39368_1000188 3300002737 Bacteria 64938
16 JGI25162J39368_1002026 3300002737 Bacteria 8939
17 JGI25157J39369_1007318 3300002741 Bacteria 1601
18 JGI25164J39214_1002076 3300002772 Bacteria 3453
19 JGI25165J46597_1002705 3300003214 Bacteria 5271
20 JGI25165J46597_1022925 3300003214 Bacteria 813
21 rootH1_10008508 3300003316 Bacteria 5101
22 rootH2_10002594 3300003320 Bacteria 27151
23 rootH2_10028888 3300003320 Bacteria 2645
24 rootH2_10068342 3300003320 Bacteria 1275
25 rootH2_10110926 3300003320 Bacteria 1476
26 rootH2_10159520 3300003320 Bacteria 2454
27 rootH2_10173382 3300003320 Bacteria 1514
28 rootH2_10317326 3300003320 Bacteria 1852
29 rootL2_10107932 3300003322 Bacteria 9496
30 rootL2_10162043 3300003322 Bacteria 2968
31 rootH1_10010074 3300003323 Bacteria 3414
32 rootH1_10018482 3300003323 Bacteria 48371
33 rootH1_10046540 3300003323 Bacteria 2022
34 rootH1_10233024 3300003323 Unclassified 1450
35 Ga0058863_10881414 3300004799 Bacteria 1051
36 Ga0058862_12862898 3300004803 Bacteria 1537
37 Ga0070658_10059798 3300005327 Bacteria 3103
38 Ga0070658_10743727 3300005327 Bacteria 851
39 Ga0070658_11415454 3300005327 Unclassified 603
40 Ga0070676_10003389 3300005328 Bacteria 8294
41 Ga0070683_100014928 3300005329 Bacteria 6809
42 Ga0070683_101459530 3300005329 Bacteria 657
43 Ga0070683_102201276 3300005329 Bacteria 529
44 Ga0068869_100520107 3300005334 Bacteria 996
45 Ga0070680_100156879 3300005336 Bacteria 1912
46 Ga0070680_100200081 3300005336 Unclassified 1684
47 Ga0068868_100034759 3300005338 Bacteria 3893
48 Ga0068868_100274558 3300005338 Bacteria 1425
49 Ga0070660_100024631 3300005339 Bacteria 4465
50 Ga0070660_100026302 3300005339 Bacteria 4331
51 Ga0070660_101436144 3300005339 Bacteria 586
52 Ga0070660_101682312 3300005339 Unclassified 540
53 Ga0070691_10126852 3300005341 Bacteria 1289
54 Ga0070661_101701559 3300005344 Bacteria 534
55 Ga0070675_100125196 3300005354 Bacteria 2186
56 Ga0070675_100876613 3300005354 Bacteria 822
57 Ga0070671_100011939 3300005355 Bacteria 6988
58 Ga0070674_100502255 3300005356 Bacteria 1010
59 Ga0070673_100007775 3300005364 Bacteria 7093
60 Ga0070673_100144582 3300005364 Bacteria 2009
61 Ga0070673_101416242 3300005364 Bacteria 654
62 Ga0070659_100000605 3300005366 Bacteria 26382
63 Ga0070659_100014736 3300005366 Bacteria 5848
64 Ga0070659_100356753 3300005366 Bacteria 1228
65 Ga0070713_100075898 3300005436 Bacteria 2852
66 Ga0070663_100006454 3300005455 Bacteria 7057
67 Ga0070678_100012059 3300005456 Bacteria 5357
68 Ga0070678_100941499 3300005456 Bacteria 791
69 Ga0070681_10019794 3300005458 Bacteria 6739
70 Ga0068867_100003025 3300005459 Bacteria 11855
71 Ga0070679_100047113 3300005530 Bacteria 4298
72 Ga0070679_100213003 3300005530 Bacteria 1895
73 Ga0070679_101076946 3300005530 Bacteria 748
74 Ga0070684_100308749 3300005535 Bacteria 1452
75 Ga0068853_100027596 3300005539 Bacteria 4770
76 Ga0068853_100071691 3300005539 Bacteria 3018
77 Ga0068853_100444387 3300005539 Bacteria 1219
78 Ga0070672_100024198 3300005543 Bacteria 4484
79 Ga0070665_100000072 3300005548 Bacteria 198575
80 Ga0068855_100000090 3300005563 Bacteria 110528
81 Ga0068855_100000268 3300005563 Bacteria 64693
82 Ga0068855_100114126 3300005563 Bacteria 3098
83 Ga0068855_100277568 3300005563 Bacteria 1862
84 Ga0068855_100659543 3300005563 Bacteria 1123
85 Ga0068855_100901468 3300005563 Bacteria 934
86 Ga0068855_101002601 3300005563 Unclassified 877
87 Ga0068855_101061383 3300005563 Bacteria 848
88 Ga0068855_101748154 3300005563 Bacteria 633
89 Ga0068855_101764254 3300005563 Bacteria 630
90 Ga0068855_101998672 3300005563 Bacteria 586
91 Ga0068857_100047445 3300005577 Bacteria 3814
92 Ga0068857_100140389 3300005577 Bacteria 2184
93 Ga0068854_101146789 3300005578 Bacteria 694
94 Ga0068856_100002063 3300005614 Bacteria 20822
95 Ga0068856_100037671 3300005614 Unclassified 4746
96 Ga0068856_100064349 3300005614 Bacteria 3623
97 Ga0068856_100097551 3300005614 Bacteria 2928
98 Ga0068856_100117436 3300005614 Bacteria 2661
99 Ga0068856_100267512 3300005614 Bacteria 1725
100 Ga0068856_100333297 3300005614 Bacteria 1535
101 Ga0068856_100667721 3300005614 Bacteria 1060
102 Ga0068856_101769889 3300005614 Bacteria 630
103 Ga0068852_100000143 3300005616 Bacteria 48192
104 Ga0068852_100298178 3300005616 Bacteria 1559
105 Ga0068852_102369443 3300005616 Bacteria 552
106 Ga0068852_102614771 3300005616 Bacteria 524
107 Ga0068866_10626522 3300005718 Bacteria 729
108 Ga0068863_100546293 3300005841 Bacteria 1144
109 Ga0068858_100094461 3300005842 Bacteria 2785
110 Ga0075366_10001066 3300006195 Bacteria 13460
111 Ga0075366_10009950 3300006195 Bacteria 5326
112 Ga0075366_10097670 3300006195 Bacteria 1761
113 Ga0097621_100000028 3300006237 Bacteria 71678
114 Ga0097621_101359215 3300006237 Bacteria 672
115 Ga0075370_10111743 3300006353 Bacteria 1587
116 Ga0068871_100000066 3300006358 Bacteria 57980
117 Ga0068865_100000127 3300006881 Bacteria 39327
118 Ga0105240_10021397 3300009093 Bacteria 8603
119 Ga0105240_10026729 3300009093 Bacteria 7569
120 Ga0105240_10070934 3300009093 Bacteria 4309
121 Ga0105240_10134558 3300009093 Bacteria 2961
122 Ga0105240_10188700 3300009093 Bacteria 2425
123 Ga0105240_10239482 3300009093 Bacteria 2104
124 Ga0105240_10511201 3300009093 Bacteria 1334
125 Ga0105240_10588266 3300009093 Bacteria 1227
126 Ga0105240_10688164 3300009093 Bacteria 1117
127 Ga0105240_11315049 3300009093 Bacteria 762
128 Ga0105245_10264156 3300009098 Bacteria 1676
129 Ga0105243_12428070 3300009148 Bacteria 563
130 Ga0105241_10017142 3300009174 Bacteria 5320
131 Ga0105241_10017609 3300009174 Bacteria 5253
132 Ga0105241_10062753 3300009174 Bacteria 2865
133 Ga0105241_10076384 3300009174 Bacteria 2612
134 Ga0105241_10540685 3300009174 Bacteria 1045
135 Ga0105242_10020443 3300009176 Bacteria 5191
136 Ga0105237_10000233 3300009545 Bacteria 79346
137 Ga0105237_10000485 3300009545 Bacteria 56664
138 Ga0105237_10004544 3300009545 Bacteria 16031
139 Ga0105237_10005170 3300009545 Bacteria 14766
140 Ga0105237_10215629 3300009545 Bacteria 1919
141 Ga0105237_10308185 3300009545 Bacteria 1586
142 Ga0105237_10380038 3300009545 Bacteria 1417
143 Ga0105237_10448463 3300009545 Bacteria 1296
144 Ga0105237_10475300 3300009545 Bacteria 1256
145 Ga0105237_10766976 3300009545 Bacteria 971
146 Ga0105237_11599529 3300009545 Bacteria 658
147 Ga0105237_11781743 3300009545 Bacteria 623
148 Ga0105238_10092755 3300009551 Bacteria 3008
149 Ga0105238_10138384 3300009551 Bacteria 2412
150 Ga0105238_10488050 3300009551 Bacteria 1232
151 Ga0105238_10595334 3300009551 Bacteria 1113
152 Ga0105238_11929574 3300009551 Bacteria 624
153 Ga0105249_11943753 3300009553 Bacteria 661
154 Ga0105239_10000039 3300010375 Bacteria 203537
155 Ga0105239_10000120 3300010375 Bacteria 110003
156 Ga0105239_10001068 3300010375 Bacteria 38074
157 Ga0105239_10002256 3300010375 Bacteria 24634
158 Ga0105239_10004588 3300010375 Bacteria 16460
159 Ga0105239_10006088 3300010375 Bacteria 14046
160 Ga0105239_10078643 3300010375 Bacteria 3630
161 Ga0105239_10529694 3300010375 Bacteria 1341
162 Ga0105239_11222616 3300010375 Bacteria 866
163 Ga0105239_11446698 3300010375 Bacteria 794
164 Ga0105239_11785920 3300010375 Bacteria 712
165 Ga0105239_11800832 3300010375 Bacteria 709
166 Ga0105239_12260677 3300010375 Bacteria 633
167 Ga0105246_11752777 3300011119 Bacteria 592
168 Ga0157373_10000031 3300013100 Bacteria 126446
169 Ga0157373_10019179 3300013100 Bacteria 4980
170 Ga0157373_10233973 3300013100 Bacteria 1298
171 Ga0157373_10735022 3300013100 Bacteria 725
172 Ga0157373_11279823 3300013100 Bacteria 555
173 Ga0157371_10000263 3300013102 Bacteria 71557
174 Ga0157371_10001069 3300013102 Bacteria 29903
175 Ga0157371_10010634 3300013102 Bacteria 7150
176 Ga0157371_10014399 3300013102 Bacteria 5968
177 Ga0157371_10043215 3300013102 Bacteria 3211
