F465180

General Info

Members Datasets Scaffolds Average Seq Length
573 342 572 379

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10041806|Ga0114129_100418062
Length 415
Sequence MTADPKDFVPQETEVSVEAKASGAEAAVTRRPVPVRKPAAGRRRRMAGAFTIGIEEEYFLVDAETKLATRHMPEDFMRAAKSATDGRAGGEFLQSQVEVISSPHSSMAEARAELRHLRQTVAAVAAEHGLAILAAGTHPTAFWASSLQTPKERYDAVMHDLQMIGRRNMLCGMHVHVELPDPDDRVDVMCRMLPHLPLFLALSTSSPFWQARRTGLKGYRLAAYDELPRTGVPELFRTKEEFDAYIAALVRAGVIEDSSFVWWAIRPSFNHPTLELRAPDCCTLVNDTIAIAALYRTLARHLCFNPWRNFDLNAVSRAIVVENKWRAQRYGVNGTFVTEQGAVTVGEMLDQVIGQTAADAEALGCTEEIRRCRSIVSAGTSADAQLAVYEAHKDSKDREAALRAVTDWIASATLQ

Samples

Sample ID Description Type Environment
1 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
176 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
177 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
194 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
239 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
341 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
342 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0.17
Rhizoplane 12.57
Rhizosphere 79.58
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10030376 3300001990 Bacteria 1691
2 JGI24750J21931_1002148 3300002070 Bacteria 2392
3 JGI24744J21845_10000578 3300002077 Bacteria 6564
4 JGI24744J21845_10023387 3300002077 Bacteria 1210
5 JGI24034J26672_10003395 3300002239 Bacteria 2220
6 JGI24742J22300_10000829 3300002244 Bacteria 4722
7 JGI25406J46586_10022199 3300003203 Bacteria 2534
8 JGI25153J46596_10000660 3300003215 Bacteria 21135
9 Ga0070676_10083523 3300005328 Bacteria 1943
10 Ga0070690_100046659 3300005330 Bacteria 2755
11 Ga0070670_100074499 3300005331 Bacteria 2916
12 Ga0070677_10022053 3300005333 Bacteria 2341
13 Ga0070677_10024627 3300005333 Bacteria 2240
14 Ga0070666_10020181 3300005335 Bacteria 4307
15 Ga0070680_100008893 3300005336 Bacteria 7698
16 Ga0068868_100004344 3300005338 Bacteria 9938
17 Ga0068868_100007586 3300005338 Bacteria 7731
18 Ga0070660_100014295 3300005339 Bacteria 5716
19 Ga0070689_100013414 3300005340 Bacteria 5930
20 Ga0070689_100025225 3300005340 Bacteria 4465
21 Ga0070687_100007221 3300005343 Bacteria 4613
22 Ga0070687_100014015 3300005343 Bacteria 3590
23 Ga0070687_100039569 3300005343 Bacteria 2370
24 Ga0070668_100037206 3300005347 Bacteria 3715
25 Ga0070669_100020211 3300005353 Bacteria 4756
26 Ga0070675_100003175 3300005354 Bacteria 12436
27 Ga0070675_100032579 3300005354 Bacteria 4219
28 Ga0070675_100141672 3300005354 Bacteria 2055
29 Ga0070675_100211756 3300005354 Bacteria 1685
30 Ga0070674_100001401 3300005356 Bacteria 12771
31 Ga0070673_100006028 3300005364 Bacteria 7850
32 Ga0070673_100124261 3300005364 Bacteria 2157
33 Ga0070688_100012050 3300005365 Bacteria 4830
34 Ga0070688_100038258 3300005365 Bacteria 2928
35 Ga0070659_100007701 3300005366 Bacteria 7833
36 Ga0070667_100025917 3300005367 Bacteria 4877
37 Ga0070703_10015721 3300005406 Bacteria 2167
38 Ga0070714_100199678 3300005435 Bacteria 1829
39 Ga0070714_100272261 3300005435 Bacteria 1570
40 Ga0070713_100077695 3300005436 Bacteria 2823
41 Ga0070713_100081966 3300005436 Bacteria 2754
42 Ga0070713_100122292 3300005436 Bacteria 2284
43 Ga0070710_10011557 3300005437 Bacteria 4365
44 Ga0070701_10151563 3300005438 Bacteria 1335
45 Ga0070711_100105348 3300005439 Bacteria 2060
46 Ga0070711_100145987 3300005439 Bacteria 1779
47 Ga0070711_100226830 3300005439 Bacteria 1455
48 Ga0070700_100012600 3300005441 Bacteria 4725
49 Ga0070663_100005197 3300005455 Bacteria 7708
50 Ga0070678_100151313 3300005456 Bacteria 1869
51 Ga0070662_100006574 3300005457 Bacteria 7502
52 Ga0070681_10309341 3300005458 Bacteria 1489
53 Ga0068867_100212687 3300005459 Bacteria 1554
54 Ga0070685_10030514 3300005466 Bacteria 3005
55 Ga0070707_100218183 3300005468 Bacteria 1858
56 Ga0070699_100003706 3300005518 Bacteria 13512
57 Ga0070679_100060447 3300005530 Bacteria 3776
58 Ga0070684_100059514 3300005535 Bacteria 3340
59 Ga0068853_100055305 3300005539 Bacteria 3421
60 Ga0070672_100000898 3300005543 Bacteria 17888
61 Ga0070672_100269402 3300005543 Bacteria 1438
62 Ga0070686_100055026 3300005544 Bacteria 2547
63 Ga0070695_100084693 3300005545 Bacteria 2104
64 Ga0070665_100009985 3300005548 Bacteria 9604
65 Ga0070704_100043161 3300005549 Bacteria 3124
66 Ga0070704_100067986 3300005549 Bacteria 2575
67 Ga0068857_100308745 3300005577 Bacteria 1459
68 Ga0068854_100018289 3300005578 Bacteria 4703
69 Ga0068856_100026810 3300005614 Bacteria 5619
70 Ga0070702_100003350 3300005615 Bacteria 7153
71 Ga0068852_100004585 3300005616 Bacteria 9785
72 Ga0068859_100040777 3300005617 Bacteria 4662
73 Ga0068859_100086478 3300005617 Bacteria 3182
74 Ga0068859_100200924 3300005617 Bacteria 2078
75 Ga0068864_100007736 3300005618 Bacteria 8855
76 Ga0068864_100154167 3300005618 Bacteria 2084
77 Ga0068866_10002579 3300005718 Bacteria 7476
78 Ga0068866_10120109 3300005718 Bacteria 1480
79 Ga0068861_100002506 3300005719 Bacteria 11987
80 Ga0068851_10014563 3300005834 Bacteria 3736
81 Ga0068870_10001759 3300005840 Bacteria 8883
82 Ga0068863_100006002 3300005841 Bacteria 11910
83 Ga0068863_100224650 3300005841 Bacteria 1810
84 Ga0068858_100004133 3300005842 Bacteria 14288
85 Ga0068858_100131455 3300005842 Bacteria 2348
86 Ga0068858_100156834 3300005842 Bacteria 2142
87 Ga0068860_100003806 3300005843 Bacteria 15525
88 Ga0068862_100006027 3300005844 Bacteria 10093
89 Ga0081455_10001263 3300005937 Bacteria 31603
90 Ga0081455_10011029 3300005937 Bacteria 9102
91 Ga0081455_10066743 3300005937 Bacteria 3002
92 Ga0081538_10023004 3300005981 Bacteria 4493
93 Ga0081538_10031421 3300005981 Bacteria 3582
94 Ga0081538_10064119 3300005981 Bacteria 2080
95 Ga0081540_1000128 3300005983 Bacteria 80512
96 Ga0081540_1001551 3300005983 Bacteria 19695
97 Ga0081540_1015315 3300005983 Bacteria 4859
98 Ga0081539_10005924 3300005985 Bacteria 12071
99 Ga0070717_10166242 3300006028 Bacteria 1916
100 Ga0075365_10030693 3300006038 Bacteria 3445
101 Ga0075365_10045180 3300006038 Bacteria 2889
102 Ga0075363_100003705 3300006048 Bacteria 6571
103 Ga0075364_10003468 3300006051 Bacteria 8974
104 Ga0075364_10082766 3300006051 Bacteria 2123
105 Ga0070715_10017966 3300006163 Bacteria 2687
106 Ga0070712_100000277 3300006175 Bacteria 28821
107 Ga0070712_100033236 3300006175 Bacteria 3489
108 Ga0075362_10003019 3300006177 Bacteria 5788
109 Ga0075367_10051084 3300006178 Bacteria 2443
110 Ga0075367_10078787 3300006178 Bacteria 1990
111 Ga0075369_10021975 3300006186 Bacteria 2628
112 Ga0075369_10063447 3300006186 Bacteria 1616
113 Ga0075366_10004591 3300006195 Bacteria 7420
114 Ga0075366_10114544 3300006195 Bacteria 1623
115 Ga0075370_10057860 3300006353 Bacteria 2204
116 Ga0075370_10099695 3300006353 Bacteria 1680
117 Ga0068871_100122539 3300006358 Bacteria 2198
118 Ga0075428_100023040 3300006844 Bacteria 6892
119 Ga0075428_100182810 3300006844 Bacteria 2269
120 Ga0075428_100220814 3300006844 Bacteria 2046
121 Ga0075428_100378490 3300006844 Bacteria 1518
122 Ga0075430_100000067 3300006846 Bacteria 56477
123 Ga0075430_100008377 3300006846 Bacteria 8735
124 Ga0075430_100142128 3300006846 Bacteria 1999
125 Ga0075431_100037781 3300006847 Bacteria 4972
126 Ga0075431_100077637 3300006847 Bacteria 3427
127 Ga0075431_100154771 3300006847 Bacteria 2359
128 Ga0075431_100260294 3300006847 Bacteria 1761
129 Ga0075433_10283037 3300006852 Bacteria 1469
130 Ga0075434_100055145 3300006871 Bacteria 3950
131 Ga0075434_100178134 3300006871 Bacteria 2146
132 Ga0075434_100419840 3300006871 Bacteria 1359
133 Ga0075429_100008809 3300006880 Bacteria 8774
134 Ga0075429_100355379 3300006880 Bacteria 1283
135 Ga0068865_100009041 3300006881 Bacteria 6163
136 Ga0075436_100020342 3300006914 Bacteria 4556
137 Ga0075436_100180185 3300006914 Bacteria 1493
138 Ga0097620_100040774 3300006931 Bacteria 4662
139 Ga0097620_100086478 3300006931 Bacteria 3182
140 Ga0097620_100200932 3300006931 Bacteria 2078
141 Ga0075435_100047464 3300007076 Bacteria 3449
142 Ga0075435_100089017 3300007076 Bacteria 2544
143 Ga0099794_10015586 3300007265 Bacteria 3358
144 Ga0099795_10053585 3300007788 Bacteria 1477
145 Ga0111539_10008081 3300009094 Bacteria 13410
146 Ga0111539_10100625 3300009094 Bacteria 3394
147 Ga0111539_10403851 3300009094 Bacteria 1591
