F465180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 342 | 572 | 379 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10041806|Ga0114129_100418062 |
| Length | 415 |
| Sequence | MTADPKDFVPQETEVSVEAKASGAEAAVTRRPVPVRKPAAGRRRRMAGAFTIGIEEEYFLVDAETKLATRHMPEDFMRAAKSATDGRAGGEFLQSQVEVISSPHSSMAEARAELRHLRQTVAAVAAEHGLAILAAGTHPTAFWASSLQTPKERYDAVMHDLQMIGRRNMLCGMHVHVELPDPDDRVDVMCRMLPHLPLFLALSTSSPFWQARRTGLKGYRLAAYDELPRTGVPELFRTKEEFDAYIAALVRAGVIEDSSFVWWAIRPSFNHPTLELRAPDCCTLVNDTIAIAALYRTLARHLCFNPWRNFDLNAVSRAIVVENKWRAQRYGVNGTFVTEQGAVTVGEMLDQVIGQTAADAEALGCTEEIRRCRSIVSAGTSADAQLAVYEAHKDSKDREAALRAVTDWIASATLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 92 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 177 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 334 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 341 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.16 |
| Nodule | 0.17 |
| Rhizoplane | 12.57 |
| Rhizosphere | 79.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10030376 | 3300001990 | Bacteria | 1691 |
| 2 | JGI24750J21931_1002148 | 3300002070 | Bacteria | 2392 |
| 3 | JGI24744J21845_10000578 | 3300002077 | Bacteria | 6564 |
| 4 | JGI24744J21845_10023387 | 3300002077 | Bacteria | 1210 |
| 5 | JGI24034J26672_10003395 | 3300002239 | Bacteria | 2220 |
| 6 | JGI24742J22300_10000829 | 3300002244 | Bacteria | 4722 |
| 7 | JGI25406J46586_10022199 | 3300003203 | Bacteria | 2534 |
| 8 | JGI25153J46596_10000660 | 3300003215 | Bacteria | 21135 |
| 9 | Ga0070676_10083523 | 3300005328 | Bacteria | 1943 |
| 10 | Ga0070690_100046659 | 3300005330 | Bacteria | 2755 |
| 11 | Ga0070670_100074499 | 3300005331 | Bacteria | 2916 |
| 12 | Ga0070677_10022053 | 3300005333 | Bacteria | 2341 |
| 13 | Ga0070677_10024627 | 3300005333 | Bacteria | 2240 |
| 14 | Ga0070666_10020181 | 3300005335 | Bacteria | 4307 |
| 15 | Ga0070680_100008893 | 3300005336 | Bacteria | 7698 |
| 16 | Ga0068868_100004344 | 3300005338 | Bacteria | 9938 |
| 17 | Ga0068868_100007586 | 3300005338 | Bacteria | 7731 |
| 18 | Ga0070660_100014295 | 3300005339 | Bacteria | 5716 |
| 19 | Ga0070689_100013414 | 3300005340 | Bacteria | 5930 |
| 20 | Ga0070689_100025225 | 3300005340 | Bacteria | 4465 |
| 21 | Ga0070687_100007221 | 3300005343 | Bacteria | 4613 |
| 22 | Ga0070687_100014015 | 3300005343 | Bacteria | 3590 |
| 23 | Ga0070687_100039569 | 3300005343 | Bacteria | 2370 |
| 24 | Ga0070668_100037206 | 3300005347 | Bacteria | 3715 |
| 25 | Ga0070669_100020211 | 3300005353 | Bacteria | 4756 |
| 26 | Ga0070675_100003175 | 3300005354 | Bacteria | 12436 |
| 27 | Ga0070675_100032579 | 3300005354 | Bacteria | 4219 |
| 28 | Ga0070675_100141672 | 3300005354 | Bacteria | 2055 |
| 29 | Ga0070675_100211756 | 3300005354 | Bacteria | 1685 |
| 30 | Ga0070674_100001401 | 3300005356 | Bacteria | 12771 |
| 31 | Ga0070673_100006028 | 3300005364 | Bacteria | 7850 |
| 32 | Ga0070673_100124261 | 3300005364 | Bacteria | 2157 |
| 33 | Ga0070688_100012050 | 3300005365 | Bacteria | 4830 |
| 34 | Ga0070688_100038258 | 3300005365 | Bacteria | 2928 |
| 35 | Ga0070659_100007701 | 3300005366 | Bacteria | 7833 |
| 36 | Ga0070667_100025917 | 3300005367 | Bacteria | 4877 |
| 37 | Ga0070703_10015721 | 3300005406 | Bacteria | 2167 |
| 38 | Ga0070714_100199678 | 3300005435 | Bacteria | 1829 |
| 39 | Ga0070714_100272261 | 3300005435 | Bacteria | 1570 |
| 40 | Ga0070713_100077695 | 3300005436 | Bacteria | 2823 |
| 41 | Ga0070713_100081966 | 3300005436 | Bacteria | 2754 |
| 42 | Ga0070713_100122292 | 3300005436 | Bacteria | 2284 |
| 43 | Ga0070710_10011557 | 3300005437 | Bacteria | 4365 |
| 44 | Ga0070701_10151563 | 3300005438 | Bacteria | 1335 |
| 45 | Ga0070711_100105348 | 3300005439 | Bacteria | 2060 |
| 46 | Ga0070711_100145987 | 3300005439 | Bacteria | 1779 |
| 47 | Ga0070711_100226830 | 3300005439 | Bacteria | 1455 |
| 48 | Ga0070700_100012600 | 3300005441 | Bacteria | 4725 |
| 49 | Ga0070663_100005197 | 3300005455 | Bacteria | 7708 |
| 50 | Ga0070678_100151313 | 3300005456 | Bacteria | 1869 |
| 51 | Ga0070662_100006574 | 3300005457 | Bacteria | 7502 |
| 52 | Ga0070681_10309341 | 3300005458 | Bacteria | 1489 |
| 53 | Ga0068867_100212687 | 3300005459 | Bacteria | 1554 |
| 54 | Ga0070685_10030514 | 3300005466 | Bacteria | 3005 |
| 55 | Ga0070707_100218183 | 3300005468 | Bacteria | 1858 |
| 56 | Ga0070699_100003706 | 3300005518 | Bacteria | 13512 |
| 57 | Ga0070679_100060447 | 3300005530 | Bacteria | 3776 |
| 58 | Ga0070684_100059514 | 3300005535 | Bacteria | 3340 |
| 59 | Ga0068853_100055305 | 3300005539 | Bacteria | 3421 |
| 60 | Ga0070672_100000898 | 3300005543 | Bacteria | 17888 |
| 61 | Ga0070672_100269402 | 3300005543 | Bacteria | 1438 |
| 62 | Ga0070686_100055026 | 3300005544 | Bacteria | 2547 |
| 63 | Ga0070695_100084693 | 3300005545 | Bacteria | 2104 |
| 64 | Ga0070665_100009985 | 3300005548 | Bacteria | 9604 |
| 65 | Ga0070704_100043161 | 3300005549 | Bacteria | 3124 |
| 66 | Ga0070704_100067986 | 3300005549 | Bacteria | 2575 |
| 67 | Ga0068857_100308745 | 3300005577 | Bacteria | 1459 |
| 68 | Ga0068854_100018289 | 3300005578 | Bacteria | 4703 |
| 69 | Ga0068856_100026810 | 3300005614 | Bacteria | 5619 |
| 70 | Ga0070702_100003350 | 3300005615 | Bacteria | 7153 |
| 71 | Ga0068852_100004585 | 3300005616 | Bacteria | 9785 |
| 72 | Ga0068859_100040777 | 3300005617 | Bacteria | 4662 |
| 73 | Ga0068859_100086478 | 3300005617 | Bacteria | 3182 |
| 74 | Ga0068859_100200924 | 3300005617 | Bacteria | 2078 |
| 75 | Ga0068864_100007736 | 3300005618 | Bacteria | 8855 |
| 76 | Ga0068864_100154167 | 3300005618 | Bacteria | 2084 |
| 77 | Ga0068866_10002579 | 3300005718 | Bacteria | 7476 |
| 78 | Ga0068866_10120109 | 3300005718 | Bacteria | 1480 |
| 79 | Ga0068861_100002506 | 3300005719 | Bacteria | 11987 |
| 80 | Ga0068851_10014563 | 3300005834 | Bacteria | 3736 |
| 81 | Ga0068870_10001759 | 3300005840 | Bacteria | 8883 |
| 82 | Ga0068863_100006002 | 3300005841 | Bacteria | 11910 |
| 83 | Ga0068863_100224650 | 3300005841 | Bacteria | 1810 |
| 84 | Ga0068858_100004133 | 3300005842 | Bacteria | 14288 |
| 85 | Ga0068858_100131455 | 3300005842 | Bacteria | 2348 |
| 86 | Ga0068858_100156834 | 3300005842 | Bacteria | 2142 |
| 87 | Ga0068860_100003806 | 3300005843 | Bacteria | 15525 |
| 88 | Ga0068862_100006027 | 3300005844 | Bacteria | 10093 |
| 89 | Ga0081455_10001263 | 3300005937 | Bacteria | 31603 |
| 90 | Ga0081455_10011029 | 3300005937 | Bacteria | 9102 |
| 91 | Ga0081455_10066743 | 3300005937 | Bacteria | 3002 |
| 92 | Ga0081538_10023004 | 3300005981 | Bacteria | 4493 |
| 93 | Ga0081538_10031421 | 3300005981 | Bacteria | 3582 |
| 94 | Ga0081538_10064119 | 3300005981 | Bacteria | 2080 |
| 95 | Ga0081540_1000128 | 3300005983 | Bacteria | 80512 |
| 96 | Ga0081540_1001551 | 3300005983 | Bacteria | 19695 |
| 97 | Ga0081540_1015315 | 3300005983 | Bacteria | 4859 |
| 98 | Ga0081539_10005924 | 3300005985 | Bacteria | 12071 |
| 99 | Ga0070717_10166242 | 3300006028 | Bacteria | 1916 |
| 100 | Ga0075365_10030693 | 3300006038 | Bacteria | 3445 |
| 101 | Ga0075365_10045180 | 3300006038 | Bacteria | 2889 |
| 102 | Ga0075363_100003705 | 3300006048 | Bacteria | 6571 |
| 103 | Ga0075364_10003468 | 3300006051 | Bacteria | 8974 |
| 104 | Ga0075364_10082766 | 3300006051 | Bacteria | 2123 |
| 105 | Ga0070715_10017966 | 3300006163 | Bacteria | 2687 |
| 106 | Ga0070712_100000277 | 3300006175 | Bacteria | 28821 |
| 107 | Ga0070712_100033236 | 3300006175 | Bacteria | 3489 |
| 108 | Ga0075362_10003019 | 3300006177 | Bacteria | 5788 |
| 109 | Ga0075367_10051084 | 3300006178 | Bacteria | 2443 |