178 Ga0157371_10935047 3300013102 Bacteria 659
179 Ga0157370_10024024 3300013104 Bacteria 6043
180 Ga0157370_10100587 3300013104 Bacteria 2709
181 Ga0157370_10341271 3300013104 Bacteria 1381
182 Ga0157370_10405346 3300013104 Bacteria 1255
183 Ga0157370_10490338 3300013104 Bacteria 1129
184 Ga0157370_10640013 3300013104 Bacteria 972
185 Ga0157370_10945268 3300013104 Bacteria 781
186 Ga0157370_11222120 3300013104 Bacteria 678
187 Ga0157370_11240239 3300013104 Unclassified 672
188 Ga0157369_10001443 3300013105 Bacteria 29190
189 Ga0157369_10012876 3300013105 Bacteria 9482
190 Ga0157369_10095474 3300013105 Bacteria 3172
191 Ga0157369_10237760 3300013105 Bacteria 1903
192 Ga0157369_10365431 3300013105 Bacteria 1498
193 Ga0157369_10810242 3300013105 Unclassified 962
194 Ga0157374_10000174 3300013296 Bacteria 59597
195 Ga0157374_10000451 3300013296 Bacteria 37378
196 Ga0157374_10037988 3300013296 Bacteria 4423
197 Ga0157374_10046992 3300013296 Bacteria 4000
198 Ga0157374_10639192 3300013296 Bacteria 1075
199 Ga0157374_10645469 3300013296 Bacteria 1070
200 Ga0157374_10937960 3300013296 Bacteria 884
201 Ga0157378_10014313 3300013297 Bacteria 6945
202 Ga0157378_10017619 3300013297 Bacteria 6271
203 Ga0157378_10393879 3300013297 Bacteria 1363
204 Ga0157378_11918036 3300013297 Bacteria 642
205 Ga0163162_10000010 3300013306 Bacteria 302032
206 Ga0163162_10009061 3300013306 Bacteria 9675
207 Ga0163162_10014100 3300013306 Bacteria 7811
208 Ga0163162_10777528 3300013306 Bacteria 1076
209 Ga0163162_10792889 3300013306 Bacteria 1065
210 Ga0163162_13367557 3300013306 Bacteria 511
211 Ga0157372_10000050 3300013307 Bacteria 140381
212 Ga0157372_10000266 3300013307 Bacteria 57783
213 Ga0157372_10000499 3300013307 Bacteria 43240
214 Ga0157372_10000660 3300013307 Bacteria 37899
215 Ga0157372_10015188 3300013307 Bacteria 8244
216 Ga0157372_10504205 3300013307 Bacteria 1411
217 Ga0157372_10921406 3300013307 Bacteria 1013
218 Ga0157372_12593303 3300013307 Bacteria 582
219 Ga0157372_12905175 3300013307 Bacteria 549
220 Ga0157375_10030029 3300013308 Bacteria 5119
221 Ga0157375_12315537 3300013308 Bacteria 640
222 Ga0163163_11272844 3300014325 Bacteria 798
223 Ga0182008_10140599 3300014497 Unclassified 1207
224 Ga0182008_10285447 3300014497 Bacteria 860
225 Ga0182008_10473826 3300014497 Bacteria 684
226 Ga0182008_10963165 3300014497 Bacteria 506
227 Ga0157377_10066070 3300014745 Bacteria 2079
228 Ga0157379_11178742 3300014968 Bacteria 736
229 Ga0157376_10186203 3300014969 Bacteria 1901
230 Ga0182006_1008547 3300015261 Bacteria 4639
231 Ga0182007_10012304 3300015262 Bacteria 3295
232 Ga0182007_10013672 3300015262 Bacteria 3086
233 Ga0163161_10058889 3300017792 Bacteria 2792
234 Ga0206351_10228156 3300020077 Bacteria 2631
235 Ga0206351_10956156 3300020077 Bacteria 1249
236 Ga0206352_10420157 3300020078 Unclassified 543
237 Ga0206352_11006529 3300020078 Bacteria 664
238 Ga0206350_10018749 3300020080 Bacteria 797
239 Ga0224712_10170478 3300022467 Bacteria 976
240 Ga0209563_106392 3300025230 Bacteria 2028
241 Ga0207427_100172 3300025231 Bacteria 71550
242 Ga0209437_100024 3300025233 Bacteria 592878
243 Ga0209437_100034 3300025233 Bacteria 494007
244 Ga0209437_132306 3300025233 Bacteria 519
245 Ga0209026_1000219 3300025250 Bacteria 78822
246 Ga0209026_1003422 3300025250 Bacteria 5214
247 Ga0209026_1003780 3300025250 Bacteria 4800
248 Ga0209026_1064020 3300025250 Bacteria 515
249 Ga0209129_1011886 3300025258 Bacteria 2046
250 Ga0209233_1000038 3300025261 Bacteria 548972
251 Ga0209233_1008430 3300025261 Bacteria 3194
252 Ga0209233_1057331 3300025261 Bacteria 765
253 Ga0209455_1009960 3300025272 Bacteria 2453
254 Ga0207642_10983838 3300025899 Bacteria 543
255 Ga0207647_10000662 3300025904 Bacteria 26925
256 Ga0207647_10006287 3300025904 Bacteria 8647
257 Ga0207645_10001390 3300025907 Bacteria 19866
258 Ga0207705_10000036 3300025909 Bacteria 200787
259 Ga0207705_10040265 3300025909 Bacteria 3351
260 Ga0207705_10335301 3300025909 Bacteria 1164
261 Ga0207705_10688977 3300025909 Unclassified 794
262 Ga0207705_11368305 3300025909 Unclassified 539
263 Ga0207654_10005732 3300025911 Bacteria 6273
264 Ga0207654_10010341 3300025911 Bacteria 4752
265 Ga0207654_10289742 3300025911 Bacteria 1110
266 Ga0207695_10000013 3300025913 Bacteria 821265
267 Ga0207695_10002721 3300025913 Bacteria 25814
268 Ga0207695_10032015 3300025913 Bacteria 5759
269 Ga0207695_10052551 3300025913 Bacteria 4267
270 Ga0207695_10115813 3300025913 Bacteria 2654
271 Ga0207695_10262527 3300025913 Bacteria 1624
272 Ga0207695_10414687 3300025913 Bacteria 1231
273 Ga0207695_10452166 3300025913 Bacteria 1167
274 Ga0207695_10743307 3300025913 Bacteria 861
275 Ga0207695_11126585 3300025913 Bacteria 665
276 Ga0207695_11644736 3300025913 Unclassified 523
277 Ga0207671_10000663 3300025914 Bacteria 44922
278 Ga0207671_10011406 3300025914 Bacteria 7239
279 Ga0207671_10012094 3300025914 Bacteria 6969
280 Ga0207671_10014472 3300025914 Bacteria 6232
281 Ga0207671_10207370 3300025914 Bacteria 1532
282 Ga0207671_10280646 3300025914 Bacteria 1314
283 Ga0207671_10341977 3300025914 Bacteria 1186
284 Ga0207660_11305773 3300025917 Bacteria 589
285 Ga0207657_10034762 3300025919 Bacteria 4528
286 Ga0207657_10259514 3300025919 Bacteria 1383
287 Ga0207657_11260092 3300025919 Unclassified 560
288 Ga0207649_11021365 3300025920 Bacteria 651
289 Ga0207652_10183492 3300025921 Bacteria 1881
290 Ga0207652_10552855 3300025921 Bacteria 1034
291 Ga0207694_10185445 3300025924 Bacteria 1689
292 Ga0207694_10194814 3300025924 Bacteria 1647
293 Ga0207694_10378529 3300025924 Bacteria 1175
294 Ga0207694_10483596 3300025924 Bacteria 1036
295 Ga0207687_10325130 3300025927 Bacteria 1246
296 Ga0207644_10013787 3300025931 Bacteria 5399
297 Ga0207690_10008888 3300025932 Bacteria 5963
298 Ga0207690_10025956 3300025932 Bacteria 3686
299 Ga0207690_10197366 3300025932 Bacteria 1526
300 Ga0207690_10410760 3300025932 Bacteria 1081
301 Ga0207706_10001262 3300025933 Bacteria 25516
302 Ga0207686_10082643 3300025934 Bacteria 2100
303 Ga0207669_11484400 3300025937 Bacteria 578
304 Ga0207704_10000044 3300025938 Bacteria 86753
305 Ga0207691_10048348 3300025940 Bacteria 3901
306 Ga0207689_10382349 3300025942 Bacteria 1172
307 Ga0207661_10009939 3300025944 Bacteria 6834
308 Ga0207667_10000009 3300025949 Bacteria 603135
309 Ga0207667_10000971 3300025949 Bacteria 36600
310 Ga0207667_10025169 3300025949 Bacteria 6521
311 Ga0207667_10041690 3300025949 Bacteria 4881
312 Ga0207667_10281087 3300025949 Bacteria 1701
313 Ga0207667_10679190 3300025949 Unclassified 1033
314 Ga0207667_10988468 3300025949 Bacteria 829
315 Ga0207667_11137548 3300025949 Bacteria 762
316 Ga0207667_11833266 3300025949 Bacteria 570
317 Ga0207651_10045542 3300025960 Bacteria 2943
318 Ga0207651_11190766 3300025960 Bacteria 684
319 Ga0207640_10642929 3300025981 Bacteria 903
320 Ga0207640_11046360 3300025981 Bacteria 720
321 Ga0207677_10012208 3300026023 Bacteria 4928
322 Ga0207677_10178101 3300026023 Bacteria 1670
323 Ga0207703_10064197 3300026035 Bacteria 3013
324 Ga0207703_10459593 3300026035 Bacteria 1190
325 Ga0207639_10008764 3300026041 Bacteria 6950
326 Ga0207639_10010971 3300026041 Bacteria 6280
327 Ga0207639_10818528 3300026041 Bacteria 868
328 Ga0207639_10949974 3300026041 Bacteria 804
329 Ga0207678_10006043 3300026067 Bacteria 10770
330 Ga0207678_11084786 3300026067 Bacteria 709
331 Ga0207702_10000797 3300026078 Bacteria 33437
332 Ga0207702_10002698 3300026078 Bacteria 16666
333 Ga0207702_10053362 3300026078 Bacteria 3422
334 Ga0207702_10070675 3300026078 Bacteria 3003
335 Ga0207702_10079018 3300026078 Bacteria 2850
336 Ga0207702_10180597 3300026078 Bacteria 1943
337 Ga0207702_10197459 3300026078 Bacteria 1863
338 Ga0207702_10245559 3300026078 Bacteria 1679
339 Ga0207702_10845243 3300026078 Bacteria 906
340 Ga0207702_11715499 3300026078 Bacteria 621