148 Ga0105245_10005857 3300009098 Bacteria 10792
149 Ga0105245_10119478 3300009098 Bacteria 2461
150 Ga0105245_10143174 3300009098 Bacteria 2254
151 Ga0105247_10009817 3300009101 Bacteria 5799
152 Ga0105247_10035426 3300009101 Bacteria 3042
153 Ga0114129_10020121 3300009147 Bacteria 9499
154 Ga0114129_10041806 3300009147 Bacteria 6454
155 Ga0114129_10114799 3300009147 Bacteria 3713
156 Ga0114129_10123887 3300009147 Bacteria 3554
157 Ga0114129_10182444 3300009147 Bacteria 2855
158 Ga0114129_10319796 3300009147 Bacteria 2063
159 Ga0105241_10301551 3300009174 Bacteria 1375
160 Ga0105242_10019227 3300009176 Bacteria 5351
161 Ga0105248_10012271 3300009177 Bacteria 9449
162 Ga0105248_10111763 3300009177 Bacteria 3081
163 Ga0105237_10422771 3300009545 Bacteria 1338
164 Ga0105238_10066854 3300009551 Bacteria 3595
165 Ga0105238_10091916 3300009551 Bacteria 3022
166 Ga0099796_10007009 3300010159 Unclassified 2921
167 Ga0105239_10007446 3300010375 Bacteria 12562
168 Ga0105239_10040888 3300010375 Bacteria 5081
169 Ga0105239_10157686 3300010375 Bacteria 2535
170 Ga0105246_10060010 3300011119 Bacteria 2641
171 Ga0105246_10075208 3300011119 Bacteria 2390
172 Ga0105246_10194209 3300011119 Bacteria 1573
173 Ga0157374_10017453 3300013296 Bacteria 6320
174 Ga0157374_10177838 3300013296 Bacteria 2077
175 Ga0157378_10013150 3300013297 Bacteria 7241
176 Ga0157378_10164417 3300013297 Bacteria 2078
177 Ga0163162_10006545 3300013306 Bacteria 11286
178 Ga0157372_10378462 3300013307 Bacteria 1650
179 Ga0157375_10006121 3300013308 Bacteria 10489
180 Ga0163163_10016469 3300014325 Bacteria 6873
181 Ga0163163_10036482 3300014325 Bacteria 4776
182 Ga0157380_10003267 3300014326 Bacteria 11108
183 Ga0157380_10447022 3300014326 Bacteria 1240
184 Ga0157377_10016261 3300014745 Bacteria 3823
185 Ga0157379_10005247 3300014968 Bacteria 11127
186 Ga0157376_10199081 3300014969 Bacteria 1841
187 Ga0163161_10003329 3300017792 Bacteria 11266
188 Ga0213872_10000559 3300021361 Bacteria 28845
189 Ga0213872_10000896 3300021361 Bacteria 21421
190 Ga0213872_10001399 3300021361 Bacteria 15889
191 Ga0213872_10005016 3300021361 Bacteria 6873
192 Ga0213872_10020207 3300021361 Bacteria 3068
193 Ga0209233_1006297 3300025261 Bacteria 3838
194 Ga0209455_1001095 3300025272 Bacteria 13326
195 Ga0209758_1000772 3300025297 Bacteria 45993
196 Ga0207697_10024543 3300025315 Bacteria 2468
197 Ga0207653_10036532 3300025885 Bacteria 1601
198 Ga0207682_10002142 3300025893 Bacteria 8946
199 Ga0207682_10024955 3300025893 Bacteria 2370
200 Ga0207642_10001398 3300025899 Bacteria 7482
201 Ga0207710_10010515 3300025900 Bacteria 3899
202 Ga0207688_10002031 3300025901 Bacteria 10865
203 Ga0207680_10037799 3300025903 Bacteria 2789
204 Ga0207685_10011888 3300025905 Bacteria 2637
205 Ga0207699_10032085 3300025906 Bacteria 2956
206 Ga0207645_10007050 3300025907 Bacteria 7998
207 Ga0207643_10001570 3300025908 Bacteria 12954
208 Ga0207643_10010100 3300025908 Bacteria 5074
209 Ga0207654_10070492 3300025911 Bacteria 2075
210 Ga0207707_10128085 3300025912 Bacteria 2220
211 Ga0207693_10001633 3300025915 Bacteria 19798
212 Ga0207693_10026048 3300025915 Bacteria 4632
213 Ga0207693_10090145 3300025915 Bacteria 2403
214 Ga0207693_10199852 3300025915 Bacteria 1572
215 Ga0207663_10086482 3300025916 Bacteria 2068
216 Ga0207663_10122842 3300025916 Bacteria 1781
217 Ga0207660_10136740 3300025917 Bacteria 1870
218 Ga0207662_10009133 3300025918 Bacteria 5449
219 Ga0207662_10022123 3300025918 Bacteria 3641
220 Ga0207662_10062016 3300025918 Bacteria 2246
221 Ga0207662_10063893 3300025918 Bacteria 2214
222 Ga0207657_10090268 3300025919 Bacteria 2557
223 Ga0207657_10098290 3300025919 Bacteria 2433
224 Ga0207652_10014131 3300025921 Bacteria 6464
225 Ga0207681_10178401 3300025923 Bacteria 1616
226 Ga0207694_10141759 3300025924 Bacteria 1933
227 Ga0207694_10207466 3300025924 Bacteria 1595
228 Ga0207650_10001375 3300025925 Bacteria 17538
229 Ga0207659_10008042 3300025926 Bacteria 6529
230 Ga0207659_10050918 3300025926 Bacteria 2944
231 Ga0207687_10014594 3300025927 Bacteria 5142
232 Ga0207687_10076609 3300025927 Bacteria 2403
233 Ga0207700_10114479 3300025928 Bacteria 2176
234 Ga0207700_10116611 3300025928 Bacteria 2158
235 Ga0207700_10290624 3300025928 Bacteria 1409
236 Ga0207664_10119826 3300025929 Bacteria 2201
237 Ga0207644_10004097 3300025931 Bacteria 9446
238 Ga0207644_10193618 3300025931 Bacteria 1600
239 Ga0207706_10001850 3300025933 Bacteria 20737
240 Ga0207706_10020785 3300025933 Bacteria 5896
241 Ga0207670_10002865 3300025936 Bacteria 9096
242 Ga0207670_10041087 3300025936 Bacteria 3039
243 Ga0207669_10003999 3300025937 Bacteria 6444
244 Ga0207669_10016637 3300025937 Bacteria 3743
245 Ga0207704_10056295 3300025938 Bacteria 2408
246 Ga0207665_10193350 3300025939 Bacteria 1479
247 Ga0207691_10001076 3300025940 Bacteria 27185
248 Ga0207691_10002814 3300025940 Bacteria 16962
249 Ga0207691_10260354 3300025940 Bacteria 1495
250 Ga0207711_10003227 3300025941 Bacteria 14209
251 Ga0207711_10014418 3300025941 Bacteria 6564
252 Ga0207689_10008025 3300025942 Bacteria 9211
253 Ga0207689_10038993 3300025942 Bacteria 3934
254 Ga0207661_10062370 3300025944 Bacteria 3016
255 Ga0207679_10017058 3300025945 Bacteria 4833
256 Ga0207651_10062039 3300025960 Bacteria 2603
257 Ga0207712_10126545 3300025961 Bacteria 1941
258 Ga0207668_10017784 3300025972 Bacteria 4461
259 Ga0207658_10196557 3300025986 Bacteria 1680
260 Ga0207677_10005514 3300026023 Bacteria 6873
261 Ga0207677_10016802 3300026023 Bacteria 4345
262 Ga0207639_10062323 3300026041 Bacteria 2883
263 Ga0207678_10005280 3300026067 Bacteria 11569
264 Ga0207708_10004126 3300026075 Bacteria 10691
265 Ga0207708_10241774 3300026075 Bacteria 1452
266 Ga0207702_10023972 3300026078 Bacteria 5063
267 Ga0207641_10005434 3300026088 Bacteria 10875
268 Ga0207641_10299956 3300026088 Bacteria 1517
269 Ga0207648_10015137 3300026089 Bacteria 7099
270 Ga0207648_10086844 3300026089 Bacteria 2729
271 Ga0207676_10002920 3300026095 Bacteria 12181
272 Ga0207676_10176644 3300026095 Bacteria 1866
273 Ga0207676_10475390 3300026095 Bacteria 1182
274 Ga0207675_100000944 3300026118 Bacteria 29022
275 Ga0209179_1004468 3300027512 Bacteria 2113
276 Ga0209588_1032280 3300027671 Bacteria 1677
277 Ga0268266_10012800 3300028379 Bacteria 7246
278 Ga0268265_10027494 3300028380 Bacteria 4061
279 Ga0268264_10011715 3300028381 Bacteria 7232
280 Ga0265337_1007649 3300028556 Bacteria 4025
281 Ga0265319_1003972 3300028563 Bacteria 7507
282 Ga0265334_10003484 3300028573 Bacteria 7149
283 Ga0265323_10002861 3300028653 Bacteria 7753
284 Ga0265336_10000389 3300028666 Bacteria 27626
285 Ga0265338_10000176 3300028800 Bacteria 118726
286 Ga0265324_10004317 3300029957 Bacteria 6479
287 Ga0265330_10041807 3300031235 Bacteria 2032
288 Ga0265332_10022996 3300031238 Bacteria 2750
289 Ga0265320_10008917 3300031240 Bacteria 6092
290 Ga0265325_10000305 3300031241 Bacteria 34555
291 Ga0265329_10015683 3300031242 Bacteria 2642
292 Ga0265329_10030727 3300031242 Bacteria 1749
293 Ga0265340_10010579 3300031247 Bacteria 4932
294 Ga0265340_10015095 3300031247 Bacteria 4019
295 Ga0265340_10041595 3300031247 Bacteria 2258
296 Ga0265339_10056400 3300031249 Bacteria 2127
297 Ga0265339_10099024 3300031249 Bacteria 1520
298 Ga0265331_10069353 3300031250 Bacteria 1651
299 Ga0265316_10048387 3300031344 Bacteria 3356
300 Ga0265316_10195443 3300031344 Bacteria 1501
301 Ga0265313_10025765 3300031595 Bacteria 3109
302 Ga0265314_10028660 3300031711 Bacteria 4149
303 Ga0265342_10000109 3300031712 Bacteria 91321
304 Ga0265342_10043953 3300031712 Bacteria 2694
305 Ga0265342_10048477 3300031712 Bacteria 2546
306 Ga0373944_0031816 3300035089 Bacteria 1590
307 Ga0373923_0002028 3300035111 Bacteria 6099
308 Ga0373932_0043865 3300035112 Bacteria 1302
309 Ga0373936_0001332 3300035113 Bacteria 8962
310 Ga0373939_0010545 3300035114 Bacteria 2313
311 Ga0373941_0017529 3300035115 Bacteria 1964
312 Ga0373953_0068991 3300035117 Bacteria 1456
313 Ga0373954_0009547 3300035118 Bacteria 4268
314 Ga0373943_0001174 3300035170 Bacteria 11694
315 Ga0373946_0013528 3300035171 Bacteria 3069
316 Ga0373955_0000069 3300035172 Bacteria 41106
317 Ga0373961_0013304 3300035241 Bacteria 2073
318 Ga0373924_0000869 3300035410 Bacteria 9505