| 110 | Ga0075367_10078787 | 3300006178 | Bacteria | 1990 |
| 111 | Ga0075369_10021975 | 3300006186 | Bacteria | 2628 |
| 112 | Ga0075369_10063447 | 3300006186 | Bacteria | 1616 |
| 113 | Ga0075366_10004591 | 3300006195 | Bacteria | 7420 |
| 114 | Ga0075366_10114544 | 3300006195 | Bacteria | 1623 |
| 115 | Ga0075370_10057860 | 3300006353 | Bacteria | 2204 |
| 116 | Ga0075370_10099695 | 3300006353 | Bacteria | 1680 |
| 117 | Ga0068871_100122539 | 3300006358 | Bacteria | 2198 |
| 118 | Ga0075428_100023040 | 3300006844 | Bacteria | 6892 |
| 119 | Ga0075428_100182810 | 3300006844 | Bacteria | 2269 |
| 120 | Ga0075428_100220814 | 3300006844 | Bacteria | 2046 |
| 121 | Ga0075428_100378490 | 3300006844 | Bacteria | 1518 |
| 122 | Ga0075430_100000067 | 3300006846 | Bacteria | 56477 |
| 123 | Ga0075430_100008377 | 3300006846 | Bacteria | 8735 |
| 124 | Ga0075430_100142128 | 3300006846 | Bacteria | 1999 |
| 125 | Ga0075431_100037781 | 3300006847 | Bacteria | 4972 |
| 126 | Ga0075431_100077637 | 3300006847 | Bacteria | 3427 |
| 127 | Ga0075431_100154771 | 3300006847 | Bacteria | 2359 |
| 128 | Ga0075431_100260294 | 3300006847 | Bacteria | 1761 |
| 129 | Ga0075433_10283037 | 3300006852 | Bacteria | 1469 |
| 130 | Ga0075434_100055145 | 3300006871 | Bacteria | 3950 |
| 131 | Ga0075434_100178134 | 3300006871 | Bacteria | 2146 |
| 132 | Ga0075434_100419840 | 3300006871 | Bacteria | 1359 |
| 133 | Ga0075429_100008809 | 3300006880 | Bacteria | 8774 |
| 134 | Ga0075429_100355379 | 3300006880 | Bacteria | 1283 |
| 135 | Ga0068865_100009041 | 3300006881 | Bacteria | 6163 |
| 136 | Ga0075436_100020342 | 3300006914 | Bacteria | 4556 |
| 137 | Ga0075436_100180185 | 3300006914 | Bacteria | 1493 |
| 138 | Ga0097620_100040774 | 3300006931 | Bacteria | 4662 |
| 139 | Ga0097620_100086478 | 3300006931 | Bacteria | 3182 |
| 140 | Ga0097620_100200932 | 3300006931 | Bacteria | 2078 |
| 141 | Ga0075435_100047464 | 3300007076 | Bacteria | 3449 |
| 142 | Ga0075435_100089017 | 3300007076 | Bacteria | 2544 |
| 143 | Ga0099794_10015586 | 3300007265 | Bacteria | 3358 |
| 144 | Ga0099795_10053585 | 3300007788 | Bacteria | 1477 |
| 145 | Ga0111539_10008081 | 3300009094 | Bacteria | 13410 |
| 146 | Ga0111539_10100625 | 3300009094 | Bacteria | 3394 |
| 147 | Ga0111539_10403851 | 3300009094 | Bacteria | 1591 |
| 148 | Ga0105245_10005857 | 3300009098 | Bacteria | 10792 |
| 149 | Ga0105245_10119478 | 3300009098 | Bacteria | 2461 |
| 150 | Ga0105245_10143174 | 3300009098 | Bacteria | 2254 |
| 151 | Ga0105247_10009817 | 3300009101 | Bacteria | 5799 |
| 152 | Ga0105247_10035426 | 3300009101 | Bacteria | 3042 |
| 153 | Ga0114129_10020121 | 3300009147 | Bacteria | 9499 |
| 154 | Ga0114129_10041806 | 3300009147 | Bacteria | 6454 |
| 155 | Ga0114129_10114799 | 3300009147 | Bacteria | 3713 |
| 156 | Ga0114129_10123887 | 3300009147 | Bacteria | 3554 |
| 157 | Ga0114129_10182444 | 3300009147 | Bacteria | 2855 |
| 158 | Ga0114129_10319796 | 3300009147 | Bacteria | 2063 |
| 159 | Ga0105241_10301551 | 3300009174 | Bacteria | 1375 |
| 160 | Ga0105242_10019227 | 3300009176 | Bacteria | 5351 |
| 161 | Ga0105248_10012271 | 3300009177 | Bacteria | 9449 |
| 162 | Ga0105248_10111763 | 3300009177 | Bacteria | 3081 |
| 163 | Ga0105237_10422771 | 3300009545 | Bacteria | 1338 |
| 164 | Ga0105238_10066854 | 3300009551 | Bacteria | 3595 |
| 165 | Ga0105238_10091916 | 3300009551 | Bacteria | 3022 |
| 166 | Ga0099796_10007009 | 3300010159 | Unclassified | 2921 |
| 167 | Ga0105239_10007446 | 3300010375 | Bacteria | 12562 |
| 168 | Ga0105239_10040888 | 3300010375 | Bacteria | 5081 |
| 169 | Ga0105239_10157686 | 3300010375 | Bacteria | 2535 |
| 170 | Ga0105246_10060010 | 3300011119 | Bacteria | 2641 |
| 171 | Ga0105246_10075208 | 3300011119 | Bacteria | 2390 |
| 172 | Ga0105246_10194209 | 3300011119 | Bacteria | 1573 |
| 173 | Ga0157374_10017453 | 3300013296 | Bacteria | 6320 |
| 174 | Ga0157374_10177838 | 3300013296 | Bacteria | 2077 |
| 175 | Ga0157378_10013150 | 3300013297 | Bacteria | 7241 |
| 176 | Ga0157378_10164417 | 3300013297 | Bacteria | 2078 |
| 177 | Ga0163162_10006545 | 3300013306 | Bacteria | 11286 |
| 178 | Ga0157372_10378462 | 3300013307 | Bacteria | 1650 |
| 179 | Ga0157375_10006121 | 3300013308 | Bacteria | 10489 |
| 180 | Ga0163163_10016469 | 3300014325 | Bacteria | 6873 |
| 181 | Ga0163163_10036482 | 3300014325 | Bacteria | 4776 |
| 182 | Ga0157380_10003267 | 3300014326 | Bacteria | 11108 |
| 183 | Ga0157380_10447022 | 3300014326 | Bacteria | 1240 |
| 184 | Ga0157377_10016261 | 3300014745 | Bacteria | 3823 |
| 185 | Ga0157379_10005247 | 3300014968 | Bacteria | 11127 |
| 186 | Ga0157376_10199081 | 3300014969 | Bacteria | 1841 |
| 187 | Ga0163161_10003329 | 3300017792 | Bacteria | 11266 |
| 188 | Ga0213872_10000559 | 3300021361 | Bacteria | 28845 |
| 189 | Ga0213872_10000896 | 3300021361 | Bacteria | 21421 |
| 190 | Ga0213872_10001399 | 3300021361 | Bacteria | 15889 |
| 191 | Ga0213872_10005016 | 3300021361 | Bacteria | 6873 |
| 192 | Ga0213872_10020207 | 3300021361 | Bacteria | 3068 |
| 193 | Ga0209233_1006297 | 3300025261 | Bacteria | 3838 |
| 194 | Ga0209455_1001095 | 3300025272 | Bacteria | 13326 |
| 195 | Ga0209758_1000772 | 3300025297 | Bacteria | 45993 |
| 196 | Ga0207697_10024543 | 3300025315 | Bacteria | 2468 |
| 197 | Ga0207653_10036532 | 3300025885 | Bacteria | 1601 |
| 198 | Ga0207682_10002142 | 3300025893 | Bacteria | 8946 |
| 199 | Ga0207682_10024955 | 3300025893 | Bacteria | 2370 |
| 200 | Ga0207642_10001398 | 3300025899 | Bacteria | 7482 |
| 201 | Ga0207710_10010515 | 3300025900 | Bacteria | 3899 |
| 202 | Ga0207688_10002031 | 3300025901 | Bacteria | 10865 |
| 203 | Ga0207680_10037799 | 3300025903 | Bacteria | 2789 |
| 204 | Ga0207685_10011888 | 3300025905 | Bacteria | 2637 |
| 205 | Ga0207699_10032085 | 3300025906 | Bacteria | 2956 |
| 206 | Ga0207645_10007050 | 3300025907 | Bacteria | 7998 |
| 207 | Ga0207643_10001570 | 3300025908 | Bacteria | 12954 |
| 208 | Ga0207643_10010100 | 3300025908 | Bacteria | 5074 |
| 209 | Ga0207654_10070492 | 3300025911 | Bacteria | 2075 |
| 210 | Ga0207707_10128085 | 3300025912 | Bacteria | 2220 |
| 211 | Ga0207693_10001633 | 3300025915 | Bacteria | 19798 |
| 212 | Ga0207693_10026048 | 3300025915 | Bacteria | 4632 |
| 213 | Ga0207693_10090145 | 3300025915 | Bacteria | 2403 |
| 214 | Ga0207693_10199852 | 3300025915 | Bacteria | 1572 |
| 215 | Ga0207663_10086482 | 3300025916 | Bacteria | 2068 |
| 216 | Ga0207663_10122842 | 3300025916 | Bacteria | 1781 |
| 217 | Ga0207660_10136740 | 3300025917 | Bacteria | 1870 |
| 218 | Ga0207662_10009133 | 3300025918 | Bacteria | 5449 |
| 219 | Ga0207662_10022123 | 3300025918 | Bacteria | 3641 |
| 220 | Ga0207662_10062016 | 3300025918 | Bacteria | 2246 |
| 221 | Ga0207662_10063893 | 3300025918 | Bacteria | 2214 |
| 222 | Ga0207657_10090268 | 3300025919 | Bacteria | 2557 |
| 223 | Ga0207657_10098290 | 3300025919 | Bacteria | 2433 |
| 224 | Ga0207652_10014131 | 3300025921 | Bacteria | 6464 |
| 225 | Ga0207681_10178401 | 3300025923 | Bacteria | 1616 |
| 226 | Ga0207694_10141759 | 3300025924 | Bacteria | 1933 |
| 227 | Ga0207694_10207466 | 3300025924 | Bacteria | 1595 |
| 228 | Ga0207650_10001375 | 3300025925 | Bacteria | 17538 |
| 229 | Ga0207659_10008042 | 3300025926 | Bacteria | 6529 |
| 230 | Ga0207659_10050918 | 3300025926 | Bacteria | 2944 |
| 231 | Ga0207687_10014594 | 3300025927 | Bacteria | 5142 |
| 232 | Ga0207687_10076609 | 3300025927 | Bacteria | 2403 |
| 233 | Ga0207700_10114479 | 3300025928 | Bacteria | 2176 |
| 234 | Ga0207700_10116611 | 3300025928 | Bacteria | 2158 |
| 235 | Ga0207700_10290624 | 3300025928 | Bacteria | 1409 |