341 Ga0207641_11902970 3300026088 Bacteria 596
342 Ga0207648_10000529 3300026089 Bacteria 42805
343 Ga0207648_11831360 3300026089 Bacteria 569
344 Ga0207674_10063810 3300026116 Bacteria 3717
345 Ga0207674_12085046 3300026116 Bacteria 531
346 Ga0207683_10006840 3300026121 Bacteria 9766
347 Ga0207683_11929157 3300026121 Bacteria 539
348 Ga0207698_10003256 3300026142 Bacteria 9759
349 Ga0207698_10192836 3300026142 Bacteria 1817
350 Ga0207698_10374545 3300026142 Bacteria 1353
351 Ga0207698_10892093 3300026142 Bacteria 896
352 Ga0268266_10000089 3300028379 Bacteria 198566
353 Ga0268266_11344546 3300028379 Bacteria 690
354 Ga0265334_10091719 3300028573 Bacteria 1107
355 Ga0307517_10010238 3300028786 Bacteria 13156
356 Ga0307515_10001997 3300028794 Bacteria 45190
357 Ga0307515_10002629 3300028794 Bacteria 38616
358 Ga0307515_10257372 3300028794 Bacteria 1488
359 Ga0265338_10100447 3300028800 Bacteria 2359
360 Ga0265324_10079140 3300029957 Unclassified 1119
361 Ga0316181_1216241 3300030744 Bacteria 962
362 Ga0265327_10005164 3300031251 Bacteria 11063
363 Ga0265327_10038957 3300031251 Bacteria 2586
364 Ga0265327_10142110 3300031251 Bacteria 1121
365 Ga0265327_10178104 3300031251 Bacteria 974
366 Ga0307513_10950926 3300031456 Bacteria 568
367 Ga0307408_100502013 3300031548 Bacteria 1062
368 Ga0307408_101016539 3300031548 Unclassified 765
369 Ga0307408_102181556 3300031548 Unclassified 535
370 Ga0307405_10046431 3300031731 Bacteria 2668
371 Ga0307413_10661292 3300031824 Unclassified 863
372 Ga0307413_11787469 3300031824 Unclassified 550
373 Ga0307406_10916936 3300031901 Bacteria 747
374 Ga0307412_10094126 3300031911 Bacteria 2103
375 Ga0307412_10139269 3300031911 Bacteria 1775
376 Ga0307412_10895536 3300031911 Bacteria 777
377 Ga0307412_11218005 3300031911 Bacteria 675
378 Ga0307416_100346233 3300032002 Bacteria 1502
379 Ga0307416_101406527 3300032002 Bacteria 803
380 Ga0307414_10014699 3300032004 Bacteria 4702
381 Ga0307414_10043195 3300032004 Unclassified 3068
382 Ga0307414_10090314 3300032004 Unclassified 2273
383 Ga0307414_10295326 3300032004 Bacteria 1368
384 Ga0307414_10334227 3300032004 Bacteria 1294
385 Ga0307414_10409367 3300032004 Bacteria 1180
386 Ga0307414_10952415 3300032004 Bacteria 789
387 Ga0307414_11257069 3300032004 Unclassified 686
388 Ga0307414_11622596 3300032004 Bacteria 603
389 Ga0307411_10003093 3300032005 Bacteria 7612
390 Ga0307411_10030778 3300032005 Bacteria 3294
391 Ga0307411_11270653 3300032005 Bacteria 670
392 Ga0307507_10000015 3300033179 Bacteria 237419
393 Ga0307510_10011192 3300033180 Bacteria 10666
394 Ga0307510_10638502 3300033180 Bacteria 521
395 Ga0373941_0013874 3300035115 Bacteria 2140
396 Ga0395899_0000002 3300037312 Bacteria 1324310
397 Ga0395899_0000088 3300037312 Bacteria 156987
398 Ga0395899_0000640 3300037312 Bacteria 36134
399 Ga0395899_0001109 3300037312 Bacteria 24123
400 Ga0395899_0034511 3300037312 Bacteria 3800
401 Ga0395899_0137256 3300037312 Bacteria 1743
402 Ga0395899_0692907 3300037312 Bacteria 640
403 Ga0395900_0000277 3300037418 Bacteria 77256
404 Ga0395900_0001234 3300037418 Bacteria 31453
405 Ga0395900_0006335 3300037418 Bacteria 12338
406 Ga0395900_0019609 3300037418 Bacteria 6896
407 Ga0395900_0230458 3300037418 Bacteria 1863
408 Ga0395898_0001918 3300037466 Bacteria 26473
409 Ga0395898_0629602 3300037466 Bacteria 1015
410 Ga0395905_0000011 3300037471 Bacteria 424563
411 Ga0395905_0000068 3300037471 Bacteria 177163
412 Ga0395905_0003090 3300037471 Bacteria 17997
413 Ga0395905_0398100 3300037471 Bacteria 1272
414 Ga0395901_0000199 3300038443 Bacteria 76415
415 Ga0395901_0004520 3300038443 Bacteria 14030
416 Ga0395901_0030940 3300038443 Bacteria 5517
417 Ga0395901_0196139 3300038443 Bacteria 2117
418 Ga0436361_0817619 3300039447 Bacteria 10670
419 Ga0451793_1169538 3300041452 Bacteria 761
420 Ga0451793_1799653 3300041452 Bacteria 589
421 Ga0451797_1325986 3300041453 Bacteria 605
422 Ga0451798_0143136 3300041458 Bacteria 549
423 Ga0451807_0169192 3300041486 Bacteria 515
424 Ga0451839_0634252 3300041496 Bacteria 514
425 Ga0439448_0043695 3300042005 Bacteria 1456
426 Ga0451577_0000052 3300042876 Bacteria 291030
427 Ga0466969_0450908 3300044656 Bacteria 585
428 Ga0466966_0285368 3300044684 Bacteria 992
429 Ga0466961_0069939 3300044693 Bacteria 2228
430 Ga0453684_0004218 3300044712 Bacteria 30864
431 Ga0453684_1838909 3300044712 Bacteria 614
432 Ga0466959_0035490 3300045049 Bacteria 3687
433 Ga0451576_0000002 3300045051 Bacteria 1670975
434 Ga0451576_0032468 3300045051 Bacteria 5558
435 Ga0466958_0037027 3300045836 Bacteria 2922
436 Ga0495592_0172053 3300046454 Bacteria 1482
437 Ga0495629_0704349 3300046459 Bacteria 670
438 Ga0495638_0113534 3300046460 Bacteria 1607
439 Ga0495638_0330066 3300046460 Bacteria 812
440 Ga0495651_0050806 3300046462 Bacteria 3198
441 Ga0495651_0146754 3300046462 Bacteria 1705
442 Ga0495653_0905000 3300046463 Bacteria 525
443 Ga0495650_0000087 3300046471 Bacteria 234870
444 Ga0495650_0029898 3300046471 Bacteria 2476
445 Ga0495650_0195852 3300046471 Bacteria 704
446 Ga0495650_0220109 3300046471 Bacteria 654
447 Ga0495605_0187687 3300046474 Bacteria 906
448 Ga0495585_0000286 3300046492 Bacteria 50524
449 Ga0495585_0000553 3300046492 Bacteria 35342
450 Ga0495585_0627575 3300046492 Bacteria 504
451 Ga0495596_0354159 3300046500 Bacteria 572
452 Ga0495583_0255405 3300046506 Bacteria 702
453 Ga0495606_0000052 3300046507 Bacteria 201529
454 Ga0495606_0026825 3300046507 Bacteria 4097
455 Ga0495606_0036546 3300046507 Bacteria 3344
456 Ga0495606_0334316 3300046507 Bacteria 809
457 Ga0495610_0009503 3300046512 Bacteria 6138
458 Ga0495616_0004909 3300046513 Bacteria 8358
459 Ga0495616_0011404 3300046513 Bacteria 5091
460 Ga0495628_0252297 3300046516 Bacteria 1317
461 Ga0495631_0010350 3300046518 Bacteria 4616
462 Ga0495631_0060149 3300046518 Bacteria 1649
463 Ga0495637_0021664 3300046520 Bacteria 2944
464 Ga0495644_0013350 3300046523 Bacteria 3152
465 Ga0495648_0001785 3300046524 Bacteria 20692
466 Ga0495652_0300791 3300046529 Bacteria 1166
467 Ga0495609_0006171 3300046538 Bacteria 6162
468 Ga0495609_0054407 3300046538 Bacteria 1777
469 Ga0495622_0301639 3300046557 Bacteria 698
470 Ga0495633_0000035 3300046558 Bacteria 185403
471 Ga0495633_0003276 3300046558 Bacteria 10897
472 Ga0495668_0000032 3300046616 Bacteria 254951
473 Ga0495668_0063399 3300046616 Bacteria 2036
474 Ga0495668_0558505 3300046616 Bacteria 632
475 Ga0495611_0169270 3300046648 Bacteria 1021
476 Ga0495625_0000008 3300046660 Bacteria 536165
477 Ga0495625_0000753 3300046660 Bacteria 45225
478 Ga0495625_0001038 3300046660 Bacteria 36510
479 Ga0495625_0014931 3300046660 Bacteria 6175
480 Ga0495625_0082824 3300046660 Bacteria 2230
481 Ga0495625_0440802 3300046660 Bacteria 806
482 Ga0495661_0021105 3300046665 Bacteria 4249
483 Ga0495661_0024218 3300046665 Bacteria 3930
484 Ga0495661_0113692 3300046665 Bacteria 1505
485 Ga0495588_0678674 3300046674 Bacteria 539
486 Ga0495588_0747536 3300046674 Bacteria 511
487 Ga0495669_0297390 3300046684 Bacteria 778
488 Ga0495670_0550669 3300046691 Bacteria 628
489 Ga0495671_0044452 3300046692 Bacteria 2227
490 Ga0495671_0125292 3300046692 Bacteria 1253
491 Ga0495649_0000018 3300046694 Bacteria 220586
492 Ga0495649_0030579 3300046694 Bacteria 2974
493 Ga0495660_0222481 3300046810 Bacteria 889
494 Ga0495683_0205678 3300047323 Bacteria 885
495 Ga0495687_004055 3300047443 Bacteria 10153
496 Ga0495687_095659 3300047443 Bacteria 1126
497 Ga0495686_0000052 3300047472 Bacteria 262622
498 Ga0495686_0451140 3300047472 Bacteria 683
499 Ga0496105_1316464 3300048908 Bacteria 527
500 Ga0496115_0489121 3300048918 Bacteria 990
501 Ga0496126_0623681 3300048929 Bacteria 847
502 Ga0501308_018122 3300049128 Bacteria 859
503 Ga0501305_019022 3300049161 Bacteria 999
504 Ga0501312_013375 3300049528 Bacteria 1141
505 Ga0501315_022841 3300049531 Unclassified 855