319 Ga0373931_0000835 3300035691 Bacteria 12936
320 Ga0373931_0007500 3300035691 Bacteria 5136
321 Ga0373931_0219802 3300035691 Bacteria 1143
322 Ga0373935_0000938 3300035692 Bacteria 15787
323 Ga0373927_0001966 3300035695 Bacteria 15156
324 Ga0373927_0011117 3300035695 Bacteria 5996
325 Ga0373927_0045006 3300035695 Bacteria 2855
326 Ga0373933_0001354 3300035724 Bacteria 14445
327 Ga0373933_0092929 3300035724 Bacteria 1864
328 Ga0373947_0001670 3300035725 Bacteria 13583
329 Ga0373947_0077794 3300035725 Bacteria 2046
330 Ga0373937_0000356 3300036401 Bacteria 42503
331 Ga0373937_0052822 3300036401 Bacteria 3728
332 Ga0373925_0000462 3300037068 Bacteria 40936
333 Ga0373925_0248657 3300037068 Bacteria 1426
334 Ga0395900_0260560 3300037418 Bacteria 1732
335 Ga0395901_0112636 3300038443 Bacteria 2857
336 Ga0436365_0015250 3300039437 Bacteria 5764
337 Ga0436365_0394916 3300039437 Bacteria 7521
338 Ga0436361_0020532 3300039447 Bacteria 44080
339 Ga0436361_0129646 3300039447 Bacteria 9661
340 Ga0436361_0142459 3300039447 Bacteria 45175
341 Ga0436361_0423477 3300039447 Bacteria 1939
342 Ga0436361_0450698 3300039447 Bacteria 8556
343 Ga0436361_0497647 3300039447 Bacteria 1644
344 Ga0436361_0572145 3300039447 Bacteria 42313
345 Ga0436361_0797374 3300039447 Bacteria 2000
346 Ga0436361_0892205 3300039447 Bacteria 3129
347 Ga0439460_0015132 3300042461 Bacteria 2038
348 Ga0466971_0067674 3300044719 Bacteria 1619
349 Ga0466959_0143938 3300045049 Bacteria 1683
350 Ga0466958_0000314 3300045836 Bacteria 19212
351 Ga0495592_0000090 3300046454 Bacteria 80171
352 Ga0495603_0062537 3300046455 Bacteria 2197
353 Ga0495629_0071834 3300046459 Bacteria 2415
354 Ga0495629_0104385 3300046459 Bacteria 1977
355 Ga0495641_0036499 3300046461 Bacteria 2309
356 Ga0495651_0000682 3300046462 Bacteria 26412
357 Ga0495653_0000322 3300046463 Bacteria 38965
358 Ga0495582_0042181 3300046473 Bacteria 2514
359 Ga0495605_0055995 3300046474 Bacteria 1903
360 Ga0495662_0001023 3300046476 Bacteria 13709
361 Ga0495664_0000078 3300046477 Bacteria 47377
362 Ga0495584_0092106 3300046491 Bacteria 1529
363 Ga0495594_0021004 3300046499 Bacteria 3483
364 Ga0495608_0000022 3300046511 Bacteria 165111
365 Ga0495618_0000229 3300046514 Bacteria 40948
366 Ga0495628_0000035 3300046516 Bacteria 111560
367 Ga0495630_0000377 3300046517 Bacteria 35153
368 Ga0495630_0092713 3300046517 Bacteria 2283
369 Ga0495652_0000062 3300046529 Bacteria 111572
370 Ga0495665_0036019 3300046531 Bacteria 2642
371 Ga0495640_0000021 3300046533 Bacteria 110511
372 Ga0495640_0094009 3300046533 Bacteria 1975
373 Ga0495587_0000006 3300046536 Bacteria 310070
374 Ga0495609_0029391 3300046538 Bacteria 2503
375 Ga0495645_0000174 3300046543 Bacteria 44827
376 Ga0495667_0000161 3300046559 Bacteria 45781
377 Ga0495656_0001474 3300046615 Bacteria 7707
378 Ga0495656_0062586 3300046615 Bacteria 1628
379 Ga0495634_0000350 3300046642 Bacteria 44772
380 Ga0495635_0000018 3300046663 Bacteria 193591
381 Ga0495661_0139652 3300046665 Bacteria 1319
382 Ga0495657_0000245 3300046675 Bacteria 49381
383 Ga0495599_0000032 3300046678 Bacteria 108178
384 Ga0495623_0000004 3300046679 Bacteria 142249
385 Ga0495646_0000083 3300046680 Bacteria 45193
386 Ga0495647_0020993 3300046681 Bacteria 2349
387 Ga0495658_0006621 3300046683 Bacteria 5694
388 Ga0495658_0082083 3300046683 Bacteria 1894
389 Ga0495658_0094956 3300046683 Bacteria 1771
390 Ga0495613_0081717 3300046689 Bacteria 2347
391 Ga0495670_0076295 3300046691 Bacteria 1703
392 Ga0495600_0000022 3300046809 Bacteria 94789
393 Ga0495581_0026783 3300047315 Bacteria 3342
394 Ga0495604_0000011 3300047317 Bacteria 292024
395 Ga0495674_0000034 3300047319 Bacteria 110674
396 Ga0495676_0092637 3300047321 Bacteria 2255
397 Ga0495680_0000290 3300047322 Bacteria 56506
398 Ga0495675_0000352 3300047444 Bacteria 32304
399 Ga0495677_0031302 3300047445 Bacteria 1937
400 Ga0495684_0000012 3300047471 Bacteria 187118
401 Ga0495593_0005499 3300047673 Bacteria 7477
402 Ga0495602_0000064 3300048088 Bacteria 104858
403 Ga0495615_0022196 3300048090 Bacteria 1441
404 Ga0496100_0007364 3300048903 Bacteria 6066
405 Ga0496100_0078035 3300048903 Bacteria 2228
406 Ga0496100_0108032 3300048903 Bacteria 1928
407 Ga0496101_0002534 3300048904 Bacteria 11221
408 Ga0496101_0009345 3300048904 Bacteria 6442
409 Ga0496101_0022365 3300048904 Bacteria 4352
410 Ga0496102_0031690 3300048905 Bacteria 4744
411 Ga0496102_0044380 3300048905 Unclassified 4034
412 Ga0496102_0047152 3300048905 Bacteria 3914
413 Ga0496103_0002040 3300048906 Bacteria 12961
414 Ga0496103_0030032 3300048906 Bacteria 3305
415 Ga0496103_0096621 3300048906 Bacteria 1867
416 Ga0496104_0001609 3300048907 Bacteria 19461
417 Ga0496104_0002163 3300048907 Bacteria 17059
418 Ga0496104_0011126 3300048907 Bacteria 8051
419 Ga0496104_0289415 3300048907 Bacteria 1550
420 Ga0496105_0000754 3300048908 Bacteria 21960
421 Ga0496105_0006795 3300048908 Bacteria 8799
422 Ga0496105_0017420 3300048908 Bacteria 5759
423 Ga0496105_0063432 3300048908 Bacteria 3048
424 Ga0496105_0065563 3300048908 Bacteria 2997
425 Ga0496105_0119900 3300048908 Bacteria 2169
426 Ga0496106_0001803 3300048909 Bacteria 16006
427 Ga0496106_0003637 3300048909 Bacteria 11498
428 Ga0496106_0039379 3300048909 Bacteria 3540
429 Ga0496106_0045309 3300048909 Bacteria 3303
430 Ga0496106_0301953 3300048909 Bacteria 1284
431 Ga0496107_0000810 3300048910 Bacteria 18168
432 Ga0496107_0060281 3300048910 Bacteria 2746
433 Ga0496107_0157447 3300048910 Bacteria 1682
434 Ga0496108_0005275 3300048911 Bacteria 10432
435 Ga0496108_0005539 3300048911 Bacteria 10217
436 Ga0496108_0010861 3300048911 Bacteria 7392
437 Ga0496108_0018930 3300048911 Bacteria 5646
438 Ga0496108_0215129 3300048911 Bacteria 1669
439 Ga0496109_0001755 3300048912 Bacteria 18034
440 Ga0496109_0003548 3300048912 Bacteria 13018
441 Ga0496109_0008088 3300048912 Bacteria 8915
442 Ga0496109_0043286 3300048912 Bacteria 4081
443 Ga0496109_0120921 3300048912 Bacteria 2439
444 Ga0496109_0158562 3300048912 Bacteria 2119
445 Ga0496110_0000282 3300048913 Bacteria 33145
446 Ga0496110_0001702 3300048913 Bacteria 16176
447 Ga0496110_0003425 3300048913 Bacteria 12136
448 Ga0496110_0016646 3300048913 Bacteria 6141
449 Ga0496110_0062726 3300048913 Bacteria 3283
450 Ga0496110_0121018 3300048913 Bacteria 2358
451 Ga0496110_0401201 3300048913 Bacteria 1250
452 Ga0496111_0001059 3300048914 Bacteria 15163
453 Ga0496111_0003144 3300048914 Bacteria 10159
454 Ga0496111_0018711 3300048914 Bacteria 4801
455 Ga0496111_0028517 3300048914 Bacteria 3956
456 Ga0496111_0164772 3300048914 Bacteria 1646
457 Ga0496112_0009122 3300048915 Bacteria 8913
458 Ga0496112_0022123 3300048915 Bacteria 6056
459 Ga0496112_0030580 3300048915 Bacteria 5212
460 Ga0496112_0106728 3300048915 Bacteria 2770
461 Ga0496112_0188225 3300048915 Bacteria 2027
462 Ga0496113_0000933 3300048916 Bacteria 15522
463 Ga0496113_0002455 3300048916 Bacteria 10796
464 Ga0496113_0005049 3300048916 Bacteria 8192
465 Ga0496114_0002210 3300048917 Bacteria 14814
466 Ga0496114_0004133 3300048917 Bacteria 11229
467 Ga0496114_0027277 3300048917 Bacteria 4677
468 Ga0496114_0143756 3300048917 Bacteria 2067
469 Ga0496115_0007233 3300048918 Bacteria 8159
470 Ga0496115_0012531 3300048918 Bacteria 6385
471 Ga0496115_0101829 3300048918 Bacteria 2355
472 Ga0496115_0129801 3300048918 Bacteria 2077
473 Ga0496115_0129982 3300048918 Bacteria 2075
474 Ga0496115_0138372 3300048918 Bacteria 2008
475 Ga0496115_0168678 3300048918 Bacteria 1810
476 Ga0496121_0016256 3300048924 Bacteria 7696
477 Ga0501031_0005837 3300049568 Bacteria 8023
478 Ga0501032_0119854 3300049569 Bacteria 1740
479 Ga0501033_0084935 3300049570 Bacteria 2319
480 Ga0501034_0050156 3300049571 Bacteria 4210
481 Ga0501034_0060014 3300049571 Bacteria 3820
482 Ga0501034_0207973 3300049571 Bacteria 1913
483 Ga0501036_0008715 3300049572 Bacteria 8320
484 Ga0501037_0010069 3300049573 Bacteria 6935
485 Ga0501038_0010460 3300049574 Bacteria 8485
486 Ga0501039_0041648 3300049575 Bacteria 3548
487 Ga0501039_0149434 3300049575 Bacteria 1836
488 Ga0501042_0024204 3300049578 Bacteria 4257
489 Ga0501043_0046681 3300049579 Bacteria 3406
490 Ga0501046_0004428 3300049580 Bacteria 12750
491 Ga0501047_0082281 3300049581 Bacteria 3094