| 236 | Ga0207664_10119826 | 3300025929 | Bacteria | 2201 |
| 237 | Ga0207644_10004097 | 3300025931 | Bacteria | 9446 |
| 238 | Ga0207644_10193618 | 3300025931 | Bacteria | 1600 |
| 239 | Ga0207706_10001850 | 3300025933 | Bacteria | 20737 |
| 240 | Ga0207706_10020785 | 3300025933 | Bacteria | 5896 |
| 241 | Ga0207670_10002865 | 3300025936 | Bacteria | 9096 |
| 242 | Ga0207670_10041087 | 3300025936 | Bacteria | 3039 |
| 243 | Ga0207669_10003999 | 3300025937 | Bacteria | 6444 |
| 244 | Ga0207669_10016637 | 3300025937 | Bacteria | 3743 |
| 245 | Ga0207704_10056295 | 3300025938 | Bacteria | 2408 |
| 246 | Ga0207665_10193350 | 3300025939 | Bacteria | 1479 |
| 247 | Ga0207691_10001076 | 3300025940 | Bacteria | 27185 |
| 248 | Ga0207691_10002814 | 3300025940 | Bacteria | 16962 |
| 249 | Ga0207691_10260354 | 3300025940 | Bacteria | 1495 |
| 250 | Ga0207711_10003227 | 3300025941 | Bacteria | 14209 |
| 251 | Ga0207711_10014418 | 3300025941 | Bacteria | 6564 |
| 252 | Ga0207689_10008025 | 3300025942 | Bacteria | 9211 |
| 253 | Ga0207689_10038993 | 3300025942 | Bacteria | 3934 |
| 254 | Ga0207661_10062370 | 3300025944 | Bacteria | 3016 |
| 255 | Ga0207679_10017058 | 3300025945 | Bacteria | 4833 |
| 256 | Ga0207651_10062039 | 3300025960 | Bacteria | 2603 |
| 257 | Ga0207712_10126545 | 3300025961 | Bacteria | 1941 |
| 258 | Ga0207668_10017784 | 3300025972 | Bacteria | 4461 |
| 259 | Ga0207658_10196557 | 3300025986 | Bacteria | 1680 |
| 260 | Ga0207677_10005514 | 3300026023 | Bacteria | 6873 |
| 261 | Ga0207677_10016802 | 3300026023 | Bacteria | 4345 |
| 262 | Ga0207639_10062323 | 3300026041 | Bacteria | 2883 |
| 263 | Ga0207678_10005280 | 3300026067 | Bacteria | 11569 |
| 264 | Ga0207708_10004126 | 3300026075 | Bacteria | 10691 |
| 265 | Ga0207708_10241774 | 3300026075 | Bacteria | 1452 |
| 266 | Ga0207702_10023972 | 3300026078 | Bacteria | 5063 |
| 267 | Ga0207641_10005434 | 3300026088 | Bacteria | 10875 |
| 268 | Ga0207641_10299956 | 3300026088 | Bacteria | 1517 |
| 269 | Ga0207648_10015137 | 3300026089 | Bacteria | 7099 |
| 270 | Ga0207648_10086844 | 3300026089 | Bacteria | 2729 |
| 271 | Ga0207676_10002920 | 3300026095 | Bacteria | 12181 |
| 272 | Ga0207676_10176644 | 3300026095 | Bacteria | 1866 |
| 273 | Ga0207676_10475390 | 3300026095 | Bacteria | 1182 |
| 274 | Ga0207675_100000944 | 3300026118 | Bacteria | 29022 |
| 275 | Ga0209179_1004468 | 3300027512 | Bacteria | 2113 |
| 276 | Ga0209588_1032280 | 3300027671 | Bacteria | 1677 |
| 277 | Ga0268266_10012800 | 3300028379 | Bacteria | 7246 |
| 278 | Ga0268265_10027494 | 3300028380 | Bacteria | 4061 |
| 279 | Ga0268264_10011715 | 3300028381 | Bacteria | 7232 |
| 280 | Ga0265337_1007649 | 3300028556 | Bacteria | 4025 |
| 281 | Ga0265319_1003972 | 3300028563 | Bacteria | 7507 |
| 282 | Ga0265334_10003484 | 3300028573 | Bacteria | 7149 |
| 283 | Ga0265323_10002861 | 3300028653 | Bacteria | 7753 |
| 284 | Ga0265336_10000389 | 3300028666 | Bacteria | 27626 |
| 285 | Ga0265338_10000176 | 3300028800 | Bacteria | 118726 |
| 286 | Ga0265324_10004317 | 3300029957 | Bacteria | 6479 |
| 287 | Ga0265330_10041807 | 3300031235 | Bacteria | 2032 |
| 288 | Ga0265332_10022996 | 3300031238 | Bacteria | 2750 |
| 289 | Ga0265320_10008917 | 3300031240 | Bacteria | 6092 |
| 290 | Ga0265325_10000305 | 3300031241 | Bacteria | 34555 |
| 291 | Ga0265329_10015683 | 3300031242 | Bacteria | 2642 |
| 292 | Ga0265329_10030727 | 3300031242 | Bacteria | 1749 |
| 293 | Ga0265340_10010579 | 3300031247 | Bacteria | 4932 |
| 294 | Ga0265340_10015095 | 3300031247 | Bacteria | 4019 |
| 295 | Ga0265340_10041595 | 3300031247 | Bacteria | 2258 |
| 296 | Ga0265339_10056400 | 3300031249 | Bacteria | 2127 |
| 297 | Ga0265339_10099024 | 3300031249 | Bacteria | 1520 |
| 298 | Ga0265331_10069353 | 3300031250 | Bacteria | 1651 |
| 299 | Ga0265316_10048387 | 3300031344 | Bacteria | 3356 |
| 300 | Ga0265316_10195443 | 3300031344 | Bacteria | 1501 |
| 301 | Ga0265313_10025765 | 3300031595 | Bacteria | 3109 |
| 302 | Ga0265314_10028660 | 3300031711 | Bacteria | 4149 |
| 303 | Ga0265342_10000109 | 3300031712 | Bacteria | 91321 |
| 304 | Ga0265342_10043953 | 3300031712 | Bacteria | 2694 |
| 305 | Ga0265342_10048477 | 3300031712 | Bacteria | 2546 |
| 306 | Ga0373944_0031816 | 3300035089 | Bacteria | 1590 |
| 307 | Ga0373923_0002028 | 3300035111 | Bacteria | 6099 |
| 308 | Ga0373932_0043865 | 3300035112 | Bacteria | 1302 |
| 309 | Ga0373936_0001332 | 3300035113 | Bacteria | 8962 |
| 310 | Ga0373939_0010545 | 3300035114 | Bacteria | 2313 |
| 311 | Ga0373941_0017529 | 3300035115 | Bacteria | 1964 |
| 312 | Ga0373953_0068991 | 3300035117 | Bacteria | 1456 |
| 313 | Ga0373954_0009547 | 3300035118 | Bacteria | 4268 |
| 314 | Ga0373943_0001174 | 3300035170 | Bacteria | 11694 |
| 315 | Ga0373946_0013528 | 3300035171 | Bacteria | 3069 |
| 316 | Ga0373955_0000069 | 3300035172 | Bacteria | 41106 |
| 317 | Ga0373961_0013304 | 3300035241 | Bacteria | 2073 |
| 318 | Ga0373924_0000869 | 3300035410 | Bacteria | 9505 |
| 319 | Ga0373931_0000835 | 3300035691 | Bacteria | 12936 |
| 320 | Ga0373931_0007500 | 3300035691 | Bacteria | 5136 |
| 321 | Ga0373931_0219802 | 3300035691 | Bacteria | 1143 |
| 322 | Ga0373935_0000938 | 3300035692 | Bacteria | 15787 |
| 323 | Ga0373927_0001966 | 3300035695 | Bacteria | 15156 |
| 324 | Ga0373927_0011117 | 3300035695 | Bacteria | 5996 |
| 325 | Ga0373927_0045006 | 3300035695 | Bacteria | 2855 |
| 326 | Ga0373933_0001354 | 3300035724 | Bacteria | 14445 |
| 327 | Ga0373933_0092929 | 3300035724 | Bacteria | 1864 |
| 328 | Ga0373947_0001670 | 3300035725 | Bacteria | 13583 |
| 329 | Ga0373947_0077794 | 3300035725 | Bacteria | 2046 |
| 330 | Ga0373937_0000356 | 3300036401 | Bacteria | 42503 |
| 331 | Ga0373937_0052822 | 3300036401 | Bacteria | 3728 |
| 332 | Ga0373925_0000462 | 3300037068 | Bacteria | 40936 |
| 333 | Ga0373925_0248657 | 3300037068 | Bacteria | 1426 |
| 334 | Ga0395900_0260560 | 3300037418 | Bacteria | 1732 |
| 335 | Ga0395901_0112636 | 3300038443 | Bacteria | 2857 |
| 336 | Ga0436365_0015250 | 3300039437 | Bacteria | 5764 |
| 337 | Ga0436365_0394916 | 3300039437 | Bacteria | 7521 |
| 338 | Ga0436361_0020532 | 3300039447 | Bacteria | 44080 |
| 339 | Ga0436361_0129646 | 3300039447 | Bacteria | 9661 |
| 340 | Ga0436361_0142459 | 3300039447 | Bacteria | 45175 |
| 341 | Ga0436361_0423477 | 3300039447 | Bacteria | 1939 |
| 342 | Ga0436361_0450698 | 3300039447 | Bacteria | 8556 |
| 343 | Ga0436361_0497647 | 3300039447 | Bacteria | 1644 |
| 344 | Ga0436361_0572145 | 3300039447 | Bacteria | 42313 |
| 345 | Ga0436361_0797374 | 3300039447 | Bacteria | 2000 |
| 346 | Ga0436361_0892205 | 3300039447 | Bacteria | 3129 |
| 347 | Ga0439460_0015132 | 3300042461 | Bacteria | 2038 |
| 348 | Ga0466971_0067674 | 3300044719 | Bacteria | 1619 |
| 349 | Ga0466959_0143938 | 3300045049 | Bacteria | 1683 |
| 350 | Ga0466958_0000314 | 3300045836 | Bacteria | 19212 |
| 351 | Ga0495592_0000090 | 3300046454 | Bacteria | 80171 |
| 352 | Ga0495603_0062537 | 3300046455 | Bacteria | 2197 |
| 353 | Ga0495629_0071834 | 3300046459 | Bacteria | 2415 |
| 354 | Ga0495629_0104385 | 3300046459 | Bacteria | 1977 |
| 355 | Ga0495641_0036499 | 3300046461 | Bacteria | 2309 |
| 356 | Ga0495651_0000682 | 3300046462 | Bacteria | 26412 |
| 357 | Ga0495653_0000322 | 3300046463 | Bacteria | 38965 |
| 358 | Ga0495582_0042181 | 3300046473 | Bacteria | 2514 |
| 359 | Ga0495605_0055995 | 3300046474 | Bacteria | 1903 |
| 360 | Ga0495662_0001023 | 3300046476 | Bacteria | 13709 |
| 361 | Ga0495664_0000078 | 3300046477 | Bacteria | 47377 |