506 Ga0501315_043477 3300049531 Bacteria 687
507 Ga0501321_009297 3300049537 Bacteria 1059
508 Ga0501031_0001412 3300049568 Bacteria 14858
509 Ga0501032_0004349 3300049569 Bacteria 10699
510 Ga0501032_0090207 3300049569 Bacteria 2034
511 Ga0501033_0000004 3300049570 Bacteria 441310
512 Ga0501033_0088260 3300049570 Bacteria 2269
513 Ga0501034_0000432 3300049571 Bacteria 69492
514 Ga0501034_0106289 3300049571 Bacteria 2800
515 Ga0501034_0459491 3300049571 Bacteria 1190
516 Ga0501036_0001406 3300049572 Bacteria 18488
517 Ga0501036_1368801 3300049572 Bacteria 574
518 Ga0501037_0001513 3300049573 Bacteria 16998
519 Ga0501037_0112817 3300049573 Bacteria 1958
520 Ga0501038_0000748 3300049574 Bacteria 28970
521 Ga0501038_0173435 3300049574 Bacteria 1744
522 Ga0501038_0352683 3300049574 Bacteria 1146
523 Ga0501038_0657781 3300049574 Unclassified 788
524 Ga0501039_0002352 3300049575 Bacteria 14078
525 Ga0501043_0001385 3300049579 Bacteria 21221
526 Ga0501043_0057794 3300049579 Bacteria 3045
527 Ga0501046_0838410 3300049580 Bacteria 643
528 Ga0501047_0000515 3300049581 Bacteria 41775
529 Ga0501047_0225885 3300049581 Bacteria 1727
530 Ga0501048_0077017 3300049582 Bacteria 2354
531 Ga0501048_0870689 3300049582 Bacteria 648
532 Ga0501070_0216669 3300049586 Bacteria 1571
533 Ga0501070_0410872 3300049586 Bacteria 1094
534 Ga0501071_0931434 3300049587 Bacteria 670
535 Ga0501223_004830 3300049663 Bacteria 2864
536 Ga0501238_031256 3300049671 Bacteria 770
537 Ga0501270_156469 3300049767 Unclassified 523
538 Ga0501035_0000657 3300049822 Bacteria 38123
539 Ga0501035_0019130 3300049822 Bacteria 6304
540 Ga0501035_1182790 3300049822 Bacteria 594
541 Ga0501044_0000349 3300049823 Bacteria 57948
542 Ga0501044_0001599 3300049823 Bacteria 26490
543 Ga0501044_1087231 3300049823 Bacteria 669
544 Ga0501045_0000028 3300049824 Bacteria 60459
545 nmdc:mga0k408_1225_c1 3300050493 Bacteria 14065
546 nmdc:mga0k408_157481_c1 3300050493 Bacteria 1353
547 nmdc:mga0k408_3989_c1 3300050493 Bacteria 7825
548 nmdc:mga07m45_94166_c1 3300050496 Bacteria 1717
549 Ga0500635_0000409 3300053080 Bacteria 12861
550 Ga0500635_0318088 3300053080 Bacteria 615
551 Ga0500578_0706939 3300053086 Bacteria 542
552 Ga0500646_0078702 3300053090 Bacteria 1002
553 Ga0500650_0125856 3300053098 Bacteria 1193
554 Ga0500572_193190 3300053111 Bacteria 667
555 Ga0500608_000203 3300053122 Bacteria 23751
556 Ga0500608_171084 3300053122 Bacteria 931
557 Ga0500618_000037 3300053125 Bacteria 117320
558 Ga0500618_041830 3300053125 Bacteria 1051
559 Ga0500642_0028794 3300053130 Bacteria 2295
560 Ga0500652_089431 3300053131 Bacteria 1285
561 Ga0500564_091119 3300053138 Bacteria 1357
562 Ga0500616_0089612 3300053153 Bacteria 1526
563 Ga0500622_0002943 3300053156 Bacteria 11819
564 Ga0500624_000572 3300053157 Bacteria 10163
565 Ga0500634_0041116 3300053161 Bacteria 2511
566 Ga0500645_076803 3300053730 Unclassified 955
567 Ga0501082_1848655 3300060353 Bacteria 527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10935047 Ga0157371_109350472 74
2 3300025909 Ga0207705_10688977 Ga0207705_106889772 78
3 3300046460 Ga0495638_0330066 Ga0495638_0330066_298_540 80
4 iso_pu_bacteria 2599185184 2599478323 80
5 iso_pu_bacteria 2852623160 2852626905 80
6 iso_pu_bacteria 2884933994 2884938043 80
7 iso_pu_bacteria 2919437846 2919439006 80
8 iso_pu_bacteria 2928078545 2928080627 80
9 iso_pu_bacteria 2928147474 2928150852 80
10 iso_pu_bacteria 2932082852 2932082988 80
11 3300003320 rootH2_10028888 rootH2_100288882 83
12 3300003320 rootH2_10159520 rootH2_101595202 83
13 3300003320 rootH2_10173382 rootH2_101733822 83
14 3300003323 rootH1_10233024 rootH1_102330242 83
15 3300005327 Ga0070658_11415454 Ga0070658_114154541 83
16 3300005329 Ga0070683_100014928 Ga0070683_1000149287 83
17 3300005339 Ga0070660_100026302 Ga0070660_1000263021 83
18 3300005339 Ga0070660_101436144 Ga0070660_1014361441 83
19 3300005341 Ga0070691_10126852 Ga0070691_101268523 83
20 3300005354 Ga0070675_100876613 Ga0070675_1008766132 83
21 3300005366 Ga0070659_100000605 Ga0070659_10000060513 83
22 3300005436 Ga0070713_100075898 Ga0070713_1000758985 83
23 3300005456 Ga0070678_100941499 Ga0070678_1009414991 83
24 3300005563 Ga0068855_100659543 Ga0068855_1006595432 83
25 3300005563 Ga0068855_101002601 Ga0068855_1010026012 83
26 3300005577 Ga0068857_100140389 Ga0068857_1001403893 83
27 3300005614 Ga0068856_100064349 Ga0068856_1000643492 83
28 3300005614 Ga0068856_100267512 Ga0068856_1002675122 83
29 3300005614 Ga0068856_100333297 Ga0068856_1003332972 83
30 3300009545 Ga0105237_11781743 Ga0105237_117817432 83
31 3300010375 Ga0105239_11446698 Ga0105239_114466982 83
32 3300013100 Ga0157373_10000031 Ga0157373_1000003116 83
33 3300013100 Ga0157373_10735022 Ga0157373_107350221 83
34 3300013100 Ga0157373_11279823 Ga0157373_112798232 83
35 3300013102 Ga0157371_10014399 Ga0157371_100143995 83
36 3300013102 Ga0157371_10043215 Ga0157371_100432152 83
37 3300013105 Ga0157369_10012876 Ga0157369_100128765 83
38 3300013105 Ga0157369_10810242 Ga0157369_108102422 83
39 3300013296 Ga0157374_10046992 Ga0157374_100469924 83
40 3300013307 Ga0157372_10000499 Ga0157372_1000049914 83
41 3300013307 Ga0157372_10000660 Ga0157372_1000066016 83
42 3300013307 Ga0157372_12905175 Ga0157372_129051751 83
43 3300014497 Ga0182008_10140599 Ga0182008_101405992 83
44 3300014497 Ga0182008_10473826 Ga0182008_104738262 83
45 3300015261 Ga0182006_1008547 Ga0182006_10085476 83
46 3300015262 Ga0182007_10013672 Ga0182007_100136724 83
47 3300025250 Ga0209026_1003422 Ga0209026_10034226 83
48 3300025261 Ga0209233_1057331 Ga0209233_10573312 83
49 3300025909 Ga0207705_11368305 Ga0207705_113683051 83
50 3300025932 Ga0207690_10025956 Ga0207690_100259563 83
51 3300025944 Ga0207661_10009939 Ga0207661_100099393 83
52 3300025949 Ga0207667_10679190 Ga0207667_106791902 83
53 3300025949 Ga0207667_10988468 Ga0207667_109884682 83
54 3300026078 Ga0207702_10079018 Ga0207702_100790182 83
55 3300026078 Ga0207702_10245559 Ga0207702_102455592 83
56 3300026078 Ga0207702_10845243 Ga0207702_108452432 83
57 3300026089 Ga0207648_11831360 Ga0207648_118313601 83
58 3300026121 Ga0207683_11929157 Ga0207683_119291572 83
59 3300028573 Ga0265334_10091719 Ga0265334_100917192 83
60 3300029957 Ga0265324_10079140 Ga0265324_100791401 83
61 3300031251 Ga0265327_10038957 Ga0265327_100389572 83
62 3300031251 Ga0265327_10142110 Ga0265327_101421102 83
63 3300031251 Ga0265327_10178104 Ga0265327_101781042 83
64 3300031548 Ga0307408_100502013 Ga0307408_1005020132 83
65 3300031548 Ga0307408_102181556 Ga0307408_1021815561 83
66 3300031731 Ga0307405_10046431 Ga0307405_100464314 83
67 3300031824 Ga0307413_10661292 Ga0307413_106612922 83
68 3300031824 Ga0307413_11787469 Ga0307413_117874692 83
69 3300031911 Ga0307412_10094126 Ga0307412_100941263 83
70 3300031911 Ga0307412_10895536 Ga0307412_108955362 83
71 3300031911 Ga0307412_11218005 Ga0307412_112180051 83
72 3300032004 Ga0307414_10014699 Ga0307414_100146994 83
73 3300032004 Ga0307414_10043195 Ga0307414_100431954 83
74 3300032004 Ga0307414_10090314 Ga0307414_100903143 83
75 3300032004 Ga0307414_10295326 Ga0307414_102953262 83
76 3300032004 Ga0307414_10334227 Ga0307414_103342271 83
77 3300032004 Ga0307414_10409367 Ga0307414_104093673 83
78 3300032004 Ga0307414_11257069 Ga0307414_112570691 83
79 3300032004 Ga0307414_11622596 Ga0307414_116225962 83
80 3300032005 Ga0307411_10003093 Ga0307411_100030933 83
81 3300032005 Ga0307411_10030778 Ga0307411_100307784 83
82 3300037312 Ga0395899_0000088 Ga0395899_0000088_36969_37223 83
83 3300037312 Ga0395899_0137256 Ga0395899_0137256_479_730 83
84 3300037418 Ga0395900_0019609 Ga0395900_0019609_5712_5966 83
85 3300037471 Ga0395905_0000011 Ga0395905_0000011_56920_57171 83
86 3300037471 Ga0395905_0398100 Ga0395905_0398100_1005_1259 83
87 3300038443 Ga0395901_0030940 Ga0395901_0030940_3260_3514 83