492 Ga0501047_0197597 3300049581 Bacteria 1873
493 Ga0501048_0008331 3300049582 Bacteria 7838
494 Ga0501067_0051201 3300049583 Bacteria 2289
495 Ga0501067_0071604 3300049583 Bacteria 1920
496 Ga0501068_0010438 3300049584 Bacteria 5219
497 Ga0501069_0021567 3300049585 Bacteria 3497
498 Ga0501071_0051618 3300049587 Bacteria 2964
499 Ga0501072_0016826 3300049588 Bacteria 5617
500 Ga0501072_0276859 3300049588 Bacteria 1335
501 Ga0501073_0002666 3300049589 Bacteria 13363
502 Ga0501074_0001621 3300049590 Bacteria 15256
503 Ga0501075_0140867 3300049591 Bacteria 1838
504 Ga0501079_0156664 3300049741 Bacteria 1775
505 Ga0501079_0166166 3300049741 Bacteria 1721
506 Ga0501080_0066382 3300049742 Bacteria 3355
507 Ga0501080_0085169 3300049742 Bacteria 2937
508 Ga0501080_0106572 3300049742 Bacteria 2597
509 Ga0501081_0097592 3300049743 Bacteria 2074
510 Ga0501081_0221814 3300049743 Bacteria 1375
511 Ga0501083_0000986 3300049744 Bacteria 18893
512 Ga0501083_0063961 3300049744 Bacteria 2453
513 Ga0501083_0114516 3300049744 Bacteria 1771
514 Ga0501083_0130798 3300049744 Bacteria 1645
515 Ga0501035_0052977 3300049822 Bacteria 3630
516 Ga0501044_0001050 3300049823 Bacteria 33213
517 Ga0501044_0017930 3300049823 Bacteria 7591
518 Ga0501045_0055627 3300049824 Bacteria 2893
519 Ga0501045_0102263 3300049824 Bacteria 2122
520 nmdc:mga03683_42287_c1 3300050489 Bacteria 1874
521 nmdc:mga03n38_45502_c1 3300050490 Bacteria 1933
522 nmdc:mga03n38_63977_c1 3300050490 Bacteria 1682
523 nmdc:mga00v17_51901_c1 3300050491 Bacteria 2494
524 nmdc:mga0yw44_19625_c1 3300050492 Bacteria 3732
525 nmdc:mga0yw44_40720_c1 3300050492 Bacteria 2762
526 nmdc:mga0yw44_94440_c1 3300050492 Bacteria 1895
527 nmdc:mga0k408_805_c2 3300050493 Bacteria 10222
528 nmdc:mga06z11_18021_c1 3300050494 Bacteria 3218
529 nmdc:mga06z11_31448_c1 3300050494 Bacteria 2579
530 nmdc:mga06z11_58952_c1 3300050494 Bacteria 1994
531 nmdc:mga06z11_72399_c1 3300050494 Bacteria 1827
532 nmdc:mga05p37_109346_c1 3300050507 Bacteria 3401
533 nmdc:mga05p37_30275_c1 3300050507 Bacteria 6603
534 nmdc:mga05p37_55142_c1 3300050507 Bacteria 4890
535 nmdc:mga05p37_66731_c1 3300050507 Bacteria 4425
536 nmdc:mga09592_205928_c1 3300050508 Bacteria 1704
537 nmdc:mga09592_96825_c1 3300050508 Bacteria 2525
538 nmdc:mga0qj67_132081_c1 3300050509 Bacteria 2022
539 nmdc:mga0qj67_144642_c1 3300050509 Bacteria 1928
540 nmdc:mga0qj67_60_c1 3300050509 Bacteria 80228
541 nmdc:mga06r32_268023_c1 3300050510 Bacteria 1695
542 nmdc:mga08y16_126950_c1 3300050511 Bacteria 2653
543 nmdc:mga08y16_353105_c1 3300050511 Bacteria 1510
544 nmdc:mga08y16_61962_c1 3300050511 Bacteria 3906
545 nmdc:mga0n895_3017_c1 3300050512 Bacteria 13379
546 nmdc:mga08x19_227291_c1 3300050514 Bacteria 1284
547 nmdc:mga0a205_200884_c1 3300050515 Bacteria 1884
548 Ga0495601_0000015 3300053077 Bacteria 213851
549 Ga0495601_0105928 3300053077 Bacteria 1818
550 Ga0495601_0211169 3300053077 Bacteria 1268
551 Ga0495612_0000096 3300053078 Bacteria 38017
552 Ga0495655_0011263 3300053083 Bacteria 1792
553 Ga0495595_0000035 3300053084 Bacteria 79822
554 Ga0495595_0003933 3300053084 Bacteria 5936
555 Ga0495619_0000044 3300053085 Bacteria 108581
556 Ga0495619_0056090 3300053085 Bacteria 2611
557 Ga0495619_0074257 3300053085 Bacteria 2280
558 Ga0500641_0014824 3300053096 Bacteria 2881
559 Ga0500654_089093 3300053099 Bacteria 1387
560 Ga0500652_000488 3300053131 Bacteria 13946
561 Ga0500658_0061944 3300053134 Bacteria 1558
562 Ga0500568_0002398 3300053139 Bacteria 11069
563 Ga0500568_0066122 3300053139 Bacteria 1391
564 Ga0500616_0004796 3300053153 Bacteria 9470
565 Ga0500616_0036278 3300053153 Bacteria 2676
566 Ga0500616_0106686 3300053153 Bacteria 1360
567 Ga0500636_0101606 3300053177 Bacteria 1634
568 Ga0500645_028599 3300053730 Bacteria 1686
569 Ga0501084_0030993 3300054114 Bacteria 4472
570 Ga0501082_0000016 3300060353 Bacteria 115081
571 Ga0501082_0030709 3300060353 Bacteria 4631
572 Ga0501082_0194171 3300060353 Bacteria 1766

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0401201 Ga0496110_0401201_180_1211 343
2 3300048090 Ga0495615_0022196 Ga0495615_0022196_388_1431 344
3 3300049588 Ga0501072_0276859 Ga0501072_0276859_73_1116 344
4 3300053139 Ga0500568_0066122 Ga0500568_0066122_11_1045 344
5 3300028556 Ga0265337_1007649 Ga0265337_10076492 350
6 3300028563 Ga0265319_1003972 Ga0265319_10039724 350
7 3300028573 Ga0265334_10003484 Ga0265334_100034843 350
8 3300028653 Ga0265323_10002861 Ga0265323_100028614 350
9 3300028666 Ga0265336_10000389 Ga0265336_1000038925 350
10 3300028800 Ga0265338_10000176 Ga0265338_1000017643 350
11 3300029957 Ga0265324_10004317 Ga0265324_100043173 350
12 3300021361 Ga0213872_10001399 Ga0213872_100013992 363
13 3300039447 Ga0436361_0020532 Ga0436361_0020532_35145_36335 363
14 3300039447 Ga0436361_0497647 Ga0436361_0497647_492_1631 363
15 3300049742 Ga0501080_0085169 Ga0501080_0085169_984_2123 363
16 3300050494 nmdc:mga06z11_58952_c1 nmdc:mga06z11_58952_c1_812_1981 363
17 3300005617 Ga0068859_100086478 Ga0068859_1000864782 364
18 3300005842 Ga0068858_100131455 Ga0068858_1001314552 364
19 3300006931 Ga0097620_100086478 Ga0097620_1000864782 364
20 3300010375 Ga0105239_10040888 Ga0105239_100408884 364
21 3300025261 Ga0209233_1006297 Ga0209233_10062974 364
22 3300025272 Ga0209455_1001095 Ga0209455_10010956 364
23 3300035695 Ga0373927_0011117 Ga0373927_0011117_3780_5000 364
24 3300048924 Ga0496121_0016256 Ga0496121_0016256_5442_6668 364
25 3300049575 Ga0501039_0041648 Ga0501039_0041648_11_1105 364
26 iso_pu_bacteria 2935847175 2935853546 364
27 3300005354 Ga0070675_100211756 Ga0070675_1002117562 365
28 3300005439 Ga0070711_100145987 Ga0070711_1001459871 365
29 3300006175 Ga0070712_100000277 Ga0070712_10000027727 365
30 3300025915 Ga0207693_10001633 Ga0207693_100016332 365
31 3300025916 Ga0207663_10122842 Ga0207663_101228422 365
32 3300025923 Ga0207681_10178401 Ga0207681_101784012 365
33 3300042461 Ga0439460_0015132 Ga0439460_0015132_556_1677 365
34 3300048917 Ga0496114_0143756 Ga0496114_0143756_881_2026 365
35 3300053085 Ga0495619_0056090 Ga0495619_0056090_960_2102 365
36 3300006178 Ga0075367_10078787 Ga0075367_100787872 366
37 3300050490 nmdc:mga03n38_63977_c1 nmdc:mga03n38_63977_c1_66_1223 366
38 3300050494 nmdc:mga06z11_18021_c1 nmdc:mga06z11_18021_c1_276_1472 366
39 3300053153 Ga0500616_0004796 Ga0500616_0004796_1245_2351 366
40 3300053153 Ga0500616_0036278 Ga0500616_0036278_241_1347 366
41 3300039447 Ga0436361_0423477 Ga0436361_0423477_217_1377 367
42 3300006038 Ga0075365_10030693 Ga0075365_100306931 368
43 3300006353 Ga0075370_10057860 Ga0075370_100578602 368
44 3300021361 Ga0213872_10000559 Ga0213872_1000055914 368
45 3300021361 Ga0213872_10000896 Ga0213872_1000089614 368
46 3300021361 Ga0213872_10020207 Ga0213872_100202073 368
47 3300039447 Ga0436361_0450698 Ga0436361_0450698_1280_2425 368
48 3300039447 Ga0436361_0572145 Ga0436361_0572145_1928_3055 368
49 3300039447 Ga0436361_0797374 Ga0436361_0797374_33_1178 368
50 3300039447 Ga0436361_0892205 Ga0436361_0892205_1251_2396 368
51 3300048904 Ga0496101_0002534 Ga0496101_0002534_7506_8660 368
52 3300048905 Ga0496102_0044380 Ga0496102_0044380_2616_3770 368
53 3300048908 Ga0496105_0063432 Ga0496105_0063432_1103_2257 368
54 3300048909 Ga0496106_0001803 Ga0496106_0001803_14216_15370 368
55 3300048909 Ga0496106_0301953 Ga0496106_0301953_17_1174 368
56 3300048911 Ga0496108_0010861 Ga0496108_0010861_5531_6688 368
57 3300048911 Ga0496108_0018930 Ga0496108_0018930_3704_4858 368
58 3300048912 Ga0496109_0003548 Ga0496109_0003548_5457_6614 368
59 3300048913 Ga0496110_0000282 Ga0496110_0000282_27195_28352 368
60 3300048913 Ga0496110_0003425 Ga0496110_0003425_1542_2702 368
61 3300048914 Ga0496111_0003144 Ga0496111_0003144_8309_9466 368
62 3300048915 Ga0496112_0009122 Ga0496112_0009122_5616_6773 368
63 3300048915 Ga0496112_0022123 Ga0496112_0022123_4191_5345 368
64 3300048916 Ga0496113_0002455 Ga0496113_0002455_4984_6141 368
65 3300048918 Ga0496115_0129982 Ga0496115_0129982_868_2022 368
66 3300049583 Ga0501067_0071604 Ga0501067_0071604_727_1866 368
67 3300050492 nmdc:mga0yw44_40720_c1 nmdc:mga0yw44_40720_c1_1442_2554 368
68 3300007788 Ga0099795_10053585 Ga0099795_100535851 369
69 3300010159 Ga0099796_10007009 Ga0099796_100070093 369