| 362 | Ga0495584_0092106 | 3300046491 | Bacteria | 1529 |
| 363 | Ga0495594_0021004 | 3300046499 | Bacteria | 3483 |
| 364 | Ga0495608_0000022 | 3300046511 | Bacteria | 165111 |
| 365 | Ga0495618_0000229 | 3300046514 | Bacteria | 40948 |
| 366 | Ga0495628_0000035 | 3300046516 | Bacteria | 111560 |
| 367 | Ga0495630_0000377 | 3300046517 | Bacteria | 35153 |
| 368 | Ga0495630_0092713 | 3300046517 | Bacteria | 2283 |
| 369 | Ga0495652_0000062 | 3300046529 | Bacteria | 111572 |
| 370 | Ga0495665_0036019 | 3300046531 | Bacteria | 2642 |
| 371 | Ga0495640_0000021 | 3300046533 | Bacteria | 110511 |
| 372 | Ga0495640_0094009 | 3300046533 | Bacteria | 1975 |
| 373 | Ga0495587_0000006 | 3300046536 | Bacteria | 310070 |
| 374 | Ga0495609_0029391 | 3300046538 | Bacteria | 2503 |
| 375 | Ga0495645_0000174 | 3300046543 | Bacteria | 44827 |
| 376 | Ga0495667_0000161 | 3300046559 | Bacteria | 45781 |
| 377 | Ga0495656_0001474 | 3300046615 | Bacteria | 7707 |
| 378 | Ga0495656_0062586 | 3300046615 | Bacteria | 1628 |
| 379 | Ga0495634_0000350 | 3300046642 | Bacteria | 44772 |
| 380 | Ga0495635_0000018 | 3300046663 | Bacteria | 193591 |
| 381 | Ga0495661_0139652 | 3300046665 | Bacteria | 1319 |
| 382 | Ga0495657_0000245 | 3300046675 | Bacteria | 49381 |
| 383 | Ga0495599_0000032 | 3300046678 | Bacteria | 108178 |
| 384 | Ga0495623_0000004 | 3300046679 | Bacteria | 142249 |
| 385 | Ga0495646_0000083 | 3300046680 | Bacteria | 45193 |
| 386 | Ga0495647_0020993 | 3300046681 | Bacteria | 2349 |
| 387 | Ga0495658_0006621 | 3300046683 | Bacteria | 5694 |
| 388 | Ga0495658_0082083 | 3300046683 | Bacteria | 1894 |
| 389 | Ga0495658_0094956 | 3300046683 | Bacteria | 1771 |
| 390 | Ga0495613_0081717 | 3300046689 | Bacteria | 2347 |
| 391 | Ga0495670_0076295 | 3300046691 | Bacteria | 1703 |
| 392 | Ga0495600_0000022 | 3300046809 | Bacteria | 94789 |
| 393 | Ga0495581_0026783 | 3300047315 | Bacteria | 3342 |
| 394 | Ga0495604_0000011 | 3300047317 | Bacteria | 292024 |
| 395 | Ga0495674_0000034 | 3300047319 | Bacteria | 110674 |
| 396 | Ga0495676_0092637 | 3300047321 | Bacteria | 2255 |
| 397 | Ga0495680_0000290 | 3300047322 | Bacteria | 56506 |
| 398 | Ga0495675_0000352 | 3300047444 | Bacteria | 32304 |
| 399 | Ga0495677_0031302 | 3300047445 | Bacteria | 1937 |
| 400 | Ga0495684_0000012 | 3300047471 | Bacteria | 187118 |
| 401 | Ga0495593_0005499 | 3300047673 | Bacteria | 7477 |
| 402 | Ga0495602_0000064 | 3300048088 | Bacteria | 104858 |
| 403 | Ga0495615_0022196 | 3300048090 | Bacteria | 1441 |
| 404 | Ga0496100_0007364 | 3300048903 | Bacteria | 6066 |
| 405 | Ga0496100_0078035 | 3300048903 | Bacteria | 2228 |
| 406 | Ga0496100_0108032 | 3300048903 | Bacteria | 1928 |
| 407 | Ga0496101_0002534 | 3300048904 | Bacteria | 11221 |
| 408 | Ga0496101_0009345 | 3300048904 | Bacteria | 6442 |
| 409 | Ga0496101_0022365 | 3300048904 | Bacteria | 4352 |
| 410 | Ga0496102_0031690 | 3300048905 | Bacteria | 4744 |
| 411 | Ga0496102_0044380 | 3300048905 | Unclassified | 4034 |
| 412 | Ga0496102_0047152 | 3300048905 | Bacteria | 3914 |
| 413 | Ga0496103_0002040 | 3300048906 | Bacteria | 12961 |
| 414 | Ga0496103_0030032 | 3300048906 | Bacteria | 3305 |
| 415 | Ga0496103_0096621 | 3300048906 | Bacteria | 1867 |
| 416 | Ga0496104_0001609 | 3300048907 | Bacteria | 19461 |
| 417 | Ga0496104_0002163 | 3300048907 | Bacteria | 17059 |
| 418 | Ga0496104_0011126 | 3300048907 | Bacteria | 8051 |
| 419 | Ga0496104_0289415 | 3300048907 | Bacteria | 1550 |
| 420 | Ga0496105_0000754 | 3300048908 | Bacteria | 21960 |
| 421 | Ga0496105_0006795 | 3300048908 | Bacteria | 8799 |
| 422 | Ga0496105_0017420 | 3300048908 | Bacteria | 5759 |
| 423 | Ga0496105_0063432 | 3300048908 | Bacteria | 3048 |
| 424 | Ga0496105_0065563 | 3300048908 | Bacteria | 2997 |
| 425 | Ga0496105_0119900 | 3300048908 | Bacteria | 2169 |
| 426 | Ga0496106_0001803 | 3300048909 | Bacteria | 16006 |
| 427 | Ga0496106_0003637 | 3300048909 | Bacteria | 11498 |
| 428 | Ga0496106_0039379 | 3300048909 | Bacteria | 3540 |
| 429 | Ga0496106_0045309 | 3300048909 | Bacteria | 3303 |
| 430 | Ga0496106_0301953 | 3300048909 | Bacteria | 1284 |
| 431 | Ga0496107_0000810 | 3300048910 | Bacteria | 18168 |
| 432 | Ga0496107_0060281 | 3300048910 | Bacteria | 2746 |
| 433 | Ga0496107_0157447 | 3300048910 | Bacteria | 1682 |
| 434 | Ga0496108_0005275 | 3300048911 | Bacteria | 10432 |
| 435 | Ga0496108_0005539 | 3300048911 | Bacteria | 10217 |
| 436 | Ga0496108_0010861 | 3300048911 | Bacteria | 7392 |
| 437 | Ga0496108_0018930 | 3300048911 | Bacteria | 5646 |
| 438 | Ga0496108_0215129 | 3300048911 | Bacteria | 1669 |
| 439 | Ga0496109_0001755 | 3300048912 | Bacteria | 18034 |
| 440 | Ga0496109_0003548 | 3300048912 | Bacteria | 13018 |
| 441 | Ga0496109_0008088 | 3300048912 | Bacteria | 8915 |
| 442 | Ga0496109_0043286 | 3300048912 | Bacteria | 4081 |
| 443 | Ga0496109_0120921 | 3300048912 | Bacteria | 2439 |
| 444 | Ga0496109_0158562 | 3300048912 | Bacteria | 2119 |
| 445 | Ga0496110_0000282 | 3300048913 | Bacteria | 33145 |
| 446 | Ga0496110_0001702 | 3300048913 | Bacteria | 16176 |
| 447 | Ga0496110_0003425 | 3300048913 | Bacteria | 12136 |
| 448 | Ga0496110_0016646 | 3300048913 | Bacteria | 6141 |
| 449 | Ga0496110_0062726 | 3300048913 | Bacteria | 3283 |
| 450 | Ga0496110_0121018 | 3300048913 | Bacteria | 2358 |
| 451 | Ga0496110_0401201 | 3300048913 | Bacteria | 1250 |
| 452 | Ga0496111_0001059 | 3300048914 | Bacteria | 15163 |
| 453 | Ga0496111_0003144 | 3300048914 | Bacteria | 10159 |
| 454 | Ga0496111_0018711 | 3300048914 | Bacteria | 4801 |
| 455 | Ga0496111_0028517 | 3300048914 | Bacteria | 3956 |
| 456 | Ga0496111_0164772 | 3300048914 | Bacteria | 1646 |
| 457 | Ga0496112_0009122 | 3300048915 | Bacteria | 8913 |
| 458 | Ga0496112_0022123 | 3300048915 | Bacteria | 6056 |
| 459 | Ga0496112_0030580 | 3300048915 | Bacteria | 5212 |
| 460 | Ga0496112_0106728 | 3300048915 | Bacteria | 2770 |
| 461 | Ga0496112_0188225 | 3300048915 | Bacteria | 2027 |
| 462 | Ga0496113_0000933 | 3300048916 | Bacteria | 15522 |
| 463 | Ga0496113_0002455 | 3300048916 | Bacteria | 10796 |
| 464 | Ga0496113_0005049 | 3300048916 | Bacteria | 8192 |
| 465 | Ga0496114_0002210 | 3300048917 | Bacteria | 14814 |
| 466 | Ga0496114_0004133 | 3300048917 | Bacteria | 11229 |
| 467 | Ga0496114_0027277 | 3300048917 | Bacteria | 4677 |
| 468 | Ga0496114_0143756 | 3300048917 | Bacteria | 2067 |
| 469 | Ga0496115_0007233 | 3300048918 | Bacteria | 8159 |
| 470 | Ga0496115_0012531 | 3300048918 | Bacteria | 6385 |
| 471 | Ga0496115_0101829 | 3300048918 | Bacteria | 2355 |
| 472 | Ga0496115_0129801 | 3300048918 | Bacteria | 2077 |
| 473 | Ga0496115_0129982 | 3300048918 | Bacteria | 2075 |
| 474 | Ga0496115_0138372 | 3300048918 | Bacteria | 2008 |
| 475 | Ga0496115_0168678 | 3300048918 | Bacteria | 1810 |
| 476 | Ga0496121_0016256 | 3300048924 | Bacteria | 7696 |
| 477 | Ga0501031_0005837 | 3300049568 | Bacteria | 8023 |
| 478 | Ga0501032_0119854 | 3300049569 | Bacteria | 1740 |
| 479 | Ga0501033_0084935 | 3300049570 | Bacteria | 2319 |
| 480 | Ga0501034_0050156 | 3300049571 | Bacteria | 4210 |
| 481 | Ga0501034_0060014 | 3300049571 | Bacteria | 3820 |
| 482 | Ga0501034_0207973 | 3300049571 | Bacteria | 1913 |
| 483 | Ga0501036_0008715 | 3300049572 | Bacteria | 8320 |
| 484 | Ga0501037_0010069 | 3300049573 | Bacteria | 6935 |
| 485 | Ga0501038_0010460 | 3300049574 | Bacteria | 8485 |
| 486 | Ga0501039_0041648 | 3300049575 | Bacteria | 3548 |
| 487 | Ga0501039_0149434 | 3300049575 | Bacteria | 1836 |
| 488 | Ga0501042_0024204 | 3300049578 | Bacteria | 4257 |