88 3300044712 Ga0453684_0004218 Ga0453684_0004218_15727_15978 83
89 3300044712 Ga0453684_1838909 Ga0453684_1838909_209_460 83
90 3300045051 Ga0451576_0000002 Ga0451576_0000002_1523272_1523523 83
91 3300045051 Ga0451576_0032468 Ga0451576_0032468_617_868 83
92 3300046616 Ga0495668_0558505 Ga0495668_0558505_160_411 83
93 3300049128 Ga0501308_018122 Ga0501308_018122_93_344 83
94 3300049161 Ga0501305_019022 Ga0501305_019022_607_858 83
95 3300049528 Ga0501312_013375 Ga0501312_013375_172_423 83
96 3300049531 Ga0501315_022841 Ga0501315_022841_569_820 83
97 3300049531 Ga0501315_043477 Ga0501315_043477_404_655 83
98 3300049537 Ga0501321_009297 Ga0501321_009297_607_858 83
99 3300049574 Ga0501038_0657781 Ga0501038_0657781_458_709 83
100 3300049663 Ga0501223_004830 Ga0501223_004830_1581_1832 83
101 3300049767 Ga0501270_156469 Ga0501270_156469_201_452 83
102 3300049822 Ga0501035_1182790 Ga0501035_1182790_111_362 83
103 3300049823 Ga0501044_1087231 Ga0501044_1087231_126_377 83
104 3300053730 Ga0500645_076803 Ga0500645_076803_28_279 83
105 3300001904 JGI24736J21556_1001799 JGI24736J21556_10017994 84
106 3300001979 JGI24740J21852_10005301 JGI24740J21852_100053015 84
107 3300001979 JGI24740J21852_10058568 JGI24740J21852_100585682 84
108 3300001979 JGI24740J21852_10128584 JGI24740J21852_101285841 84
109 3300001989 JGI24739J22299_10087288 JGI24739J22299_100872881 84
110 3300001989 JGI24739J22299_10091857 JGI24739J22299_100918571 84
111 3300001990 JGI24737J22298_10003401 JGI24737J22298_100034013 84
112 3300001990 JGI24737J22298_10025610 JGI24737J22298_100256104 84
113 3300001990 JGI24737J22298_10027875 JGI24737J22298_100278752 84
114 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004116 84
115 3300002067 JGI24735J21928_10009496 JGI24735J21928_100094963 84
116 3300002067 JGI24735J21928_10258196 JGI24735J21928_102581962 84
117 3300002075 JGI24738J21930_10140607 JGI24738J21930_101406072 84
118 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001728 84
119 3300002737 JGI25162J39368_1000188 JGI25162J39368_100018811 84
120 3300002737 JGI25162J39368_1002026 JGI25162J39368_10020264 84
121 3300002741 JGI25157J39369_1007318 JGI25157J39369_10073183 84
122 3300002772 JGI25164J39214_1002076 JGI25164J39214_10020761 84
123 3300003214 JGI25165J46597_1002705 JGI25165J46597_10027057 84
124 3300003214 JGI25165J46597_1022925 JGI25165J46597_10229252 84
125 3300003316 rootH1_10008508 rootH1_100085083 84
126 3300003320 rootH2_10002594 rootH2_100025943 84
127 3300003320 rootH2_10068342 rootH2_100683421 84
128 3300003320 rootH2_10110926 rootH2_101109261 84
129 3300003320 rootH2_10317326 rootH2_103173261 84
130 3300003322 rootL2_10107932 rootL2_101079321 84
131 3300003322 rootL2_10162043 rootL2_101620433 84
132 3300003323 rootH1_10010074 rootH1_100100745 84
133 3300003323 rootH1_10018482 rootH1_1001848255 84
134 3300003323 rootH1_10046540 rootH1_100465404 84
135 3300004799 Ga0058863_10881414 Ga0058863_108814143 84
136 3300004803 Ga0058862_12862898 Ga0058862_128628982 84
137 3300005327 Ga0070658_10059798 Ga0070658_100597983 84
138 3300005327 Ga0070658_10743727 Ga0070658_107437272 84
139 3300005328 Ga0070676_10003389 Ga0070676_100033893 84
140 3300005329 Ga0070683_101459530 Ga0070683_1014595301 84
141 3300005329 Ga0070683_102201276 Ga0070683_1022012761 84
142 3300005334 Ga0068869_100520107 Ga0068869_1005201072 84
143 3300005336 Ga0070680_100156879 Ga0070680_1001568792 84
144 3300005336 Ga0070680_100200081 Ga0070680_1002000813 84
145 3300005338 Ga0068868_100034759 Ga0068868_1000347592 84
146 3300005338 Ga0068868_100274558 Ga0068868_1002745582 84
147 3300005339 Ga0070660_100024631 Ga0070660_1000246313 84
148 3300005339 Ga0070660_101682312 Ga0070660_1016823121 84
149 3300005344 Ga0070661_101701559 Ga0070661_1017015592 84
150 3300005354 Ga0070675_100125196 Ga0070675_1001251963 84
151 3300005355 Ga0070671_100011939 Ga0070671_1000119393 84
152 3300005356 Ga0070674_100502255 Ga0070674_1005022551 84
153 3300005364 Ga0070673_100007775 Ga0070673_10000777510 84
154 3300005364 Ga0070673_100144582 Ga0070673_1001445822 84
155 3300005364 Ga0070673_101416242 Ga0070673_1014162422 84
156 3300005366 Ga0070659_100014736 Ga0070659_1000147363 84
157 3300005366 Ga0070659_100356753 Ga0070659_1003567532 84
158 3300005455 Ga0070663_100006454 Ga0070663_1000064544 84
159 3300005456 Ga0070678_100012059 Ga0070678_1000120595 84
160 3300005458 Ga0070681_10019794 Ga0070681_100197944 84
161 3300005459 Ga0068867_100003025 Ga0068867_10000302510 84
162 3300005530 Ga0070679_100047113 Ga0070679_1000471132 84
163 3300005530 Ga0070679_100213003 Ga0070679_1002130032 84
164 3300005530 Ga0070679_101076946 Ga0070679_1010769462 84
165 3300005535 Ga0070684_100308749 Ga0070684_1003087492 84
166 3300005539 Ga0068853_100027596 Ga0068853_1000275965 84
167 3300005539 Ga0068853_100071691 Ga0068853_1000716914 84
168 3300005539 Ga0068853_100444387 Ga0068853_1004443872 84
169 3300005543 Ga0070672_100024198 Ga0070672_1000241984 84
170 3300005548 Ga0070665_100000072 Ga0070665_10000007261 84
171 3300005563 Ga0068855_100000090 Ga0068855_10000009073 84
172 3300005563 Ga0068855_100000268 Ga0068855_10000026829 84
173 3300005563 Ga0068855_100114126 Ga0068855_1001141263 84
174 3300005563 Ga0068855_100277568 Ga0068855_1002775682 84
175 3300005563 Ga0068855_100901468 Ga0068855_1009014682 84
176 3300005563 Ga0068855_101061383 Ga0068855_1010613832 84
177 3300005563 Ga0068855_101748154 Ga0068855_1017481541 84
178 3300005563 Ga0068855_101764254 Ga0068855_1017642542 84
179 3300005563 Ga0068855_101998672 Ga0068855_1019986721 84
180 3300005577 Ga0068857_100047445 Ga0068857_1000474454 84
181 3300005578 Ga0068854_101146789 Ga0068854_1011467892 84
182 3300005614 Ga0068856_100002063 Ga0068856_10000206320 84
183 3300005614 Ga0068856_100037671 Ga0068856_1000376712 84
184 3300005614 Ga0068856_100097551 Ga0068856_1000975511 84
185 3300005614 Ga0068856_100117436 Ga0068856_1001174363 84
186 3300005614 Ga0068856_100667721 Ga0068856_1006677212 84
187 3300005614 Ga0068856_101769889 Ga0068856_1017698892 84
188 3300005616 Ga0068852_100000143 Ga0068852_1000001436 84
189 3300005616 Ga0068852_100298178 Ga0068852_1002981782 84
190 3300005616 Ga0068852_102369443 Ga0068852_1023694432 84
191 3300005616 Ga0068852_102614771 Ga0068852_1026147712 84
192 3300005718 Ga0068866_10626522 Ga0068866_106265222 84
193 3300005841 Ga0068863_100546293 Ga0068863_1005462933 84
194 3300005842 Ga0068858_100094461 Ga0068858_1000944612 84
195 3300006195 Ga0075366_10001066 Ga0075366_100010663 84
196 3300006195 Ga0075366_10009950 Ga0075366_100099502 84
197 3300006195 Ga0075366_10097670 Ga0075366_100976702 84
198 3300006237 Ga0097621_100000028 Ga0097621_10000002823 84
199 3300006237 Ga0097621_101359215 Ga0097621_1013592152 84
200 3300006353 Ga0075370_10111743 Ga0075370_101117434 84
201 3300006358 Ga0068871_100000066 Ga0068871_10000006620 84
202 3300006881 Ga0068865_100000127 Ga0068865_10000012738 84
203 3300009093 Ga0105240_10021397 Ga0105240_100213976 84
204 3300009093 Ga0105240_10026729 Ga0105240_100267294 84
205 3300009093 Ga0105240_10070934 Ga0105240_100709345 84
206 3300009093 Ga0105240_10134558 Ga0105240_101345582 84
207 3300009093 Ga0105240_10188700 Ga0105240_101887002 84
208 3300009093 Ga0105240_10239482 Ga0105240_102394821 84
209 3300009093 Ga0105240_10511201 Ga0105240_105112012 84
210 3300009093 Ga0105240_10588266 Ga0105240_105882662 84
211 3300009093 Ga0105240_10688164 Ga0105240_106881642 84
212 3300009093 Ga0105240_11315049 Ga0105240_113150492 84
213 3300009098 Ga0105245_10264156 Ga0105245_102641563 84
214 3300009148 Ga0105243_12428070 Ga0105243_124280702 84
215 3300009174 Ga0105241_10017142 Ga0105241_100171423 84
216 3300009174 Ga0105241_10017609 Ga0105241_100176094 84
217 3300009174 Ga0105241_10062753 Ga0105241_100627531 84
218 3300009174 Ga0105241_10076384 Ga0105241_100763842 84