70 3300031235 Ga0265330_10041807 Ga0265330_100418071 369
71 3300031242 Ga0265329_10030727 Ga0265329_100307272 369
72 3300031249 Ga0265339_10099024 Ga0265339_100990241 369
73 3300031344 Ga0265316_10195443 Ga0265316_101954431 369
74 3300035691 Ga0373931_0219802 Ga0373931_0219802_22_1131 369
75 3300046683 Ga0495658_0006621 Ga0495658_0006621_2602_3822 369
76 3300001990 JGI24737J22298_10030376 JGI24737J22298_100303762 370
77 3300002070 JGI24750J21931_1002148 JGI24750J21931_10021482 370
78 3300002077 JGI24744J21845_10000578 JGI24744J21845_100005787 370
79 3300002077 JGI24744J21845_10023387 JGI24744J21845_100233871 370
80 3300002239 JGI24034J26672_10003395 JGI24034J26672_100033952 370
81 3300002244 JGI24742J22300_10000829 JGI24742J22300_100008293 370
82 3300003203 JGI25406J46586_10022199 JGI25406J46586_100221992 370
83 3300003215 JGI25153J46596_10000660 JGI25153J46596_1000066018 370
84 3300005328 Ga0070676_10083523 Ga0070676_100835232 370
85 3300005330 Ga0070690_100046659 Ga0070690_1000466593 370
86 3300005331 Ga0070670_100074499 Ga0070670_1000744992 370
87 3300005333 Ga0070677_10022053 Ga0070677_100220533 370
88 3300005333 Ga0070677_10024627 Ga0070677_100246272 370
89 3300005335 Ga0070666_10020181 Ga0070666_100201814 370
90 3300005336 Ga0070680_100008893 Ga0070680_1000088935 370
91 3300005338 Ga0068868_100004344 Ga0068868_1000043444 370
92 3300005338 Ga0068868_100007586 Ga0068868_1000075863 370
93 3300005339 Ga0070660_100014295 Ga0070660_1000142955 370
94 3300005340 Ga0070689_100013414 Ga0070689_1000134142 370
95 3300005340 Ga0070689_100025225 Ga0070689_1000252252 370
96 3300005343 Ga0070687_100007221 Ga0070687_1000072212 370
97 3300005343 Ga0070687_100014015 Ga0070687_1000140153 370
98 3300005343 Ga0070687_100039569 Ga0070687_1000395693 370
99 3300005347 Ga0070668_100037206 Ga0070668_1000372063 370
100 3300005353 Ga0070669_100020211 Ga0070669_1000202112 370
101 3300005354 Ga0070675_100003175 Ga0070675_1000031755 370
102 3300005354 Ga0070675_100032579 Ga0070675_1000325794 370
103 3300005354 Ga0070675_100141672 Ga0070675_1001416721 370
104 3300005356 Ga0070674_100001401 Ga0070674_10000140110 370
105 3300005364 Ga0070673_100006028 Ga0070673_1000060286 370
106 3300005364 Ga0070673_100124261 Ga0070673_1001242612 370
107 3300005365 Ga0070688_100012050 Ga0070688_1000120503 370
108 3300005365 Ga0070688_100038258 Ga0070688_1000382583 370
109 3300005366 Ga0070659_100007701 Ga0070659_1000077016 370
110 3300005367 Ga0070667_100025917 Ga0070667_1000259173 370
111 3300005406 Ga0070703_10015721 Ga0070703_100157212 370
112 3300005435 Ga0070714_100199678 Ga0070714_1001996781 370
113 3300005435 Ga0070714_100272261 Ga0070714_1002722611 370
114 3300005436 Ga0070713_100077695 Ga0070713_1000776952 370
115 3300005436 Ga0070713_100081966 Ga0070713_1000819663 370
116 3300005436 Ga0070713_100122292 Ga0070713_1001222921 370
117 3300005437 Ga0070710_10011557 Ga0070710_100115572 370
118 3300005438 Ga0070701_10151563 Ga0070701_101515631 370
119 3300005439 Ga0070711_100105348 Ga0070711_1001053482 370
120 3300005439 Ga0070711_100226830 Ga0070711_1002268301 370
121 3300005441 Ga0070700_100012600 Ga0070700_1000126004 370
122 3300005455 Ga0070663_100005197 Ga0070663_1000051976 370
123 3300005456 Ga0070678_100151313 Ga0070678_1001513132 370
124 3300005457 Ga0070662_100006574 Ga0070662_1000065746 370
125 3300005458 Ga0070681_10309341 Ga0070681_103093412 370
126 3300005459 Ga0068867_100212687 Ga0068867_1002126871 370
127 3300005466 Ga0070685_10030514 Ga0070685_100305142 370
128 3300005468 Ga0070707_100218183 Ga0070707_1002181831 370
129 3300005518 Ga0070699_100003706 Ga0070699_1000037063 370
130 3300005530 Ga0070679_100060447 Ga0070679_1000604473 370
131 3300005535 Ga0070684_100059514 Ga0070684_1000595143 370
132 3300005539 Ga0068853_100055305 Ga0068853_1000553052 370
133 3300005543 Ga0070672_100000898 Ga0070672_1000008989 370
134 3300005543 Ga0070672_100269402 Ga0070672_1002694021 370
135 3300005544 Ga0070686_100055026 Ga0070686_1000550262 370
136 3300005545 Ga0070695_100084693 Ga0070695_1000846931 370
137 3300005548 Ga0070665_100009985 Ga0070665_1000099853 370
138 3300005549 Ga0070704_100043161 Ga0070704_1000431613 370
139 3300005549 Ga0070704_100067986 Ga0070704_1000679861 370
140 3300005577 Ga0068857_100308745 Ga0068857_1003087451 370
141 3300005578 Ga0068854_100018289 Ga0068854_1000182892 370
142 3300005614 Ga0068856_100026810 Ga0068856_1000268102 370
143 3300005615 Ga0070702_100003350 Ga0070702_1000033504 370
144 3300005616 Ga0068852_100004585 Ga0068852_1000045854 370
145 3300005617 Ga0068859_100040777 Ga0068859_1000407774 370
146 3300005617 Ga0068859_100200924 Ga0068859_1002009242 370
147 3300005618 Ga0068864_100007736 Ga0068864_1000077365 370
148 3300005618 Ga0068864_100154167 Ga0068864_1001541672 370
149 3300005718 Ga0068866_10002579 Ga0068866_100025794 370
150 3300005718 Ga0068866_10120109 Ga0068866_101201092 370
151 3300005719 Ga0068861_100002506 Ga0068861_1000025067 370
152 3300005834 Ga0068851_10014563 Ga0068851_100145633 370
153 3300005840 Ga0068870_10001759 Ga0068870_100017595 370
154 3300005841 Ga0068863_100006002 Ga0068863_1000060026 370
155 3300005841 Ga0068863_100224650 Ga0068863_1002246502 370
156 3300005842 Ga0068858_100004133 Ga0068858_10000413310 370
157 3300005842 Ga0068858_100156834 Ga0068858_1001568342 370
158 3300005843 Ga0068860_100003806 Ga0068860_1000038066 370
159 3300005844 Ga0068862_100006027 Ga0068862_1000060272 370
160 3300005937 Ga0081455_10001263 Ga0081455_1000126319 370
161 3300005937 Ga0081455_10011029 Ga0081455_100110295 370
162 3300005937 Ga0081455_10066743 Ga0081455_100667432 370
163 3300005981 Ga0081538_10023004 Ga0081538_100230044 370
164 3300005981 Ga0081538_10031421 Ga0081538_100314212 370
165 3300005981 Ga0081538_10064119 Ga0081538_100641192 370
166 3300005983 Ga0081540_1000128 Ga0081540_100012842 370
167 3300005983 Ga0081540_1001551 Ga0081540_100155116 370
168 3300005983 Ga0081540_1015315 Ga0081540_10153153 370
169 3300005985 Ga0081539_10005924 Ga0081539_100059248 370
170 3300006028 Ga0070717_10166242 Ga0070717_101662422 370
171 3300006038 Ga0075365_10045180 Ga0075365_100451803 370
172 3300006048 Ga0075363_100003705 Ga0075363_1000037057 370
173 3300006051 Ga0075364_10003468 Ga0075364_100034684 370
174 3300006051 Ga0075364_10082766 Ga0075364_100827662 370
175 3300006163 Ga0070715_10017966 Ga0070715_100179662 370
176 3300006175 Ga0070712_100033236 Ga0070712_1000332362 370
177 3300006177 Ga0075362_10003019 Ga0075362_100030194 370
178 3300006178 Ga0075367_10051084 Ga0075367_100510843 370
179 3300006186 Ga0075369_10021975 Ga0075369_100219752 370
180 3300006186 Ga0075369_10063447 Ga0075369_100634472 370
181 3300006195 Ga0075366_10004591 Ga0075366_100045916 370
182 3300006195 Ga0075366_10114544 Ga0075366_101145442 370
183 3300006353 Ga0075370_10099695 Ga0075370_100996951 370
184 3300006358 Ga0068871_100122539 Ga0068871_1001225392 370
185 3300006844 Ga0075428_100023040 Ga0075428_1000230404 370
186 3300006844 Ga0075428_100182810 Ga0075428_1001828103 370
187 3300006844 Ga0075428_100220814 Ga0075428_1002208143 370
188 3300006844 Ga0075428_100378490 Ga0075428_1003784902 370
189 3300006846 Ga0075430_100000067 Ga0075430_10000006746 370
190 3300006846 Ga0075430_100008377 Ga0075430_1000083771 370
191 3300006846 Ga0075430_100142128 Ga0075430_1001421281 370
192 3300006847 Ga0075431_100037781 Ga0075431_1000377812 370
193 3300006847 Ga0075431_100077637 Ga0075431_1000776373 370
194 3300006847 Ga0075431_100154771 Ga0075431_1001547711 370
195 3300006847 Ga0075431_100260294 Ga0075431_1002602942 370
196 3300006852 Ga0075433_10283037 Ga0075433_102830372 370
197 3300006871 Ga0075434_100055145 Ga0075434_1000551453 370
198 3300006871 Ga0075434_100178134 Ga0075434_1001781342 370
199 3300006871 Ga0075434_100419840 Ga0075434_1004198402 370
200 3300006880 Ga0075429_100008809 Ga0075429_1000088093 370
201 3300006880 Ga0075429_100355379 Ga0075429_1003553791 370
202 3300006881 Ga0068865_100009041 Ga0068865_1000090414 370
203 3300006914 Ga0075436_100020342 Ga0075436_1000203424 370
204 3300006914 Ga0075436_100180185 Ga0075436_1001801852 370
205 3300006931 Ga0097620_100040774 Ga0097620_1000407744 370
206 3300006931 Ga0097620_100200932 Ga0097620_1002009322 370
207 3300007076 Ga0075435_100047464 Ga0075435_1000474644 370