| 489 | Ga0501043_0046681 | 3300049579 | Bacteria | 3406 |
| 490 | Ga0501046_0004428 | 3300049580 | Bacteria | 12750 |
| 491 | Ga0501047_0082281 | 3300049581 | Bacteria | 3094 |
| 492 | Ga0501047_0197597 | 3300049581 | Bacteria | 1873 |
| 493 | Ga0501048_0008331 | 3300049582 | Bacteria | 7838 |
| 494 | Ga0501067_0051201 | 3300049583 | Bacteria | 2289 |
| 495 | Ga0501067_0071604 | 3300049583 | Bacteria | 1920 |
| 496 | Ga0501068_0010438 | 3300049584 | Bacteria | 5219 |
| 497 | Ga0501069_0021567 | 3300049585 | Bacteria | 3497 |
| 498 | Ga0501071_0051618 | 3300049587 | Bacteria | 2964 |
| 499 | Ga0501072_0016826 | 3300049588 | Bacteria | 5617 |
| 500 | Ga0501072_0276859 | 3300049588 | Bacteria | 1335 |
| 501 | Ga0501073_0002666 | 3300049589 | Bacteria | 13363 |
| 502 | Ga0501074_0001621 | 3300049590 | Bacteria | 15256 |
| 503 | Ga0501075_0140867 | 3300049591 | Bacteria | 1838 |
| 504 | Ga0501079_0156664 | 3300049741 | Bacteria | 1775 |
| 505 | Ga0501079_0166166 | 3300049741 | Bacteria | 1721 |
| 506 | Ga0501080_0066382 | 3300049742 | Bacteria | 3355 |
| 507 | Ga0501080_0085169 | 3300049742 | Bacteria | 2937 |
| 508 | Ga0501080_0106572 | 3300049742 | Bacteria | 2597 |
| 509 | Ga0501081_0097592 | 3300049743 | Bacteria | 2074 |
| 510 | Ga0501081_0221814 | 3300049743 | Bacteria | 1375 |
| 511 | Ga0501083_0000986 | 3300049744 | Bacteria | 18893 |
| 512 | Ga0501083_0063961 | 3300049744 | Bacteria | 2453 |
| 513 | Ga0501083_0114516 | 3300049744 | Bacteria | 1771 |
| 514 | Ga0501083_0130798 | 3300049744 | Bacteria | 1645 |
| 515 | Ga0501035_0052977 | 3300049822 | Bacteria | 3630 |
| 516 | Ga0501044_0001050 | 3300049823 | Bacteria | 33213 |
| 517 | Ga0501044_0017930 | 3300049823 | Bacteria | 7591 |
| 518 | Ga0501045_0055627 | 3300049824 | Bacteria | 2893 |
| 519 | Ga0501045_0102263 | 3300049824 | Bacteria | 2122 |
| 520 | nmdc:mga03683_42287_c1 | 3300050489 | Bacteria | 1874 |
| 521 | nmdc:mga03n38_45502_c1 | 3300050490 | Bacteria | 1933 |
| 522 | nmdc:mga03n38_63977_c1 | 3300050490 | Bacteria | 1682 |
| 523 | nmdc:mga00v17_51901_c1 | 3300050491 | Bacteria | 2494 |
| 524 | nmdc:mga0yw44_19625_c1 | 3300050492 | Bacteria | 3732 |
| 525 | nmdc:mga0yw44_40720_c1 | 3300050492 | Bacteria | 2762 |
| 526 | nmdc:mga0yw44_94440_c1 | 3300050492 | Bacteria | 1895 |
| 527 | nmdc:mga0k408_805_c2 | 3300050493 | Bacteria | 10222 |
| 528 | nmdc:mga06z11_18021_c1 | 3300050494 | Bacteria | 3218 |
| 529 | nmdc:mga06z11_31448_c1 | 3300050494 | Bacteria | 2579 |
| 530 | nmdc:mga06z11_58952_c1 | 3300050494 | Bacteria | 1994 |
| 531 | nmdc:mga06z11_72399_c1 | 3300050494 | Bacteria | 1827 |
| 532 | nmdc:mga05p37_109346_c1 | 3300050507 | Bacteria | 3401 |
| 533 | nmdc:mga05p37_30275_c1 | 3300050507 | Bacteria | 6603 |
| 534 | nmdc:mga05p37_55142_c1 | 3300050507 | Bacteria | 4890 |
| 535 | nmdc:mga05p37_66731_c1 | 3300050507 | Bacteria | 4425 |
| 536 | nmdc:mga09592_205928_c1 | 3300050508 | Bacteria | 1704 |
| 537 | nmdc:mga09592_96825_c1 | 3300050508 | Bacteria | 2525 |
| 538 | nmdc:mga0qj67_132081_c1 | 3300050509 | Bacteria | 2022 |
| 539 | nmdc:mga0qj67_144642_c1 | 3300050509 | Bacteria | 1928 |
| 540 | nmdc:mga0qj67_60_c1 | 3300050509 | Bacteria | 80228 |
| 541 | nmdc:mga06r32_268023_c1 | 3300050510 | Bacteria | 1695 |
| 542 | nmdc:mga08y16_126950_c1 | 3300050511 | Bacteria | 2653 |
| 543 | nmdc:mga08y16_353105_c1 | 3300050511 | Bacteria | 1510 |
| 544 | nmdc:mga08y16_61962_c1 | 3300050511 | Bacteria | 3906 |
| 545 | nmdc:mga0n895_3017_c1 | 3300050512 | Bacteria | 13379 |
| 546 | nmdc:mga08x19_227291_c1 | 3300050514 | Bacteria | 1284 |
| 547 | nmdc:mga0a205_200884_c1 | 3300050515 | Bacteria | 1884 |
| 548 | Ga0495601_0000015 | 3300053077 | Bacteria | 213851 |
| 549 | Ga0495601_0105928 | 3300053077 | Bacteria | 1818 |
| 550 | Ga0495601_0211169 | 3300053077 | Bacteria | 1268 |
| 551 | Ga0495612_0000096 | 3300053078 | Bacteria | 38017 |
| 552 | Ga0495655_0011263 | 3300053083 | Bacteria | 1792 |
| 553 | Ga0495595_0000035 | 3300053084 | Bacteria | 79822 |
| 554 | Ga0495595_0003933 | 3300053084 | Bacteria | 5936 |
| 555 | Ga0495619_0000044 | 3300053085 | Bacteria | 108581 |
| 556 | Ga0495619_0056090 | 3300053085 | Bacteria | 2611 |
| 557 | Ga0495619_0074257 | 3300053085 | Bacteria | 2280 |
| 558 | Ga0500641_0014824 | 3300053096 | Bacteria | 2881 |
| 559 | Ga0500654_089093 | 3300053099 | Bacteria | 1387 |
| 560 | Ga0500652_000488 | 3300053131 | Bacteria | 13946 |
| 561 | Ga0500658_0061944 | 3300053134 | Bacteria | 1558 |
| 562 | Ga0500568_0002398 | 3300053139 | Bacteria | 11069 |
| 563 | Ga0500568_0066122 | 3300053139 | Bacteria | 1391 |
| 564 | Ga0500616_0004796 | 3300053153 | Bacteria | 9470 |
| 565 | Ga0500616_0036278 | 3300053153 | Bacteria | 2676 |
| 566 | Ga0500616_0106686 | 3300053153 | Bacteria | 1360 |
| 567 | Ga0500636_0101606 | 3300053177 | Bacteria | 1634 |
| 568 | Ga0500645_028599 | 3300053730 | Bacteria | 1686 |
| 569 | Ga0501084_0030993 | 3300054114 | Bacteria | 4472 |
| 570 | Ga0501082_0000016 | 3300060353 | Bacteria | 115081 |
| 571 | Ga0501082_0030709 | 3300060353 | Bacteria | 4631 |
| 572 | Ga0501082_0194171 | 3300060353 | Bacteria | 1766 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0401201 | Ga0496110_0401201_180_1211 | 343 |
| 2 | 3300048090 | Ga0495615_0022196 | Ga0495615_0022196_388_1431 | 344 |
| 3 | 3300049588 | Ga0501072_0276859 | Ga0501072_0276859_73_1116 | 344 |
| 4 | 3300053139 | Ga0500568_0066122 | Ga0500568_0066122_11_1045 | 344 |
| 5 | 3300028556 | Ga0265337_1007649 | Ga0265337_10076492 | 350 |
| 6 | 3300028563 | Ga0265319_1003972 | Ga0265319_10039724 | 350 |
| 7 | 3300028573 | Ga0265334_10003484 | Ga0265334_100034843 | 350 |
| 8 | 3300028653 | Ga0265323_10002861 | Ga0265323_100028614 | 350 |
| 9 | 3300028666 | Ga0265336_10000389 | Ga0265336_1000038925 | 350 |
| 10 | 3300028800 | Ga0265338_10000176 | Ga0265338_1000017643 | 350 |
| 11 | 3300029957 | Ga0265324_10004317 | Ga0265324_100043173 | 350 |
| 12 | 3300021361 | Ga0213872_10001399 | Ga0213872_100013992 | 363 |
| 13 | 3300039447 | Ga0436361_0020532 | Ga0436361_0020532_35145_36335 | 363 |
| 14 | 3300039447 | Ga0436361_0497647 | Ga0436361_0497647_492_1631 | 363 |
| 15 | 3300049742 | Ga0501080_0085169 | Ga0501080_0085169_984_2123 | 363 |
| 16 | 3300050494 | nmdc:mga06z11_58952_c1 | nmdc:mga06z11_58952_c1_812_1981 | 363 |
| 17 | 3300005617 | Ga0068859_100086478 | Ga0068859_1000864782 | 364 |
| 18 | 3300005842 | Ga0068858_100131455 | Ga0068858_1001314552 | 364 |
| 19 | 3300006931 | Ga0097620_100086478 | Ga0097620_1000864782 | 364 |
| 20 | 3300010375 | Ga0105239_10040888 | Ga0105239_100408884 | 364 |
| 21 | 3300025261 | Ga0209233_1006297 | Ga0209233_10062974 | 364 |
| 22 | 3300025272 | Ga0209455_1001095 | Ga0209455_10010956 | 364 |
| 23 | 3300035695 | Ga0373927_0011117 | Ga0373927_0011117_3780_5000 | 364 |
| 24 | 3300048924 | Ga0496121_0016256 | Ga0496121_0016256_5442_6668 | 364 |
| 25 | 3300049575 | Ga0501039_0041648 | Ga0501039_0041648_11_1105 | 364 |
| 26 | iso_pu_bacteria | 2935847175 | 2935853546 | 364 |
| 27 | 3300005354 | Ga0070675_100211756 | Ga0070675_1002117562 | 365 |
| 28 | 3300005439 | Ga0070711_100145987 | Ga0070711_1001459871 | 365 |
| 29 | 3300006175 | Ga0070712_100000277 | Ga0070712_10000027727 | 365 |
| 30 | 3300025915 | Ga0207693_10001633 | Ga0207693_100016332 | 365 |
| 31 | 3300025916 | Ga0207663_10122842 | Ga0207663_101228422 | 365 |
| 32 | 3300025923 | Ga0207681_10178401 | Ga0207681_101784012 | 365 |
| 33 | 3300042461 | Ga0439460_0015132 | Ga0439460_0015132_556_1677 | 365 |
| 34 | 3300048917 | Ga0496114_0143756 | Ga0496114_0143756_881_2026 | 365 |