219 3300009174 Ga0105241_10540685 Ga0105241_105406852 84
220 3300009176 Ga0105242_10020443 Ga0105242_100204433 84
221 3300009545 Ga0105237_10000233 Ga0105237_100002334 84
222 3300009545 Ga0105237_10000485 Ga0105237_1000048522 84
223 3300009545 Ga0105237_10004544 Ga0105237_100045446 84
224 3300009545 Ga0105237_10005170 Ga0105237_1000517011 84
225 3300009545 Ga0105237_10215629 Ga0105237_102156292 84
226 3300009545 Ga0105237_10308185 Ga0105237_103081851 84
227 3300009545 Ga0105237_10380038 Ga0105237_103800381 84
228 3300009545 Ga0105237_10448463 Ga0105237_104484631 84
229 3300009545 Ga0105237_10475300 Ga0105237_104753002 84
230 3300009545 Ga0105237_10766976 Ga0105237_107669762 84
231 3300009545 Ga0105237_11599529 Ga0105237_115995291 84
232 3300009551 Ga0105238_10092755 Ga0105238_100927553 84
233 3300009551 Ga0105238_10138384 Ga0105238_101383844 84
234 3300009551 Ga0105238_10488050 Ga0105238_104880501 84
235 3300009551 Ga0105238_10595334 Ga0105238_105953341 84
236 3300009551 Ga0105238_11929574 Ga0105238_119295742 84
237 3300009553 Ga0105249_11943753 Ga0105249_119437531 84
238 3300010375 Ga0105239_10000039 Ga0105239_10000039136 84
239 3300010375 Ga0105239_10000120 Ga0105239_1000012087 84
240 3300010375 Ga0105239_10001068 Ga0105239_1000106823 84
241 3300010375 Ga0105239_10002256 Ga0105239_1000225627 84
242 3300010375 Ga0105239_10004588 Ga0105239_1000458818 84
243 3300010375 Ga0105239_10006088 Ga0105239_100060888 84
244 3300010375 Ga0105239_10078643 Ga0105239_100786434 84
245 3300010375 Ga0105239_10529694 Ga0105239_105296941 84
246 3300010375 Ga0105239_11222616 Ga0105239_112226161 84
247 3300010375 Ga0105239_11785920 Ga0105239_117859202 84
248 3300010375 Ga0105239_11800832 Ga0105239_118008321 84
249 3300010375 Ga0105239_12260677 Ga0105239_122606772 84
250 3300011119 Ga0105246_11752777 Ga0105246_117527771 84
251 3300013100 Ga0157373_10019179 Ga0157373_100191794 84
252 3300013100 Ga0157373_10233973 Ga0157373_102339732 84
253 3300013102 Ga0157371_10000263 Ga0157371_100002634 84
254 3300013102 Ga0157371_10001069 Ga0157371_100010693 84
255 3300013102 Ga0157371_10010634 Ga0157371_100106346 84
256 3300013104 Ga0157370_10024024 Ga0157370_100240245 84
257 3300013104 Ga0157370_10100587 Ga0157370_101005872 84
258 3300013104 Ga0157370_10341271 Ga0157370_103412713 84
259 3300013104 Ga0157370_10405346 Ga0157370_104053463 84
260 3300013104 Ga0157370_10490338 Ga0157370_104903383 84
261 3300013104 Ga0157370_10640013 Ga0157370_106400132 84
262 3300013104 Ga0157370_10945268 Ga0157370_109452682 84
263 3300013104 Ga0157370_11222120 Ga0157370_112221201 84
264 3300013104 Ga0157370_11240239 Ga0157370_112402392 84
265 3300013105 Ga0157369_10001443 Ga0157369_1000144319 84
266 3300013105 Ga0157369_10095474 Ga0157369_100954743 84
267 3300013105 Ga0157369_10237760 Ga0157369_102377602 84
268 3300013105 Ga0157369_10365431 Ga0157369_103654313 84
269 3300013296 Ga0157374_10000174 Ga0157374_1000017465 84
270 3300013296 Ga0157374_10000451 Ga0157374_1000045141 84
271 3300013296 Ga0157374_10037988 Ga0157374_100379883 84
272 3300013296 Ga0157374_10639192 Ga0157374_106391922 84
273 3300013296 Ga0157374_10645469 Ga0157374_106454691 84
274 3300013296 Ga0157374_10937960 Ga0157374_109379602 84
275 3300013297 Ga0157378_10014313 Ga0157378_100143136 84
276 3300013297 Ga0157378_10017619 Ga0157378_100176194 84
277 3300013297 Ga0157378_10393879 Ga0157378_103938793 84
278 3300013297 Ga0157378_11918036 Ga0157378_119180361 84
279 3300013306 Ga0163162_10000010 Ga0163162_1000001068 84
280 3300013306 Ga0163162_10009061 Ga0163162_100090615 84
281 3300013306 Ga0163162_10014100 Ga0163162_100141003 84
282 3300013306 Ga0163162_10777528 Ga0163162_107775282 84
283 3300013306 Ga0163162_10792889 Ga0163162_107928892 84
284 3300013306 Ga0163162_13367557 Ga0163162_133675571 84
285 3300013307 Ga0157372_10000050 Ga0157372_1000005097 84
286 3300013307 Ga0157372_10000266 Ga0157372_1000026637 84
287 3300013307 Ga0157372_10015188 Ga0157372_100151885 84
288 3300013307 Ga0157372_10504205 Ga0157372_105042052 84
289 3300013307 Ga0157372_10921406 Ga0157372_109214062 84
290 3300013307 Ga0157372_12593303 Ga0157372_125933032 84
291 3300013308 Ga0157375_10030029 Ga0157375_100300295 84
292 3300013308 Ga0157375_12315537 Ga0157375_123155372 84
293 3300014325 Ga0163163_11272844 Ga0163163_112728442 84
294 3300014497 Ga0182008_10285447 Ga0182008_102854472 84
295 3300014497 Ga0182008_10963165 Ga0182008_109631651 84
296 3300014745 Ga0157377_10066070 Ga0157377_100660704 84
297 3300014968 Ga0157379_11178742 Ga0157379_111787421 84
298 3300014969 Ga0157376_10186203 Ga0157376_101862033 84
299 3300015262 Ga0182007_10012304 Ga0182007_100123042 84
300 3300017792 Ga0163161_10058889 Ga0163161_100588893 84
301 3300020077 Ga0206351_10228156 Ga0206351_102281563 84
302 3300020077 Ga0206351_10956156 Ga0206351_109561562 84
303 3300020078 Ga0206352_10420157 Ga0206352_104201572 84
304 3300020078 Ga0206352_11006529 Ga0206352_110065292 84
305 3300020080 Ga0206350_10018749 Ga0206350_100187492 84
306 3300022467 Ga0224712_10170478 Ga0224712_101704781 84
307 3300025230 Ga0209563_106392 Ga0209563_1063922 84
308 3300025231 Ga0207427_100172 Ga0207427_10017260 84
309 3300025233 Ga0209437_100024 Ga0209437_100024288 84
310 3300025233 Ga0209437_100034 Ga0209437_100034165 84
311 3300025233 Ga0209437_132306 Ga0209437_1323061 84
312 3300025250 Ga0209026_1000219 Ga0209026_100021960 84
313 3300025250 Ga0209026_1003780 Ga0209026_10037804 84
314 3300025250 Ga0209026_1064020 Ga0209026_10640202 84
315 3300025258 Ga0209129_1011886 Ga0209129_10118864 84
316 3300025261 Ga0209233_1000038 Ga0209233_1000038165 84
317 3300025261 Ga0209233_1008430 Ga0209233_10084302 84
318 3300025272 Ga0209455_1009960 Ga0209455_10099603 84
319 3300025899 Ga0207642_10983838 Ga0207642_109838382 84
320 3300025904 Ga0207647_10000662 Ga0207647_1000066220 84
321 3300025904 Ga0207647_10006287 Ga0207647_1000628710 84
322 3300025907 Ga0207645_10001390 Ga0207645_1000139017 84
323 3300025909 Ga0207705_10000036 Ga0207705_1000003694 84
324 3300025909 Ga0207705_10040265 Ga0207705_100402653 84
325 3300025909 Ga0207705_10335301 Ga0207705_103353012 84
326 3300025911 Ga0207654_10005732 Ga0207654_100057323 84
327 3300025911 Ga0207654_10010341 Ga0207654_100103415 84
328 3300025911 Ga0207654_10289742 Ga0207654_102897422 84
329 3300025913 Ga0207695_10000013 Ga0207695_10000013265 84
330 3300025913 Ga0207695_10002721 Ga0207695_1000272125 84
331 3300025913 Ga0207695_10032015 Ga0207695_100320153 84
332 3300025913 Ga0207695_10052551 Ga0207695_100525515 84
333 3300025913 Ga0207695_10115813 Ga0207695_101158131 84
334 3300025913 Ga0207695_10262527 Ga0207695_102625272 84
335 3300025913 Ga0207695_10414687 Ga0207695_104146871 84
336 3300025913 Ga0207695_10452166 Ga0207695_104521662 84
337 3300025913 Ga0207695_10743307 Ga0207695_107433072 84
338 3300025913 Ga0207695_11126585 Ga0207695_111265851 84
339 3300025913 Ga0207695_11644736 Ga0207695_116447362 84
340 3300025914 Ga0207671_10000663 Ga0207671_100006634 84
341 3300025914 Ga0207671_10011406 Ga0207671_100114064 84
342 3300025914 Ga0207671_10012094 Ga0207671_100120946 84
343 3300025914 Ga0207671_10014472 Ga0207671_100144721 84
344 3300025914 Ga0207671_10207370 Ga0207671_102073701 84
345 3300025914 Ga0207671_10280646 Ga0207671_102806461 84
346 3300025914 Ga0207671_10341977 Ga0207671_103419773 84
347 3300025917 Ga0207660_11305773 Ga0207660_113057731 84
348 3300025919 Ga0207657_10034762 Ga0207657_100347623 84
349 3300025919 Ga0207657_10259514 Ga0207657_102595142 84
350 3300025919 Ga0207657_11260092 Ga0207657_112600921 84
351 3300025920 Ga0207649_11021365 Ga0207649_110213652 84
352 3300025921 Ga0207652_10183492 Ga0207652_101834922 84
353 3300025921 Ga0207652_10552855 Ga0207652_105528553 84
354 3300025924 Ga0207694_10185445 Ga0207694_101854453 84
355 3300025924 Ga0207694_10194814 Ga0207694_101948142 84
356 3300025924 Ga0207694_10378529 Ga0207694_103785292 84