208 3300007076 Ga0075435_100089017 Ga0075435_1000890172 370
209 3300007265 Ga0099794_10015586 Ga0099794_100155861 370
210 3300009094 Ga0111539_10008081 Ga0111539_1000808111 370
211 3300009094 Ga0111539_10100625 Ga0111539_101006254 370
212 3300009094 Ga0111539_10403851 Ga0111539_104038512 370
213 3300009098 Ga0105245_10005857 Ga0105245_100058572 370
214 3300009098 Ga0105245_10119478 Ga0105245_101194781 370
215 3300009098 Ga0105245_10143174 Ga0105245_101431742 370
216 3300009101 Ga0105247_10009817 Ga0105247_100098174 370
217 3300009101 Ga0105247_10035426 Ga0105247_100354262 370
218 3300009147 Ga0114129_10020121 Ga0114129_100201215 370
219 3300009147 Ga0114129_10041806 Ga0114129_100418062 370
220 3300009147 Ga0114129_10114799 Ga0114129_101147992 370
221 3300009147 Ga0114129_10123887 Ga0114129_101238872 370
222 3300009147 Ga0114129_10182444 Ga0114129_101824441 370
223 3300009147 Ga0114129_10319796 Ga0114129_103197963 370
224 3300009174 Ga0105241_10301551 Ga0105241_103015511 370
225 3300009176 Ga0105242_10019227 Ga0105242_100192274 370
226 3300009177 Ga0105248_10012271 Ga0105248_100122719 370
227 3300009177 Ga0105248_10111763 Ga0105248_101117633 370
228 3300009545 Ga0105237_10422771 Ga0105237_104227711 370
229 3300009551 Ga0105238_10066854 Ga0105238_100668544 370
230 3300009551 Ga0105238_10091916 Ga0105238_100919162 370
231 3300010375 Ga0105239_10007446 Ga0105239_100074462 370
232 3300010375 Ga0105239_10157686 Ga0105239_101576862 370
233 3300011119 Ga0105246_10060010 Ga0105246_100600102 370
234 3300011119 Ga0105246_10075208 Ga0105246_100752082 370
235 3300011119 Ga0105246_10194209 Ga0105246_101942091 370
236 3300013296 Ga0157374_10017453 Ga0157374_100174535 370
237 3300013296 Ga0157374_10177838 Ga0157374_101778382 370
238 3300013297 Ga0157378_10013150 Ga0157378_100131504 370
239 3300013297 Ga0157378_10164417 Ga0157378_101644172 370
240 3300013306 Ga0163162_10006545 Ga0163162_100065452 370
241 3300013307 Ga0157372_10378462 Ga0157372_103784622 370
242 3300013308 Ga0157375_10006121 Ga0157375_100061218 370
243 3300014325 Ga0163163_10016469 Ga0163163_100164694 370
244 3300014325 Ga0163163_10036482 Ga0163163_100364822 370
245 3300014326 Ga0157380_10003267 Ga0157380_100032678 370
246 3300014326 Ga0157380_10447022 Ga0157380_104470221 370
247 3300014745 Ga0157377_10016261 Ga0157377_100162613 370
248 3300014968 Ga0157379_10005247 Ga0157379_100052472 370
249 3300014969 Ga0157376_10199081 Ga0157376_101990811 370
250 3300017792 Ga0163161_10003329 Ga0163161_1000332910 370
251 3300021361 Ga0213872_10005016 Ga0213872_100050162 370
252 3300025297 Ga0209758_1000772 Ga0209758_100077225 370
253 3300025315 Ga0207697_10024543 Ga0207697_100245432 370
254 3300025885 Ga0207653_10036532 Ga0207653_100365321 370
255 3300025893 Ga0207682_10002142 Ga0207682_100021422 370
256 3300025893 Ga0207682_10024955 Ga0207682_100249553 370
257 3300025899 Ga0207642_10001398 Ga0207642_100013984 370
258 3300025900 Ga0207710_10010515 Ga0207710_100105154 370
259 3300025901 Ga0207688_10002031 Ga0207688_100020317 370
260 3300025903 Ga0207680_10037799 Ga0207680_100377992 370
261 3300025905 Ga0207685_10011888 Ga0207685_100118883 370
262 3300025906 Ga0207699_10032085 Ga0207699_100320852 370
263 3300025907 Ga0207645_10007050 Ga0207645_100070507 370
264 3300025908 Ga0207643_10001570 Ga0207643_100015709 370
265 3300025908 Ga0207643_10010100 Ga0207643_100101004 370
266 3300025911 Ga0207654_10070492 Ga0207654_100704922 370
267 3300025912 Ga0207707_10128085 Ga0207707_101280853 370
268 3300025915 Ga0207693_10026048 Ga0207693_100260482 370
269 3300025915 Ga0207693_10090145 Ga0207693_100901451 370
270 3300025915 Ga0207693_10199852 Ga0207693_101998522 370
271 3300025916 Ga0207663_10086482 Ga0207663_100864822 370
272 3300025917 Ga0207660_10136740 Ga0207660_101367401 370
273 3300025918 Ga0207662_10009133 Ga0207662_100091332 370
274 3300025918 Ga0207662_10022123 Ga0207662_100221231 370
275 3300025918 Ga0207662_10062016 Ga0207662_100620162 370
276 3300025918 Ga0207662_10063893 Ga0207662_100638932 370
277 3300025919 Ga0207657_10090268 Ga0207657_100902683 370
278 3300025919 Ga0207657_10098290 Ga0207657_100982902 370
279 3300025921 Ga0207652_10014131 Ga0207652_100141316 370
280 3300025924 Ga0207694_10141759 Ga0207694_101417592 370
281 3300025924 Ga0207694_10207466 Ga0207694_102074661 370
282 3300025925 Ga0207650_10001375 Ga0207650_1000137513 370
283 3300025926 Ga0207659_10008042 Ga0207659_100080422 370
284 3300025926 Ga0207659_10050918 Ga0207659_100509183 370
285 3300025927 Ga0207687_10014594 Ga0207687_100145943 370
286 3300025927 Ga0207687_10076609 Ga0207687_100766093 370
287 3300025928 Ga0207700_10114479 Ga0207700_101144792 370
288 3300025928 Ga0207700_10116611 Ga0207700_101166112 370
289 3300025928 Ga0207700_10290624 Ga0207700_102906241 370
290 3300025929 Ga0207664_10119826 Ga0207664_101198262 370
291 3300025931 Ga0207644_10004097 Ga0207644_100040972 370
292 3300025931 Ga0207644_10193618 Ga0207644_101936182 370
293 3300025933 Ga0207706_10001850 Ga0207706_1000185016 370
294 3300025933 Ga0207706_10020785 Ga0207706_100207854 370
295 3300025936 Ga0207670_10002865 Ga0207670_100028654 370
296 3300025936 Ga0207670_10041087 Ga0207670_100410873 370
297 3300025937 Ga0207669_10003999 Ga0207669_100039995 370
298 3300025937 Ga0207669_10016637 Ga0207669_100166374 370
299 3300025938 Ga0207704_10056295 Ga0207704_100562952 370
300 3300025939 Ga0207665_10193350 Ga0207665_101933501 370
301 3300025940 Ga0207691_10001076 Ga0207691_1000107616 370
302 3300025940 Ga0207691_10002814 Ga0207691_100028149 370
303 3300025940 Ga0207691_10260354 Ga0207691_102603542 370
304 3300025941 Ga0207711_10003227 Ga0207711_1000322710 370
305 3300025941 Ga0207711_10014418 Ga0207711_100144183 370
306 3300025942 Ga0207689_10008025 Ga0207689_100080253 370
307 3300025942 Ga0207689_10038993 Ga0207689_100389932 370
308 3300025944 Ga0207661_10062370 Ga0207661_100623703 370
309 3300025945 Ga0207679_10017058 Ga0207679_100170581 370
310 3300025960 Ga0207651_10062039 Ga0207651_100620391 370
311 3300025961 Ga0207712_10126545 Ga0207712_101265452 370
312 3300025972 Ga0207668_10017784 Ga0207668_100177843 370
313 3300025986 Ga0207658_10196557 Ga0207658_101965572 370
314 3300026023 Ga0207677_10005514 Ga0207677_100055143 370
315 3300026023 Ga0207677_10016802 Ga0207677_100168023 370
316 3300026041 Ga0207639_10062323 Ga0207639_100623232 370
317 3300026067 Ga0207678_10005280 Ga0207678_100052808 370
318 3300026075 Ga0207708_10004126 Ga0207708_100041268 370
319 3300026075 Ga0207708_10241774 Ga0207708_102417741 370
320 3300026078 Ga0207702_10023972 Ga0207702_100239724 370
321 3300026088 Ga0207641_10005434 Ga0207641_100054347 370
322 3300026088 Ga0207641_10299956 Ga0207641_102999562 370
323 3300026089 Ga0207648_10015137 Ga0207648_100151373 370
324 3300026089 Ga0207648_10086844 Ga0207648_100868443 370
325 3300026095 Ga0207676_10002920 Ga0207676_1000292010 370
326 3300026095 Ga0207676_10176644 Ga0207676_101766442 370
327 3300026095 Ga0207676_10475390 Ga0207676_104753901 370
328 3300026118 Ga0207675_100000944 Ga0207675_10000094412 370
329 3300027512 Ga0209179_1004468 Ga0209179_10044682 370
330 3300027671 Ga0209588_1032280 Ga0209588_10322802 370
331 3300028379 Ga0268266_10012800 Ga0268266_100128002 370
332 3300028380 Ga0268265_10027494 Ga0268265_100274943 370
333 3300028381 Ga0268264_10011715 Ga0268264_100117154 370
334 3300031238 Ga0265332_10022996 Ga0265332_100229962 370
335 3300031240 Ga0265320_10008917 Ga0265320_100089177 370
336 3300031241 Ga0265325_10000305 Ga0265325_1000030513 370
337 3300031242 Ga0265329_10015683 Ga0265329_100156831 370
338 3300031247 Ga0265340_10010579 Ga0265340_100105795 370
339 3300031247 Ga0265340_10015095 Ga0265340_100150953 370
340 3300031247 Ga0265340_10041595 Ga0265340_100415952 370
341 3300031249 Ga0265339_10056400 Ga0265339_100564001 370
342 3300031250 Ga0265331_10069353 Ga0265331_100693532 370
343 3300031344 Ga0265316_10048387 Ga0265316_100483873 370
344 3300031595 Ga0265313_10025765 Ga0265313_100257651 370
345 3300031711 Ga0265314_10028660 Ga0265314_100286602 370
346 3300031712 Ga0265342_10000109 Ga0265342_1000010962 370
347 3300031712 Ga0265342_10043953 Ga0265342_100439532 370
348 3300031712 Ga0265342_10048477 Ga0265342_100484772 370
349 3300035089 Ga0373944_0031816 Ga0373944_0031816_149_1261 370