| 35 | 3300053085 | Ga0495619_0056090 | Ga0495619_0056090_960_2102 | 365 |
| 36 | 3300006178 | Ga0075367_10078787 | Ga0075367_100787872 | 366 |
| 37 | 3300050490 | nmdc:mga03n38_63977_c1 | nmdc:mga03n38_63977_c1_66_1223 | 366 |
| 38 | 3300050494 | nmdc:mga06z11_18021_c1 | nmdc:mga06z11_18021_c1_276_1472 | 366 |
| 39 | 3300053153 | Ga0500616_0004796 | Ga0500616_0004796_1245_2351 | 366 |
| 40 | 3300053153 | Ga0500616_0036278 | Ga0500616_0036278_241_1347 | 366 |
| 41 | 3300039447 | Ga0436361_0423477 | Ga0436361_0423477_217_1377 | 367 |
| 42 | 3300006038 | Ga0075365_10030693 | Ga0075365_100306931 | 368 |
| 43 | 3300006353 | Ga0075370_10057860 | Ga0075370_100578602 | 368 |
| 44 | 3300021361 | Ga0213872_10000559 | Ga0213872_1000055914 | 368 |
| 45 | 3300021361 | Ga0213872_10000896 | Ga0213872_1000089614 | 368 |
| 46 | 3300021361 | Ga0213872_10020207 | Ga0213872_100202073 | 368 |
| 47 | 3300039447 | Ga0436361_0450698 | Ga0436361_0450698_1280_2425 | 368 |
| 48 | 3300039447 | Ga0436361_0572145 | Ga0436361_0572145_1928_3055 | 368 |
| 49 | 3300039447 | Ga0436361_0797374 | Ga0436361_0797374_33_1178 | 368 |
| 50 | 3300039447 | Ga0436361_0892205 | Ga0436361_0892205_1251_2396 | 368 |
| 51 | 3300048904 | Ga0496101_0002534 | Ga0496101_0002534_7506_8660 | 368 |
| 52 | 3300048905 | Ga0496102_0044380 | Ga0496102_0044380_2616_3770 | 368 |
| 53 | 3300048908 | Ga0496105_0063432 | Ga0496105_0063432_1103_2257 | 368 |
| 54 | 3300048909 | Ga0496106_0001803 | Ga0496106_0001803_14216_15370 | 368 |
| 55 | 3300048909 | Ga0496106_0301953 | Ga0496106_0301953_17_1174 | 368 |
| 56 | 3300048911 | Ga0496108_0010861 | Ga0496108_0010861_5531_6688 | 368 |
| 57 | 3300048911 | Ga0496108_0018930 | Ga0496108_0018930_3704_4858 | 368 |
| 58 | 3300048912 | Ga0496109_0003548 | Ga0496109_0003548_5457_6614 | 368 |
| 59 | 3300048913 | Ga0496110_0000282 | Ga0496110_0000282_27195_28352 | 368 |
| 60 | 3300048913 | Ga0496110_0003425 | Ga0496110_0003425_1542_2702 | 368 |
| 61 | 3300048914 | Ga0496111_0003144 | Ga0496111_0003144_8309_9466 | 368 |
| 62 | 3300048915 | Ga0496112_0009122 | Ga0496112_0009122_5616_6773 | 368 |
| 63 | 3300048915 | Ga0496112_0022123 | Ga0496112_0022123_4191_5345 | 368 |
| 64 | 3300048916 | Ga0496113_0002455 | Ga0496113_0002455_4984_6141 | 368 |
| 65 | 3300048918 | Ga0496115_0129982 | Ga0496115_0129982_868_2022 | 368 |
| 66 | 3300049583 | Ga0501067_0071604 | Ga0501067_0071604_727_1866 | 368 |
| 67 | 3300050492 | nmdc:mga0yw44_40720_c1 | nmdc:mga0yw44_40720_c1_1442_2554 | 368 |
| 68 | 3300007788 | Ga0099795_10053585 | Ga0099795_100535851 | 369 |
| 69 | 3300010159 | Ga0099796_10007009 | Ga0099796_100070093 | 369 |
| 70 | 3300031235 | Ga0265330_10041807 | Ga0265330_100418071 | 369 |
| 71 | 3300031242 | Ga0265329_10030727 | Ga0265329_100307272 | 369 |
| 72 | 3300031249 | Ga0265339_10099024 | Ga0265339_100990241 | 369 |
| 73 | 3300031344 | Ga0265316_10195443 | Ga0265316_101954431 | 369 |
| 74 | 3300035691 | Ga0373931_0219802 | Ga0373931_0219802_22_1131 | 369 |
| 75 | 3300046683 | Ga0495658_0006621 | Ga0495658_0006621_2602_3822 | 369 |
| 76 | 3300001990 | JGI24737J22298_10030376 | JGI24737J22298_100303762 | 370 |
| 77 | 3300002070 | JGI24750J21931_1002148 | JGI24750J21931_10021482 | 370 |
| 78 | 3300002077 | JGI24744J21845_10000578 | JGI24744J21845_100005787 | 370 |
| 79 | 3300002077 | JGI24744J21845_10023387 | JGI24744J21845_100233871 | 370 |
| 80 | 3300002239 | JGI24034J26672_10003395 | JGI24034J26672_100033952 | 370 |
| 81 | 3300002244 | JGI24742J22300_10000829 | JGI24742J22300_100008293 | 370 |
| 82 | 3300003203 | JGI25406J46586_10022199 | JGI25406J46586_100221992 | 370 |
| 83 | 3300003215 | JGI25153J46596_10000660 | JGI25153J46596_1000066018 | 370 |
| 84 | 3300005328 | Ga0070676_10083523 | Ga0070676_100835232 | 370 |
| 85 | 3300005330 | Ga0070690_100046659 | Ga0070690_1000466593 | 370 |
| 86 | 3300005331 | Ga0070670_100074499 | Ga0070670_1000744992 | 370 |
| 87 | 3300005333 | Ga0070677_10022053 | Ga0070677_100220533 | 370 |
| 88 | 3300005333 | Ga0070677_10024627 | Ga0070677_100246272 | 370 |
| 89 | 3300005335 | Ga0070666_10020181 | Ga0070666_100201814 | 370 |
| 90 | 3300005336 | Ga0070680_100008893 | Ga0070680_1000088935 | 370 |
| 91 | 3300005338 | Ga0068868_100004344 | Ga0068868_1000043444 | 370 |
| 92 | 3300005338 | Ga0068868_100007586 | Ga0068868_1000075863 | 370 |
| 93 | 3300005339 | Ga0070660_100014295 | Ga0070660_1000142955 | 370 |
| 94 | 3300005340 | Ga0070689_100013414 | Ga0070689_1000134142 | 370 |
| 95 | 3300005340 | Ga0070689_100025225 | Ga0070689_1000252252 | 370 |
| 96 | 3300005343 | Ga0070687_100007221 | Ga0070687_1000072212 | 370 |
| 97 | 3300005343 | Ga0070687_100014015 | Ga0070687_1000140153 | 370 |
| 98 | 3300005343 | Ga0070687_100039569 | Ga0070687_1000395693 | 370 |
| 99 | 3300005347 | Ga0070668_100037206 | Ga0070668_1000372063 | 370 |
| 100 | 3300005353 | Ga0070669_100020211 | Ga0070669_1000202112 | 370 |
| 101 | 3300005354 | Ga0070675_100003175 | Ga0070675_1000031755 | 370 |
| 102 | 3300005354 | Ga0070675_100032579 | Ga0070675_1000325794 | 370 |
| 103 | 3300005354 | Ga0070675_100141672 | Ga0070675_1001416721 | 370 |
| 104 | 3300005356 | Ga0070674_100001401 | Ga0070674_10000140110 | 370 |
| 105 | 3300005364 | Ga0070673_100006028 | Ga0070673_1000060286 | 370 |
| 106 | 3300005364 | Ga0070673_100124261 | Ga0070673_1001242612 | 370 |
| 107 | 3300005365 | Ga0070688_100012050 | Ga0070688_1000120503 | 370 |
| 108 | 3300005365 | Ga0070688_100038258 | Ga0070688_1000382583 | 370 |
| 109 | 3300005366 | Ga0070659_100007701 | Ga0070659_1000077016 | 370 |
| 110 | 3300005367 | Ga0070667_100025917 | Ga0070667_1000259173 | 370 |
| 111 | 3300005406 | Ga0070703_10015721 | Ga0070703_100157212 | 370 |
| 112 | 3300005435 | Ga0070714_100199678 | Ga0070714_1001996781 | 370 |
| 113 | 3300005435 | Ga0070714_100272261 | Ga0070714_1002722611 | 370 |
| 114 | 3300005436 | Ga0070713_100077695 | Ga0070713_1000776952 | 370 |
| 115 | 3300005436 | Ga0070713_100081966 | Ga0070713_1000819663 | 370 |
| 116 | 3300005436 | Ga0070713_100122292 | Ga0070713_1001222921 | 370 |
| 117 | 3300005437 | Ga0070710_10011557 | Ga0070710_100115572 | 370 |
| 118 | 3300005438 | Ga0070701_10151563 | Ga0070701_101515631 | 370 |
| 119 | 3300005439 | Ga0070711_100105348 | Ga0070711_1001053482 | 370 |
| 120 | 3300005439 | Ga0070711_100226830 | Ga0070711_1002268301 | 370 |
| 121 | 3300005441 | Ga0070700_100012600 | Ga0070700_1000126004 | 370 |
| 122 | 3300005455 | Ga0070663_100005197 | Ga0070663_1000051976 | 370 |
| 123 | 3300005456 | Ga0070678_100151313 | Ga0070678_1001513132 | 370 |
| 124 | 3300005457 | Ga0070662_100006574 | Ga0070662_1000065746 | 370 |
| 125 | 3300005458 | Ga0070681_10309341 | Ga0070681_103093412 | 370 |
| 126 | 3300005459 | Ga0068867_100212687 | Ga0068867_1002126871 | 370 |
| 127 | 3300005466 | Ga0070685_10030514 | Ga0070685_100305142 | 370 |
| 128 | 3300005468 | Ga0070707_100218183 | Ga0070707_1002181831 | 370 |
| 129 | 3300005518 | Ga0070699_100003706 | Ga0070699_1000037063 | 370 |
| 130 | 3300005530 | Ga0070679_100060447 | Ga0070679_1000604473 | 370 |
| 131 | 3300005535 | Ga0070684_100059514 | Ga0070684_1000595143 | 370 |
| 132 | 3300005539 | Ga0068853_100055305 | Ga0068853_1000553052 | 370 |
| 133 | 3300005543 | Ga0070672_100000898 | Ga0070672_1000008989 | 370 |
| 134 | 3300005543 | Ga0070672_100269402 | Ga0070672_1002694021 | 370 |
| 135 | 3300005544 | Ga0070686_100055026 | Ga0070686_1000550262 | 370 |
| 136 | 3300005545 | Ga0070695_100084693 | Ga0070695_1000846931 | 370 |
| 137 | 3300005548 | Ga0070665_100009985 | Ga0070665_1000099853 | 370 |