357 3300025924 Ga0207694_10483596 Ga0207694_104835963 84
358 3300025927 Ga0207687_10325130 Ga0207687_103251302 84
359 3300025931 Ga0207644_10013787 Ga0207644_100137873 84
360 3300025932 Ga0207690_10008888 Ga0207690_100088883 84
361 3300025932 Ga0207690_10197366 Ga0207690_101973662 84
362 3300025932 Ga0207690_10410760 Ga0207690_104107603 84
363 3300025933 Ga0207706_10001262 Ga0207706_1000126219 84
364 3300025934 Ga0207686_10082643 Ga0207686_100826434 84
365 3300025937 Ga0207669_11484400 Ga0207669_114844001 84
366 3300025938 Ga0207704_10000044 Ga0207704_1000004454 84
367 3300025940 Ga0207691_10048348 Ga0207691_100483483 84
368 3300025942 Ga0207689_10382349 Ga0207689_103823492 84
369 3300025949 Ga0207667_10000009 Ga0207667_10000009369 84
370 3300025949 Ga0207667_10000971 Ga0207667_1000097113 84
371 3300025949 Ga0207667_10025169 Ga0207667_100251695 84
372 3300025949 Ga0207667_10041690 Ga0207667_100416906 84
373 3300025949 Ga0207667_10281087 Ga0207667_102810872 84
374 3300025949 Ga0207667_11137548 Ga0207667_111375481 84
375 3300025949 Ga0207667_11833266 Ga0207667_118332661 84
376 3300025960 Ga0207651_10045542 Ga0207651_100455425 84
377 3300025960 Ga0207651_11190766 Ga0207651_111907662 84
378 3300025981 Ga0207640_10642929 Ga0207640_106429292 84
379 3300025981 Ga0207640_11046360 Ga0207640_110463602 84
380 3300026023 Ga0207677_10012208 Ga0207677_100122086 84
381 3300026023 Ga0207677_10178101 Ga0207677_101781012 84
382 3300026035 Ga0207703_10064197 Ga0207703_100641974 84
383 3300026035 Ga0207703_10459593 Ga0207703_104595932 84
384 3300026041 Ga0207639_10008764 Ga0207639_100087647 84
385 3300026041 Ga0207639_10010971 Ga0207639_100109716 84
386 3300026041 Ga0207639_10818528 Ga0207639_108185282 84
387 3300026041 Ga0207639_10949974 Ga0207639_109499742 84
388 3300026067 Ga0207678_10006043 Ga0207678_1000604311 84
389 3300026067 Ga0207678_11084786 Ga0207678_110847862 84
390 3300026078 Ga0207702_10000797 Ga0207702_1000079730 84
391 3300026078 Ga0207702_10002698 Ga0207702_1000269817 84
392 3300026078 Ga0207702_10053362 Ga0207702_100533622 84
393 3300026078 Ga0207702_10070675 Ga0207702_100706751 84
394 3300026078 Ga0207702_10180597 Ga0207702_101805972 84
395 3300026078 Ga0207702_10197459 Ga0207702_101974593 84
396 3300026078 Ga0207702_11715499 Ga0207702_117154992 84
397 3300026088 Ga0207641_11902970 Ga0207641_119029702 84
398 3300026089 Ga0207648_10000529 Ga0207648_1000052921 84
399 3300026116 Ga0207674_10063810 Ga0207674_100638104 84
400 3300026116 Ga0207674_12085046 Ga0207674_120850462 84
401 3300026121 Ga0207683_10006840 Ga0207683_100068404 84
402 3300026142 Ga0207698_10003256 Ga0207698_1000325610 84
403 3300026142 Ga0207698_10192836 Ga0207698_101928362 84
404 3300026142 Ga0207698_10374545 Ga0207698_103745452 84
405 3300026142 Ga0207698_10892093 Ga0207698_108920931 84
406 3300028379 Ga0268266_10000089 Ga0268266_1000008960 84
407 3300028379 Ga0268266_11344546 Ga0268266_113445462 84
408 3300028786 Ga0307517_10010238 Ga0307517_100102383 84
409 3300028794 Ga0307515_10001997 Ga0307515_1000199725 84
410 3300028794 Ga0307515_10002629 Ga0307515_1000262939 84
411 3300028794 Ga0307515_10257372 Ga0307515_102573721 84
412 3300028800 Ga0265338_10100447 Ga0265338_101004473 84
413 3300030744 Ga0316181_1216241 Ga0316181_12162412 84
414 3300031251 Ga0265327_10005164 Ga0265327_100051645 84
415 3300031456 Ga0307513_10950926 Ga0307513_109509261 84
416 3300031548 Ga0307408_101016539 Ga0307408_1010165392 84
417 3300031901 Ga0307406_10916936 Ga0307406_109169362 84
418 3300031911 Ga0307412_10139269 Ga0307412_101392692 84
419 3300032002 Ga0307416_100346233 Ga0307416_1003462332 84
420 3300032002 Ga0307416_101406527 Ga0307416_1014065272 84
421 3300032004 Ga0307414_10952415 Ga0307414_109524152 84
422 3300032005 Ga0307411_11270653 Ga0307411_112706532 84
423 3300033179 Ga0307507_10000015 Ga0307507_1000001550 84
424 3300033180 Ga0307510_10011192 Ga0307510_100111925 84
425 3300033180 Ga0307510_10638502 Ga0307510_106385021 84
426 3300035115 Ga0373941_0013874 Ga0373941_0013874_855_1109 84
427 3300037312 Ga0395899_0000002 Ga0395899_0000002_1016175_1016429 84
428 3300037312 Ga0395899_0000640 Ga0395899_0000640_27273_27527 84
429 3300037312 Ga0395899_0001109 Ga0395899_0001109_22007_22261 84
430 3300037312 Ga0395899_0034511 Ga0395899_0034511_1535_1789 84
431 3300037312 Ga0395899_0692907 Ga0395899_0692907_240_494 84
432 3300037418 Ga0395900_0000277 Ga0395900_0000277_40648_40902 84
433 3300037418 Ga0395900_0001234 Ga0395900_0001234_20305_20559 84
434 3300037418 Ga0395900_0006335 Ga0395900_0006335_7025_7279 84
435 3300037418 Ga0395900_0230458 Ga0395900_0230458_543_797 84
436 3300037466 Ga0395898_0001918 Ga0395898_0001918_17127_17381 84
437 3300037466 Ga0395898_0629602 Ga0395898_0629602_456_710 84
438 3300037471 Ga0395905_0000068 Ga0395905_0000068_50364_50618 84
439 3300037471 Ga0395905_0003090 Ga0395905_0003090_807_1061 84
440 3300038443 Ga0395901_0000199 Ga0395901_0000199_18327_18581 84
441 3300038443 Ga0395901_0004520 Ga0395901_0004520_5311_5565 84
442 3300038443 Ga0395901_0196139 Ga0395901_0196139_817_1071 84
443 3300039447 Ga0436361_0817619 Ga0436361_0817619_3286_3540 84
444 3300041452 Ga0451793_1169538 Ga0451793_1169538_225_482 84
445 3300041452 Ga0451793_1799653 Ga0451793_1799653_180_434 84
446 3300041453 Ga0451797_1325986 Ga0451797_1325986_250_504 84
447 3300041458 Ga0451798_0143136 Ga0451798_0143136_148_405 84
448 3300041486 Ga0451807_0169192 Ga0451807_0169192_144_398 84
449 3300041496 Ga0451839_0634252 Ga0451839_0634252_99_353 84
450 3300042005 Ga0439448_0043695 Ga0439448_0043695_174_428 84
451 3300042876 Ga0451577_0000052 Ga0451577_0000052_114793_115047 84
452 3300044656 Ga0466969_0450908 Ga0466969_0450908_33_287 84
453 3300044684 Ga0466966_0285368 Ga0466966_0285368_307_561 84
454 3300044693 Ga0466961_0069939 Ga0466961_0069939_39_293 84
455 3300045049 Ga0466959_0035490 Ga0466959_0035490_95_349 84
456 3300045836 Ga0466958_0037027 Ga0466958_0037027_851_1105 84
457 3300046454 Ga0495592_0172053 Ga0495592_0172053_485_739 84
458 3300046459 Ga0495629_0704349 Ga0495629_0704349_290_544 84
459 3300046460 Ga0495638_0113534 Ga0495638_0113534_1038_1295 84
460 3300046462 Ga0495651_0050806 Ga0495651_0050806_1708_1962 84
461 3300046462 Ga0495651_0146754 Ga0495651_0146754_570_824 84
462 3300046463 Ga0495653_0905000 Ga0495653_0905000_260_514 84
463 3300046471 Ga0495650_0000087 Ga0495650_0000087_34171_34428 84
464 3300046471 Ga0495650_0029898 Ga0495650_0029898_763_1017 84
465 3300046471 Ga0495650_0195852 Ga0495650_0195852_381_635 84
466 3300046471 Ga0495650_0220109 Ga0495650_0220109_284_541 84
467 3300046474 Ga0495605_0187687 Ga0495605_0187687_375_632 84
468 3300046492 Ga0495585_0000286 Ga0495585_0000286_21766_22020 84
469 3300046492 Ga0495585_0000553 Ga0495585_0000553_18875_19129 84
470 3300046492 Ga0495585_0627575 Ga0495585_0627575_126_380 84
471 3300046500 Ga0495596_0354159 Ga0495596_0354159_216_470 84
472 3300046506 Ga0495583_0255405 Ga0495583_0255405_183_437 84
473 3300046507 Ga0495606_0000052 Ga0495606_0000052_160648_160905 84
474 3300046507 Ga0495606_0026825 Ga0495606_0026825_832_1089 84
475 3300046507 Ga0495606_0036546 Ga0495606_0036546_835_1089 84
476 3300046507 Ga0495606_0334316 Ga0495606_0334316_174_431 84
477 3300046512 Ga0495610_0009503 Ga0495610_0009503_726_980 84
478 3300046513 Ga0495616_0004909 Ga0495616_0004909_1475_1732 84
479 3300046513 Ga0495616_0011404 Ga0495616_0011404_1886_2143 84
480 3300046516 Ga0495628_0252297 Ga0495628_0252297_307_561 84
481 3300046518 Ga0495631_0010350 Ga0495631_0010350_164_418 84
482 3300046518 Ga0495631_0060149 Ga0495631_0060149_239_493 84
483 3300046520 Ga0495637_0021664 Ga0495637_0021664_2432_2686 84
484 3300046523 Ga0495644_0013350 Ga0495644_0013350_14_268 84
485 3300046524 Ga0495648_0001785 Ga0495648_0001785_16557_16811 84
486 3300046529 Ga0495652_0300791 Ga0495652_0300791_708_962 84