350 3300035111 Ga0373923_0002028 Ga0373923_0002028_1955_3073 370
351 3300035112 Ga0373932_0043865 Ga0373932_0043865_145_1257 370
352 3300035113 Ga0373936_0001332 Ga0373936_0001332_2458_3576 370
353 3300035114 Ga0373939_0010545 Ga0373939_0010545_703_1815 370
354 3300035115 Ga0373941_0017529 Ga0373941_0017529_617_1729 370
355 3300035117 Ga0373953_0068991 Ga0373953_0068991_34_1146 370
356 3300035118 Ga0373954_0009547 Ga0373954_0009547_1251_2369 370
357 3300035170 Ga0373943_0001174 Ga0373943_0001174_9473_10591 370
358 3300035171 Ga0373946_0013528 Ga0373946_0013528_1496_2614 370
359 3300035172 Ga0373955_0000069 Ga0373955_0000069_34570_35688 370
360 3300035241 Ga0373961_0013304 Ga0373961_0013304_202_1320 370
361 3300035410 Ga0373924_0000869 Ga0373924_0000869_685_1803 370
362 3300035691 Ga0373931_0000835 Ga0373931_0000835_8483_9595 370
363 3300035691 Ga0373931_0007500 Ga0373931_0007500_470_1582 370
364 3300035692 Ga0373935_0000938 Ga0373935_0000938_4082_5200 370
365 3300035695 Ga0373927_0001966 Ga0373927_0001966_7298_8416 370
366 3300035695 Ga0373927_0045006 Ga0373927_0045006_377_1534 370
367 3300035724 Ga0373933_0001354 Ga0373933_0001354_12705_13823 370
368 3300035724 Ga0373933_0092929 Ga0373933_0092929_661_1773 370
369 3300035725 Ga0373947_0001670 Ga0373947_0001670_7843_8961 370
370 3300035725 Ga0373947_0077794 Ga0373947_0077794_448_1560 370
371 3300036401 Ga0373937_0000356 Ga0373937_0000356_17384_18502 370
372 3300036401 Ga0373937_0052822 Ga0373937_0052822_274_1386 370
373 3300037068 Ga0373925_0000462 Ga0373925_0000462_18304_19422 370
374 3300037068 Ga0373925_0248657 Ga0373925_0248657_146_1258 370
375 3300037418 Ga0395900_0260560 Ga0395900_0260560_234_1346 370
376 3300038443 Ga0395901_0112636 Ga0395901_0112636_438_1550 370
377 3300039437 Ga0436365_0015250 Ga0436365_0015250_340_1548 370
378 3300039437 Ga0436365_0394916 Ga0436365_0394916_1435_2598 370
379 3300039447 Ga0436361_0129646 Ga0436361_0129646_1834_2991 370
380 3300039447 Ga0436361_0142459 Ga0436361_0142459_5359_6501 370
381 3300044719 Ga0466971_0067674 Ga0466971_0067674_322_1533 370
382 3300045049 Ga0466959_0143938 Ga0466959_0143938_91_1206 370
383 3300045836 Ga0466958_0000314 Ga0466958_0000314_13323_14534 370
384 3300046454 Ga0495592_0000090 Ga0495592_0000090_21496_22614 370
385 3300046455 Ga0495603_0062537 Ga0495603_0062537_532_1644 370
386 3300046459 Ga0495629_0071834 Ga0495629_0071834_757_1914 370
387 3300046459 Ga0495629_0104385 Ga0495629_0104385_35_1147 370
388 3300046461 Ga0495641_0036499 Ga0495641_0036499_298_1410 370
389 3300046462 Ga0495651_0000682 Ga0495651_0000682_21508_22626 370
390 3300046463 Ga0495653_0000322 Ga0495653_0000322_16333_17451 370
391 3300046473 Ga0495582_0042181 Ga0495582_0042181_1107_2264 370
392 3300046474 Ga0495605_0055995 Ga0495605_0055995_418_1539 370
393 3300046476 Ga0495662_0001023 Ga0495662_0001023_5862_6980 370
394 3300046477 Ga0495664_0000078 Ga0495664_0000078_22472_23590 370
395 3300046491 Ga0495584_0092106 Ga0495584_0092106_43_1200 370
396 3300046499 Ga0495594_0021004 Ga0495594_0021004_674_1786 370
397 3300046511 Ga0495608_0000022 Ga0495608_0000022_140206_141324 370
398 3300046514 Ga0495618_0000229 Ga0495618_0000229_18324_19442 370
399 3300046516 Ga0495628_0000035 Ga0495628_0000035_88030_89148 370
400 3300046517 Ga0495630_0000377 Ga0495630_0000377_13078_14196 370
401 3300046517 Ga0495630_0092713 Ga0495630_0092713_547_1704 370
402 3300046529 Ga0495652_0000062 Ga0495652_0000062_88042_89160 370
403 3300046531 Ga0495665_0036019 Ga0495665_0036019_422_1534 370
404 3300046533 Ga0495640_0000021 Ga0495640_0000021_23788_24906 370
405 3300046533 Ga0495640_0094009 Ga0495640_0094009_360_1517 370
406 3300046536 Ga0495587_0000006 Ga0495587_0000006_88042_89160 370
407 3300046538 Ga0495609_0029391 Ga0495609_0029391_1297_2409 370
408 3300046543 Ga0495645_0000174 Ga0495645_0000174_22195_23313 370
409 3300046559 Ga0495667_0000161 Ga0495667_0000161_22251_23369 370
410 3300046615 Ga0495656_0001474 Ga0495656_0001474_4710_5822 370
411 3300046615 Ga0495656_0062586 Ga0495656_0062586_19_1176 370
412 3300046642 Ga0495634_0000350 Ga0495634_0000350_21487_22605 370
413 3300046663 Ga0495635_0000018 Ga0495635_0000018_170959_172077 370
414 3300046665 Ga0495661_0139652 Ga0495661_0139652_76_1233 370
415 3300046675 Ga0495657_0000245 Ga0495657_0000245_26759_27877 370
416 3300046678 Ga0495599_0000032 Ga0495599_0000032_85642_86760 370
417 3300046679 Ga0495623_0000004 Ga0495623_0000004_12262_13380 370
418 3300046680 Ga0495646_0000083 Ga0495646_0000083_21815_22933 370
419 3300046681 Ga0495647_0020993 Ga0495647_0020993_847_2004 370
420 3300046683 Ga0495658_0082083 Ga0495658_0082083_67_1224 370
421 3300046683 Ga0495658_0094956 Ga0495658_0094956_363_1520 370
422 3300046689 Ga0495613_0081717 Ga0495613_0081717_128_1246 370
423 3300046691 Ga0495670_0076295 Ga0495670_0076295_267_1424 370
424 3300046809 Ga0495600_0000022 Ga0495600_0000022_69884_71002 370
425 3300047315 Ga0495581_0026783 Ga0495581_0026783_2121_3239 370
426 3300047317 Ga0495604_0000011 Ga0495604_0000011_21515_22633 370
427 3300047319 Ga0495674_0000034 Ga0495674_0000034_88042_89160 370
428 3300047321 Ga0495676_0092637 Ga0495676_0092637_624_1736 370
429 3300047322 Ga0495680_0000290 Ga0495680_0000290_21508_22626 370
430 3300047444 Ga0495675_0000352 Ga0495675_0000352_7403_8521 370
431 3300047445 Ga0495677_0031302 Ga0495677_0031302_143_1300 370
432 3300047471 Ga0495684_0000012 Ga0495684_0000012_162328_163446 370
433 3300047673 Ga0495593_0005499 Ga0495593_0005499_380_1498 370
434 3300048088 Ga0495602_0000064 Ga0495602_0000064_21515_22633 370
435 3300048903 Ga0496100_0007364 Ga0496100_0007364_4611_5723 370
436 3300048903 Ga0496100_0078035 Ga0496100_0078035_719_1876 370
437 3300048903 Ga0496100_0108032 Ga0496100_0108032_504_1661 370
438 3300048904 Ga0496101_0009345 Ga0496101_0009345_504_1661 370
439 3300048904 Ga0496101_0022365 Ga0496101_0022365_1184_2296 370
440 3300048905 Ga0496102_0031690 Ga0496102_0031690_3246_4403 370
441 3300048905 Ga0496102_0047152 Ga0496102_0047152_617_1729 370
442 3300048906 Ga0496103_0002040 Ga0496103_0002040_8480_9637 370
443 3300048906 Ga0496103_0030032 Ga0496103_0030032_732_1889 370
444 3300048906 Ga0496103_0096621 Ga0496103_0096621_326_1483 370
445 3300048907 Ga0496104_0001609 Ga0496104_0001609_4399_5556 370
446 3300048907 Ga0496104_0002163 Ga0496104_0002163_11296_12453 370
447 3300048907 Ga0496104_0011126 Ga0496104_0011126_2506_3618 370
448 3300048907 Ga0496104_0289415 Ga0496104_0289415_342_1499 370
449 3300048908 Ga0496105_0000754 Ga0496105_0000754_8945_10102 370
450 3300048908 Ga0496105_0006795 Ga0496105_0006795_3182_4294 370
451 3300048908 Ga0496105_0017420 Ga0496105_0017420_3452_4609 370
452 3300048908 Ga0496105_0065563 Ga0496105_0065563_817_1974 370
453 3300048908 Ga0496105_0119900 Ga0496105_0119900_892_2049 370
454 3300048909 Ga0496106_0003637 Ga0496106_0003637_2878_4035 370
455 3300048909 Ga0496106_0039379 Ga0496106_0039379_1259_2371 370
456 3300048909 Ga0496106_0045309 Ga0496106_0045309_50_1207 370
457 3300048910 Ga0496107_0000810 Ga0496107_0000810_2925_4082 370
458 3300048910 Ga0496107_0060281 Ga0496107_0060281_1398_2510 370
459 3300048910 Ga0496107_0157447 Ga0496107_0157447_182_1339 370
460 3300048911 Ga0496108_0005275 Ga0496108_0005275_2108_3220 370
461 3300048911 Ga0496108_0005539 Ga0496108_0005539_4551_5708 370
462 3300048911 Ga0496108_0215129 Ga0496108_0215129_518_1630 370
463 3300048912 Ga0496109_0001755 Ga0496109_0001755_2177_3334 370
464 3300048912 Ga0496109_0008088 Ga0496109_0008088_7113_8225 370
465 3300048912 Ga0496109_0043286 Ga0496109_0043286_1459_2571 370
466 3300048912 Ga0496109_0120921 Ga0496109_0120921_923_2080 370
467 3300048912 Ga0496109_0158562 Ga0496109_0158562_376_1533 370
468 3300048913 Ga0496110_0001702 Ga0496110_0001702_9230_10342 370
469 3300048913 Ga0496110_0016646 Ga0496110_0016646_4643_5800 370
470 3300048913 Ga0496110_0062726 Ga0496110_0062726_628_1785 370
471 3300048913 Ga0496110_0121018 Ga0496110_0121018_943_2055 370
472 3300048914 Ga0496111_0001059 Ga0496111_0001059_7043_8200 370
473 3300048914 Ga0496111_0018711 Ga0496111_0018711_2717_3874 370
474 3300048914 Ga0496111_0028517 Ga0496111_0028517_2403_3515 370
475 3300048914 Ga0496111_0164772 Ga0496111_0164772_440_1597 370