| 138 | 3300005549 | Ga0070704_100043161 | Ga0070704_1000431613 | 370 |
| 139 | 3300005549 | Ga0070704_100067986 | Ga0070704_1000679861 | 370 |
| 140 | 3300005577 | Ga0068857_100308745 | Ga0068857_1003087451 | 370 |
| 141 | 3300005578 | Ga0068854_100018289 | Ga0068854_1000182892 | 370 |
| 142 | 3300005614 | Ga0068856_100026810 | Ga0068856_1000268102 | 370 |
| 143 | 3300005615 | Ga0070702_100003350 | Ga0070702_1000033504 | 370 |
| 144 | 3300005616 | Ga0068852_100004585 | Ga0068852_1000045854 | 370 |
| 145 | 3300005617 | Ga0068859_100040777 | Ga0068859_1000407774 | 370 |
| 146 | 3300005617 | Ga0068859_100200924 | Ga0068859_1002009242 | 370 |
| 147 | 3300005618 | Ga0068864_100007736 | Ga0068864_1000077365 | 370 |
| 148 | 3300005618 | Ga0068864_100154167 | Ga0068864_1001541672 | 370 |
| 149 | 3300005718 | Ga0068866_10002579 | Ga0068866_100025794 | 370 |
| 150 | 3300005718 | Ga0068866_10120109 | Ga0068866_101201092 | 370 |
| 151 | 3300005719 | Ga0068861_100002506 | Ga0068861_1000025067 | 370 |
| 152 | 3300005834 | Ga0068851_10014563 | Ga0068851_100145633 | 370 |
| 153 | 3300005840 | Ga0068870_10001759 | Ga0068870_100017595 | 370 |
| 154 | 3300005841 | Ga0068863_100006002 | Ga0068863_1000060026 | 370 |
| 155 | 3300005841 | Ga0068863_100224650 | Ga0068863_1002246502 | 370 |
| 156 | 3300005842 | Ga0068858_100004133 | Ga0068858_10000413310 | 370 |
| 157 | 3300005842 | Ga0068858_100156834 | Ga0068858_1001568342 | 370 |
| 158 | 3300005843 | Ga0068860_100003806 | Ga0068860_1000038066 | 370 |
| 159 | 3300005844 | Ga0068862_100006027 | Ga0068862_1000060272 | 370 |
| 160 | 3300005937 | Ga0081455_10001263 | Ga0081455_1000126319 | 370 |
| 161 | 3300005937 | Ga0081455_10011029 | Ga0081455_100110295 | 370 |
| 162 | 3300005937 | Ga0081455_10066743 | Ga0081455_100667432 | 370 |
| 163 | 3300005981 | Ga0081538_10023004 | Ga0081538_100230044 | 370 |
| 164 | 3300005981 | Ga0081538_10031421 | Ga0081538_100314212 | 370 |
| 165 | 3300005981 | Ga0081538_10064119 | Ga0081538_100641192 | 370 |
| 166 | 3300005983 | Ga0081540_1000128 | Ga0081540_100012842 | 370 |
| 167 | 3300005983 | Ga0081540_1001551 | Ga0081540_100155116 | 370 |
| 168 | 3300005983 | Ga0081540_1015315 | Ga0081540_10153153 | 370 |
| 169 | 3300005985 | Ga0081539_10005924 | Ga0081539_100059248 | 370 |
| 170 | 3300006028 | Ga0070717_10166242 | Ga0070717_101662422 | 370 |
| 171 | 3300006038 | Ga0075365_10045180 | Ga0075365_100451803 | 370 |
| 172 | 3300006048 | Ga0075363_100003705 | Ga0075363_1000037057 | 370 |
| 173 | 3300006051 | Ga0075364_10003468 | Ga0075364_100034684 | 370 |
| 174 | 3300006051 | Ga0075364_10082766 | Ga0075364_100827662 | 370 |
| 175 | 3300006163 | Ga0070715_10017966 | Ga0070715_100179662 | 370 |
| 176 | 3300006175 | Ga0070712_100033236 | Ga0070712_1000332362 | 370 |
| 177 | 3300006177 | Ga0075362_10003019 | Ga0075362_100030194 | 370 |
| 178 | 3300006178 | Ga0075367_10051084 | Ga0075367_100510843 | 370 |
| 179 | 3300006186 | Ga0075369_10021975 | Ga0075369_100219752 | 370 |
| 180 | 3300006186 | Ga0075369_10063447 | Ga0075369_100634472 | 370 |
| 181 | 3300006195 | Ga0075366_10004591 | Ga0075366_100045916 | 370 |
| 182 | 3300006195 | Ga0075366_10114544 | Ga0075366_101145442 | 370 |
| 183 | 3300006353 | Ga0075370_10099695 | Ga0075370_100996951 | 370 |
| 184 | 3300006358 | Ga0068871_100122539 | Ga0068871_1001225392 | 370 |
| 185 | 3300006844 | Ga0075428_100023040 | Ga0075428_1000230404 | 370 |
| 186 | 3300006844 | Ga0075428_100182810 | Ga0075428_1001828103 | 370 |
| 187 | 3300006844 | Ga0075428_100220814 | Ga0075428_1002208143 | 370 |
| 188 | 3300006844 | Ga0075428_100378490 | Ga0075428_1003784902 | 370 |
| 189 | 3300006846 | Ga0075430_100000067 | Ga0075430_10000006746 | 370 |
| 190 | 3300006846 | Ga0075430_100008377 | Ga0075430_1000083771 | 370 |
| 191 | 3300006846 | Ga0075430_100142128 | Ga0075430_1001421281 | 370 |
| 192 | 3300006847 | Ga0075431_100037781 | Ga0075431_1000377812 | 370 |
| 193 | 3300006847 | Ga0075431_100077637 | Ga0075431_1000776373 | 370 |
| 194 | 3300006847 | Ga0075431_100154771 | Ga0075431_1001547711 | 370 |
| 195 | 3300006847 | Ga0075431_100260294 | Ga0075431_1002602942 | 370 |
| 196 | 3300006852 | Ga0075433_10283037 | Ga0075433_102830372 | 370 |
| 197 | 3300006871 | Ga0075434_100055145 | Ga0075434_1000551453 | 370 |
| 198 | 3300006871 | Ga0075434_100178134 | Ga0075434_1001781342 | 370 |
| 199 | 3300006871 | Ga0075434_100419840 | Ga0075434_1004198402 | 370 |
| 200 | 3300006880 | Ga0075429_100008809 | Ga0075429_1000088093 | 370 |
| 201 | 3300006880 | Ga0075429_100355379 | Ga0075429_1003553791 | 370 |
| 202 | 3300006881 | Ga0068865_100009041 | Ga0068865_1000090414 | 370 |
| 203 | 3300006914 | Ga0075436_100020342 | Ga0075436_1000203424 | 370 |
| 204 | 3300006914 | Ga0075436_100180185 | Ga0075436_1001801852 | 370 |
| 205 | 3300006931 | Ga0097620_100040774 | Ga0097620_1000407744 | 370 |
| 206 | 3300006931 | Ga0097620_100200932 | Ga0097620_1002009322 | 370 |
| 207 | 3300007076 | Ga0075435_100047464 | Ga0075435_1000474644 | 370 |
| 208 | 3300007076 | Ga0075435_100089017 | Ga0075435_1000890172 | 370 |
| 209 | 3300007265 | Ga0099794_10015586 | Ga0099794_100155861 | 370 |
| 210 | 3300009094 | Ga0111539_10008081 | Ga0111539_1000808111 | 370 |
| 211 | 3300009094 | Ga0111539_10100625 | Ga0111539_101006254 | 370 |
| 212 | 3300009094 | Ga0111539_10403851 | Ga0111539_104038512 | 370 |
| 213 | 3300009098 | Ga0105245_10005857 | Ga0105245_100058572 | 370 |
| 214 | 3300009098 | Ga0105245_10119478 | Ga0105245_101194781 | 370 |
| 215 | 3300009098 | Ga0105245_10143174 | Ga0105245_101431742 | 370 |
| 216 | 3300009101 | Ga0105247_10009817 | Ga0105247_100098174 | 370 |
| 217 | 3300009101 | Ga0105247_10035426 | Ga0105247_100354262 | 370 |
| 218 | 3300009147 | Ga0114129_10020121 | Ga0114129_100201215 | 370 |
| 219 | 3300009147 | Ga0114129_10041806 | Ga0114129_100418062 | 370 |
| 220 | 3300009147 | Ga0114129_10114799 | Ga0114129_101147992 | 370 |
| 221 | 3300009147 | Ga0114129_10123887 | Ga0114129_101238872 | 370 |
| 222 | 3300009147 | Ga0114129_10182444 | Ga0114129_101824441 | 370 |
| 223 | 3300009147 | Ga0114129_10319796 | Ga0114129_103197963 | 370 |
| 224 | 3300009174 | Ga0105241_10301551 | Ga0105241_103015511 | 370 |
| 225 | 3300009176 | Ga0105242_10019227 | Ga0105242_100192274 | 370 |
| 226 | 3300009177 | Ga0105248_10012271 | Ga0105248_100122719 | 370 |
| 227 | 3300009177 | Ga0105248_10111763 | Ga0105248_101117633 | 370 |
| 228 | 3300009545 | Ga0105237_10422771 | Ga0105237_104227711 | 370 |
| 229 | 3300009551 | Ga0105238_10066854 | Ga0105238_100668544 | 370 |
| 230 | 3300009551 | Ga0105238_10091916 | Ga0105238_100919162 | 370 |
| 231 | 3300010375 | Ga0105239_10007446 | Ga0105239_100074462 | 370 |
| 232 | 3300010375 | Ga0105239_10157686 | Ga0105239_101576862 | 370 |
| 233 | 3300011119 | Ga0105246_10060010 | Ga0105246_100600102 | 370 |
| 234 | 3300011119 | Ga0105246_10075208 | Ga0105246_100752082 | 370 |
| 235 | 3300011119 | Ga0105246_10194209 | Ga0105246_101942091 | 370 |
| 236 | 3300013296 | Ga0157374_10017453 | Ga0157374_100174535 | 370 |
| 237 | 3300013296 | Ga0157374_10177838 | Ga0157374_101778382 | 370 |
| 238 | 3300013297 | Ga0157378_10013150 | Ga0157378_100131504 | 370 |
| 239 | 3300013297 | Ga0157378_10164417 | Ga0157378_101644172 | 370 |
| 240 | 3300013306 | Ga0163162_10006545 | Ga0163162_100065452 | 370 |
| 241 | 3300013307 | Ga0157372_10378462 | Ga0157372_103784622 | 370 |
| 242 | 3300013308 | Ga0157375_10006121 | Ga0157375_100061218 | 370 |
| 243 | 3300014325 | Ga0163163_10016469 | Ga0163163_100164694 | 370 |
| 244 | 3300014325 | Ga0163163_10036482 | Ga0163163_100364822 | 370 |