487 3300046538 Ga0495609_0006171 Ga0495609_0006171_3200_3457 84
488 3300046538 Ga0495609_0054407 Ga0495609_0054407_837_1091 84
489 3300046557 Ga0495622_0301639 Ga0495622_0301639_339_593 84
490 3300046558 Ga0495633_0000035 Ga0495633_0000035_138233_138487 84
491 3300046558 Ga0495633_0003276 Ga0495633_0003276_1515_1769 84
492 3300046616 Ga0495668_0000032 Ga0495668_0000032_58871_59125 84
493 3300046616 Ga0495668_0063399 Ga0495668_0063399_496_750 84
494 3300046648 Ga0495611_0169270 Ga0495611_0169270_495_749 84
495 3300046660 Ga0495625_0000008 Ga0495625_0000008_525518_525775 84
496 3300046660 Ga0495625_0000753 Ga0495625_0000753_14036_14290 84
497 3300046660 Ga0495625_0001038 Ga0495625_0001038_20040_20294 84
498 3300046660 Ga0495625_0014931 Ga0495625_0014931_2511_2765 84
499 3300046660 Ga0495625_0082824 Ga0495625_0082824_835_1092 84
500 3300046660 Ga0495625_0440802 Ga0495625_0440802_331_585 84
501 3300046665 Ga0495661_0021105 Ga0495661_0021105_740_994 84
502 3300046665 Ga0495661_0024218 Ga0495661_0024218_99_356 84
503 3300046665 Ga0495661_0113692 Ga0495661_0113692_48_302 84
504 3300046674 Ga0495588_0678674 Ga0495588_0678674_63_317 84
505 3300046674 Ga0495588_0747536 Ga0495588_0747536_217_474 84
506 3300046684 Ga0495669_0297390 Ga0495669_0297390_156_410 84
507 3300046691 Ga0495670_0550669 Ga0495670_0550669_172_426 84
508 3300046692 Ga0495671_0044452 Ga0495671_0044452_592_849 84
509 3300046692 Ga0495671_0125292 Ga0495671_0125292_909_1166 84
510 3300046694 Ga0495649_0000018 Ga0495649_0000018_10391_10648 84
511 3300046694 Ga0495649_0030579 Ga0495649_0030579_138_392 84
512 3300046810 Ga0495660_0222481 Ga0495660_0222481_97_351 84
513 3300047323 Ga0495683_0205678 Ga0495683_0205678_463_717 84
514 3300047443 Ga0495687_004055 Ga0495687_004055_6049_6303 84
515 3300047443 Ga0495687_095659 Ga0495687_095659_798_1055 84
516 3300047472 Ga0495686_0000052 Ga0495686_0000052_235993_236250 84
517 3300047472 Ga0495686_0451140 Ga0495686_0451140_268_522 84
518 3300048908 Ga0496105_1316464 Ga0496105_1316464_17_271 84
519 3300048918 Ga0496115_0489121 Ga0496115_0489121_377_631 84
520 3300048929 Ga0496126_0623681 Ga0496126_0623681_282_536 84
521 3300049568 Ga0501031_0001412 Ga0501031_0001412_11514_11768 84
522 3300049569 Ga0501032_0004349 Ga0501032_0004349_5744_5998 84
523 3300049569 Ga0501032_0090207 Ga0501032_0090207_868_1131 84
524 3300049570 Ga0501033_0000004 Ga0501033_0000004_38901_39155 84
525 3300049570 Ga0501033_0088260 Ga0501033_0088260_1175_1438 84
526 3300049571 Ga0501034_0000432 Ga0501034_0000432_53149_53403 84
527 3300049571 Ga0501034_0106289 Ga0501034_0106289_1300_1563 84
528 3300049571 Ga0501034_0459491 Ga0501034_0459491_667_921 84
529 3300049572 Ga0501036_0001406 Ga0501036_0001406_10301_10555 84
530 3300049572 Ga0501036_1368801 Ga0501036_1368801_247_510 84
531 3300049573 Ga0501037_0001513 Ga0501037_0001513_8957_9211 84
532 3300049573 Ga0501037_0112817 Ga0501037_0112817_147_410 84
533 3300049574 Ga0501038_0000748 Ga0501038_0000748_18499_18753 84
534 3300049574 Ga0501038_0173435 Ga0501038_0173435_1399_1653 84
535 3300049574 Ga0501038_0352683 Ga0501038_0352683_607_870 84
536 3300049575 Ga0501039_0002352 Ga0501039_0002352_3206_3460 84
537 3300049579 Ga0501043_0001385 Ga0501043_0001385_17750_18004 84
538 3300049579 Ga0501043_0057794 Ga0501043_0057794_1881_2144 84
539 3300049580 Ga0501046_0838410 Ga0501046_0838410_269_532 84
540 3300049581 Ga0501047_0000515 Ga0501047_0000515_33881_34144 84
541 3300049581 Ga0501047_0225885 Ga0501047_0225885_1370_1624 84
542 3300049582 Ga0501048_0077017 Ga0501048_0077017_100_354 84
543 3300049582 Ga0501048_0870689 Ga0501048_0870689_138_401 84
544 3300049586 Ga0501070_0216669 Ga0501070_0216669_101_364 84
545 3300049586 Ga0501070_0410872 Ga0501070_0410872_759_1022 84
546 3300049587 Ga0501071_0931434 Ga0501071_0931434_250_513 84
547 3300049671 Ga0501238_031256 Ga0501238_031256_399_656 84
548 3300049822 Ga0501035_0000657 Ga0501035_0000657_30872_31135 84
549 3300049822 Ga0501035_0019130 Ga0501035_0019130_3289_3543 84
550 3300049823 Ga0501044_0000349 Ga0501044_0000349_32805_33059 84
551 3300049823 Ga0501044_0001599 Ga0501044_0001599_7907_8170 84
552 3300049824 Ga0501045_0000028 Ga0501045_0000028_26587_26841 84
553 3300050493 nmdc:mga0k408_1225_c1 nmdc:mga0k408_1225_c1_11174_11428 84
554 3300050493 nmdc:mga0k408_157481_c1 nmdc:mga0k408_157481_c1_430_684 84
555 3300050493 nmdc:mga0k408_3989_c1 nmdc:mga0k408_3989_c1_307_561 84
556 3300050496 nmdc:mga07m45_94166_c1 nmdc:mga07m45_94166_c1_1175_1429 84
557 3300053080 Ga0500635_0000409 Ga0500635_0000409_6269_6523 84
558 3300053080 Ga0500635_0318088 Ga0500635_0318088_69_323 84
559 3300053086 Ga0500578_0706939 Ga0500578_0706939_80_337 84
560 3300053090 Ga0500646_0078702 Ga0500646_0078702_717_971 84
561 3300053098 Ga0500650_0125856 Ga0500650_0125856_742_996 84
562 3300053111 Ga0500572_193190 Ga0500572_193190_122_376 84
563 3300053122 Ga0500608_000203 Ga0500608_000203_4095_4349 84
564 3300053122 Ga0500608_171084 Ga0500608_171084_306_560 84
565 3300053125 Ga0500618_000037 Ga0500618_000037_22634_22888 84
566 3300053125 Ga0500618_041830 Ga0500618_041830_32_286 84
567 3300053130 Ga0500642_0028794 Ga0500642_0028794_927_1181 84
568 3300053131 Ga0500652_089431 Ga0500652_089431_207_464 84
569 3300053138 Ga0500564_091119 Ga0500564_091119_492_749 84
570 3300053153 Ga0500616_0089612 Ga0500616_0089612_1045_1302 84
571 3300053156 Ga0500622_0002943 Ga0500622_0002943_375_629 84
572 3300053157 Ga0500624_000572 Ga0500624_000572_5833_6090 84
573 3300053161 Ga0500634_0041116 Ga0500634_0041116_640_897 84
574 3300060353 Ga0501082_1848655 Ga0501082_1848655_14_268 84

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

19

95

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gtd-assembly1.cif.gz_B northeast structural genomics consortium (nesg id tt50) structure of mth169, the purs subunit of fgam synthetase 0.9038 4 81
1t4a-assembly1.cif.gz_A structure of b. subtilis purs c2 crystal form 0.8803 4 82
2yx5-assembly1.cif.gz_A crystal structure of methanocaldococcus jannaschii purs, one of the subunits of formylglycinamide ribonucleotide amidotransferase in the purine biosynthetic pathway 0.8617 4 84
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.8599 1 84
2zw2-assembly1.cif.gz_B crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs) 0.8514 3 84
ID Description Score Start End Superfamily
af_Q2FZJ2_1_81_3.30.1280.10 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.9231 1 82 3.30.1280.10
af_Q2FZJ2_1_81_3.30.1280.10 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.9018 1 82 3.30.1280.10
1gtdA00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8651 5 84 3.30.1280.10
2dgbA00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8627 3 84 3.30.1280.10
2yx5A00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8617 4 84 3.30.1280.10
ID Description Score Start End GO Terms
AF-A0A5C7US01-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.9943 3 84 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1F6QPQ4-F1-model_v4 Multifunctional fusion protein [Includes: Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (Phosphoribosylformylglycinamidine synthase subunit III) (FGAR amidotransferase III) (FGAR-AT III); Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase)] 0.9891 2 84 GO:0004639
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0009236
AF-I2GNQ8-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.9882 2 84 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A7C3LSR0-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.9859 3 84 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A2T0T0K1-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.984 2 84 GO:0004642
GO:0005524
GO:0005737
GO:0006189

Feature Viewer

pLDDT pTM Quality
96.43 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map