476 3300048915 Ga0496112_0030580 Ga0496112_0030580_3452_4609 370
477 3300048915 Ga0496112_0106728 Ga0496112_0106728_739_1851 370
478 3300048915 Ga0496112_0188225 Ga0496112_0188225_838_1995 370
479 3300048916 Ga0496113_0000933 Ga0496113_0000933_7299_8456 370
480 3300048916 Ga0496113_0005049 Ga0496113_0005049_4987_6144 370
481 3300048917 Ga0496114_0002210 Ga0496114_0002210_2888_4000 370
482 3300048917 Ga0496114_0004133 Ga0496114_0004133_6016_7173 370
483 3300048917 Ga0496114_0027277 Ga0496114_0027277_2790_3947 370
484 3300048918 Ga0496115_0007233 Ga0496115_0007233_169_1281 370
485 3300048918 Ga0496115_0012531 Ga0496115_0012531_342_1499 370
486 3300048918 Ga0496115_0101829 Ga0496115_0101829_256_1413 370
487 3300048918 Ga0496115_0129801 Ga0496115_0129801_682_1803 370
488 3300048918 Ga0496115_0138372 Ga0496115_0138372_843_1955 370
489 3300048918 Ga0496115_0168678 Ga0496115_0168678_472_1629 370
490 3300049568 Ga0501031_0005837 Ga0501031_0005837_3907_5070 370
491 3300049569 Ga0501032_0119854 Ga0501032_0119854_519_1631 370
492 3300049570 Ga0501033_0084935 Ga0501033_0084935_27_1190 370
493 3300049571 Ga0501034_0050156 Ga0501034_0050156_2449_3567 370
494 3300049571 Ga0501034_0060014 Ga0501034_0060014_1941_3104 370
495 3300049571 Ga0501034_0207973 Ga0501034_0207973_274_1392 370
496 3300049572 Ga0501036_0008715 Ga0501036_0008715_461_1624 370
497 3300049573 Ga0501037_0010069 Ga0501037_0010069_3373_4536 370
498 3300049574 Ga0501038_0010460 Ga0501038_0010460_6192_7355 370
499 3300049575 Ga0501039_0149434 Ga0501039_0149434_16_1137 370
500 3300049578 Ga0501042_0024204 Ga0501042_0024204_1510_2673 370
501 3300049579 Ga0501043_0046681 Ga0501043_0046681_1131_2294 370
502 3300049580 Ga0501046_0004428 Ga0501046_0004428_4094_5257 370
503 3300049581 Ga0501047_0082281 Ga0501047_0082281_27_1190 370
504 3300049581 Ga0501047_0197597 Ga0501047_0197597_624_1742 370
505 3300049582 Ga0501048_0008331 Ga0501048_0008331_2696_3859 370
506 3300049583 Ga0501067_0051201 Ga0501067_0051201_233_1396 370
507 3300049584 Ga0501068_0010438 Ga0501068_0010438_1588_2751 370
508 3300049585 Ga0501069_0021567 Ga0501069_0021567_322_1485 370
509 3300049587 Ga0501071_0051618 Ga0501071_0051618_415_1578 370
510 3300049588 Ga0501072_0016826 Ga0501072_0016826_2642_3763 370
511 3300049589 Ga0501073_0002666 Ga0501073_0002666_5692_6855 370
512 3300049590 Ga0501074_0001621 Ga0501074_0001621_6464_7627 370
513 3300049591 Ga0501075_0140867 Ga0501075_0140867_80_1192 370
514 3300049741 Ga0501079_0156664 Ga0501079_0156664_282_1439 370
515 3300049741 Ga0501079_0166166 Ga0501079_0166166_581_1693 370
516 3300049742 Ga0501080_0066382 Ga0501080_0066382_783_1901 370
517 3300049742 Ga0501080_0106572 Ga0501080_0106572_322_1485 370
518 3300049743 Ga0501081_0097592 Ga0501081_0097592_288_1445 370
519 3300049743 Ga0501081_0221814 Ga0501081_0221814_15_1178 370
520 3300049744 Ga0501083_0000986 Ga0501083_0000986_13701_14828 370
521 3300049744 Ga0501083_0063961 Ga0501083_0063961_1061_2182 370
522 3300049744 Ga0501083_0114516 Ga0501083_0114516_626_1744 370
523 3300049744 Ga0501083_0130798 Ga0501083_0130798_402_1565 370
524 3300049822 Ga0501035_0052977 Ga0501035_0052977_529_1692 370
525 3300049823 Ga0501044_0001050 Ga0501044_0001050_3919_5037 370
526 3300049823 Ga0501044_0017930 Ga0501044_0017930_717_1880 370
527 3300049824 Ga0501045_0055627 Ga0501045_0055627_1691_2854 370
528 3300049824 Ga0501045_0102263 Ga0501045_0102263_319_1440 370
529 3300050489 nmdc:mga03683_42287_c1 nmdc:mga03683_42287_c1_409_1590 370
530 3300050490 nmdc:mga03n38_45502_c1 nmdc:mga03n38_45502_c1_401_1522 370
531 3300050491 nmdc:mga00v17_51901_c1 nmdc:mga00v17_51901_c1_724_1869 370
532 3300050492 nmdc:mga0yw44_19625_c1 nmdc:mga0yw44_19625_c1_554_1711 370
533 3300050492 nmdc:mga0yw44_94440_c1 nmdc:mga0yw44_94440_c1_48_1160 370
534 3300050493 nmdc:mga0k408_805_c2 nmdc:mga0k408_805_c2_3063_4184 370
535 3300050494 nmdc:mga06z11_31448_c1 nmdc:mga06z11_31448_c1_459_1604 370
536 3300050494 nmdc:mga06z11_72399_c1 nmdc:mga06z11_72399_c1_195_1316 370
537 3300050507 nmdc:mga05p37_109346_c1 nmdc:mga05p37_109346_c1_490_1602 370
538 3300050507 nmdc:mga05p37_30275_c1 nmdc:mga05p37_30275_c1_4703_5860 370
539 3300050507 nmdc:mga05p37_55142_c1 nmdc:mga05p37_55142_c1_1749_2861 370
540 3300050507 nmdc:mga05p37_66731_c1 nmdc:mga05p37_66731_c1_1049_2173 370
541 3300050508 nmdc:mga09592_205928_c1 nmdc:mga09592_205928_c1_120_1232 370
542 3300050508 nmdc:mga09592_96825_c1 nmdc:mga09592_96825_c1_82_1194 370
543 3300050509 nmdc:mga0qj67_132081_c1 nmdc:mga0qj67_132081_c1_32_1144 370
544 3300050509 nmdc:mga0qj67_144642_c1 nmdc:mga0qj67_144642_c1_360_1481 370
545 3300050509 nmdc:mga0qj67_60_c1 nmdc:mga0qj67_60_c1_61071_62183 370
546 3300050510 nmdc:mga06r32_268023_c1 nmdc:mga06r32_268023_c1_130_1251 370
547 3300050511 nmdc:mga08y16_126950_c1 nmdc:mga08y16_126950_c1_537_1694 370
548 3300050511 nmdc:mga08y16_353105_c1 nmdc:mga08y16_353105_c1_328_1440 370
549 3300050511 nmdc:mga08y16_61962_c1 nmdc:mga08y16_61962_c1_1564_2685 370
550 3300050512 nmdc:mga0n895_3017_c1 nmdc:mga0n895_3017_c1_1555_2703 370
551 3300050514 nmdc:mga08x19_227291_c1 nmdc:mga08x19_227291_c1_103_1221 370
552 3300050515 nmdc:mga0a205_200884_c1 nmdc:mga0a205_200884_c1_146_1267 370
553 3300053077 Ga0495601_0000015 Ga0495601_0000015_21515_22633 370
554 3300053077 Ga0495601_0105928 Ga0495601_0105928_645_1757 370
555 3300053077 Ga0495601_0211169 Ga0495601_0211169_123_1235 370
556 3300053078 Ga0495612_0000096 Ga0495612_0000096_15385_16503 370
557 3300053083 Ga0495655_0011263 Ga0495655_0011263_390_1547 370
558 3300053084 Ga0495595_0000035 Ga0495595_0000035_57247_58365 370
559 3300053084 Ga0495595_0003933 Ga0495595_0003933_821_1933 370
560 3300053085 Ga0495619_0000044 Ga0495619_0000044_21815_22933 370
561 3300053085 Ga0495619_0074257 Ga0495619_0074257_155_1267 370
562 3300053096 Ga0500641_0014824 Ga0500641_0014824_43_1161 370
563 3300053099 Ga0500654_089093 Ga0500654_089093_184_1305 370
564 3300053131 Ga0500652_000488 Ga0500652_000488_12798_13916 370
565 3300053134 Ga0500658_0061944 Ga0500658_0061944_297_1442 370
566 3300053139 Ga0500568_0002398 Ga0500568_0002398_178_1359 370
567 3300053153 Ga0500616_0106686 Ga0500616_0106686_65_1177 370
568 3300053177 Ga0500636_0101606 Ga0500636_0101606_31_1149 370
569 3300053730 Ga0500645_028599 Ga0500645_028599_159_1277 370
570 3300054114 Ga0501084_0030993 Ga0501084_0030993_2945_4108 370
571 3300060353 Ga0501082_0000016 Ga0501082_0000016_11235_12356 370
572 3300060353 Ga0501082_0030709 Ga0501082_0030709_1493_2656 370
573 3300060353 Ga0501082_0194171 Ga0501082_0194171_13_1134 370

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04107

GCS2

Glutamate-cysteine ligase family 2(GCS2)

52

332

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.8927 2 362
1r8g-assembly1.cif.gz_B structure and function of ybdk 0.888 2 362
1r8g-assembly1.cif.gz_A structure and function of ybdk 0.8872 2 367
1tt4-assembly1.cif.gz_B structure of np459575, a predicted glutathione synthase from salmonella typhimurium 0.8736 2 362
1r8g-assembly1.cif.gz_A structure and function of ybdk 0.8658 2 367
ID Description Score Start End Superfamily
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9361 2 366 3.30.590.20
af_P9WPK9_8_375_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.9092 2 366 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.873 2 367 3.30.590.20
1r8gA00 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.8514 2 367 3.30.590.20
af_I6YCS6_35_480_3.30.590.20 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; 0.8294 2 346 3.30.590.20
ID Description Score Start End GO Terms
AF-A0A327L2A5-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9797 4 370 GO:0004357
GO:0005524
GO:0042398
AF-A4YLK4-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9779 1 370 GO:0004357
GO:0005524
GO:0042398
AF-A0A363TMY8-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9778 1 370 GO:0004357
GO:0005524
GO:0042398
AF-A0A0R3CPT8-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9769 5 369 GO:0004357
GO:0005524
GO:0042398
AF-A0A363TMY8-F1-model_v4 Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) 0.9752 1 370 GO:0004357
GO:0005524
GO:0042398

Feature Viewer

pLDDT pTM Quality
91.12 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map