| 245 | 3300014326 | Ga0157380_10003267 | Ga0157380_100032678 | 370 |
| 246 | 3300014326 | Ga0157380_10447022 | Ga0157380_104470221 | 370 |
| 247 | 3300014745 | Ga0157377_10016261 | Ga0157377_100162613 | 370 |
| 248 | 3300014968 | Ga0157379_10005247 | Ga0157379_100052472 | 370 |
| 249 | 3300014969 | Ga0157376_10199081 | Ga0157376_101990811 | 370 |
| 250 | 3300017792 | Ga0163161_10003329 | Ga0163161_1000332910 | 370 |
| 251 | 3300021361 | Ga0213872_10005016 | Ga0213872_100050162 | 370 |
| 252 | 3300025297 | Ga0209758_1000772 | Ga0209758_100077225 | 370 |
| 253 | 3300025315 | Ga0207697_10024543 | Ga0207697_100245432 | 370 |
| 254 | 3300025885 | Ga0207653_10036532 | Ga0207653_100365321 | 370 |
| 255 | 3300025893 | Ga0207682_10002142 | Ga0207682_100021422 | 370 |
| 256 | 3300025893 | Ga0207682_10024955 | Ga0207682_100249553 | 370 |
| 257 | 3300025899 | Ga0207642_10001398 | Ga0207642_100013984 | 370 |
| 258 | 3300025900 | Ga0207710_10010515 | Ga0207710_100105154 | 370 |
| 259 | 3300025901 | Ga0207688_10002031 | Ga0207688_100020317 | 370 |
| 260 | 3300025903 | Ga0207680_10037799 | Ga0207680_100377992 | 370 |
| 261 | 3300025905 | Ga0207685_10011888 | Ga0207685_100118883 | 370 |
| 262 | 3300025906 | Ga0207699_10032085 | Ga0207699_100320852 | 370 |
| 263 | 3300025907 | Ga0207645_10007050 | Ga0207645_100070507 | 370 |
| 264 | 3300025908 | Ga0207643_10001570 | Ga0207643_100015709 | 370 |
| 265 | 3300025908 | Ga0207643_10010100 | Ga0207643_100101004 | 370 |
| 266 | 3300025911 | Ga0207654_10070492 | Ga0207654_100704922 | 370 |
| 267 | 3300025912 | Ga0207707_10128085 | Ga0207707_101280853 | 370 |
| 268 | 3300025915 | Ga0207693_10026048 | Ga0207693_100260482 | 370 |
| 269 | 3300025915 | Ga0207693_10090145 | Ga0207693_100901451 | 370 |
| 270 | 3300025915 | Ga0207693_10199852 | Ga0207693_101998522 | 370 |
| 271 | 3300025916 | Ga0207663_10086482 | Ga0207663_100864822 | 370 |
| 272 | 3300025917 | Ga0207660_10136740 | Ga0207660_101367401 | 370 |
| 273 | 3300025918 | Ga0207662_10009133 | Ga0207662_100091332 | 370 |
| 274 | 3300025918 | Ga0207662_10022123 | Ga0207662_100221231 | 370 |
| 275 | 3300025918 | Ga0207662_10062016 | Ga0207662_100620162 | 370 |
| 276 | 3300025918 | Ga0207662_10063893 | Ga0207662_100638932 | 370 |
| 277 | 3300025919 | Ga0207657_10090268 | Ga0207657_100902683 | 370 |
| 278 | 3300025919 | Ga0207657_10098290 | Ga0207657_100982902 | 370 |
| 279 | 3300025921 | Ga0207652_10014131 | Ga0207652_100141316 | 370 |
| 280 | 3300025924 | Ga0207694_10141759 | Ga0207694_101417592 | 370 |
| 281 | 3300025924 | Ga0207694_10207466 | Ga0207694_102074661 | 370 |
| 282 | 3300025925 | Ga0207650_10001375 | Ga0207650_1000137513 | 370 |
| 283 | 3300025926 | Ga0207659_10008042 | Ga0207659_100080422 | 370 |
| 284 | 3300025926 | Ga0207659_10050918 | Ga0207659_100509183 | 370 |
| 285 | 3300025927 | Ga0207687_10014594 | Ga0207687_100145943 | 370 |
| 286 | 3300025927 | Ga0207687_10076609 | Ga0207687_100766093 | 370 |
| 287 | 3300025928 | Ga0207700_10114479 | Ga0207700_101144792 | 370 |
| 288 | 3300025928 | Ga0207700_10116611 | Ga0207700_101166112 | 370 |
| 289 | 3300025928 | Ga0207700_10290624 | Ga0207700_102906241 | 370 |
| 290 | 3300025929 | Ga0207664_10119826 | Ga0207664_101198262 | 370 |
| 291 | 3300025931 | Ga0207644_10004097 | Ga0207644_100040972 | 370 |
| 292 | 3300025931 | Ga0207644_10193618 | Ga0207644_101936182 | 370 |
| 293 | 3300025933 | Ga0207706_10001850 | Ga0207706_1000185016 | 370 |
| 294 | 3300025933 | Ga0207706_10020785 | Ga0207706_100207854 | 370 |
| 295 | 3300025936 | Ga0207670_10002865 | Ga0207670_100028654 | 370 |
| 296 | 3300025936 | Ga0207670_10041087 | Ga0207670_100410873 | 370 |
| 297 | 3300025937 | Ga0207669_10003999 | Ga0207669_100039995 | 370 |
| 298 | 3300025937 | Ga0207669_10016637 | Ga0207669_100166374 | 370 |
| 299 | 3300025938 | Ga0207704_10056295 | Ga0207704_100562952 | 370 |
| 300 | 3300025939 | Ga0207665_10193350 | Ga0207665_101933501 | 370 |
| 301 | 3300025940 | Ga0207691_10001076 | Ga0207691_1000107616 | 370 |
| 302 | 3300025940 | Ga0207691_10002814 | Ga0207691_100028149 | 370 |
| 303 | 3300025940 | Ga0207691_10260354 | Ga0207691_102603542 | 370 |
| 304 | 3300025941 | Ga0207711_10003227 | Ga0207711_1000322710 | 370 |
| 305 | 3300025941 | Ga0207711_10014418 | Ga0207711_100144183 | 370 |
| 306 | 3300025942 | Ga0207689_10008025 | Ga0207689_100080253 | 370 |
| 307 | 3300025942 | Ga0207689_10038993 | Ga0207689_100389932 | 370 |
| 308 | 3300025944 | Ga0207661_10062370 | Ga0207661_100623703 | 370 |
| 309 | 3300025945 | Ga0207679_10017058 | Ga0207679_100170581 | 370 |
| 310 | 3300025960 | Ga0207651_10062039 | Ga0207651_100620391 | 370 |
| 311 | 3300025961 | Ga0207712_10126545 | Ga0207712_101265452 | 370 |
| 312 | 3300025972 | Ga0207668_10017784 | Ga0207668_100177843 | 370 |
| 313 | 3300025986 | Ga0207658_10196557 | Ga0207658_101965572 | 370 |
| 314 | 3300026023 | Ga0207677_10005514 | Ga0207677_100055143 | 370 |
| 315 | 3300026023 | Ga0207677_10016802 | Ga0207677_100168023 | 370 |
| 316 | 3300026041 | Ga0207639_10062323 | Ga0207639_100623232 | 370 |
| 317 | 3300026067 | Ga0207678_10005280 | Ga0207678_100052808 | 370 |
| 318 | 3300026075 | Ga0207708_10004126 | Ga0207708_100041268 | 370 |
| 319 | 3300026075 | Ga0207708_10241774 | Ga0207708_102417741 | 370 |
| 320 | 3300026078 | Ga0207702_10023972 | Ga0207702_100239724 | 370 |
| 321 | 3300026088 | Ga0207641_10005434 | Ga0207641_100054347 | 370 |
| 322 | 3300026088 | Ga0207641_10299956 | Ga0207641_102999562 | 370 |
| 323 | 3300026089 | Ga0207648_10015137 | Ga0207648_100151373 | 370 |
| 324 | 3300026089 | Ga0207648_10086844 | Ga0207648_100868443 | 370 |
| 325 | 3300026095 | Ga0207676_10002920 | Ga0207676_1000292010 | 370 |
| 326 | 3300026095 | Ga0207676_10176644 | Ga0207676_101766442 | 370 |
| 327 | 3300026095 | Ga0207676_10475390 | Ga0207676_104753901 | 370 |
| 328 | 3300026118 | Ga0207675_100000944 | Ga0207675_10000094412 | 370 |
| 329 | 3300027512 | Ga0209179_1004468 | Ga0209179_10044682 | 370 |
| 330 | 3300027671 | Ga0209588_1032280 | Ga0209588_10322802 | 370 |
| 331 | 3300028379 | Ga0268266_10012800 | Ga0268266_100128002 | 370 |
| 332 | 3300028380 | Ga0268265_10027494 | Ga0268265_100274943 | 370 |
| 333 | 3300028381 | Ga0268264_10011715 | Ga0268264_100117154 | 370 |
| 334 | 3300031238 | Ga0265332_10022996 | Ga0265332_100229962 | 370 |
| 335 | 3300031240 | Ga0265320_10008917 | Ga0265320_100089177 | 370 |
| 336 | 3300031241 | Ga0265325_10000305 | Ga0265325_1000030513 | 370 |
| 337 | 3300031242 | Ga0265329_10015683 | Ga0265329_100156831 | 370 |
| 338 | 3300031247 | Ga0265340_10010579 | Ga0265340_100105795 | 370 |
| 339 | 3300031247 | Ga0265340_10015095 | Ga0265340_100150953 | 370 |
| 340 | 3300031247 | Ga0265340_10041595 | Ga0265340_100415952 | 370 |
| 341 | 3300031249 | Ga0265339_10056400 | Ga0265339_100564001 | 370 |
| 342 | 3300031250 | Ga0265331_10069353 | Ga0265331_100693532 | 370 |
| 343 | 3300031344 | Ga0265316_10048387 | Ga0265316_100483873 | 370 |
| 344 | 3300031595 | Ga0265313_10025765 | Ga0265313_100257651 | 370 |
| 345 | 3300031711 | Ga0265314_10028660 | Ga0265314_100286602 | 370 |
| 346 | 3300031712 | Ga0265342_10000109 | Ga0265342_1000010962 | 370 |
| 347 | 3300031712 | Ga0265342_10043953 | Ga0265342_100439532 | 370 |
| 348 | 3300031712 | Ga0265342_10048477 | Ga0265342_100484772 | 370 |
| 349 | 3300035089 | Ga0373944_0031816 | Ga0373944_0031816_149_1261 | 370 |
| 350 | 3300035111 | Ga0373923_0002028 | Ga0373923_0002028_1955_3073 | 370 |
| 351 | 3300035112 | Ga0373932_0043865 | Ga0373932_0043865_145_1257 | 370 |
| 352 | 3300035113 | Ga0373936_0001332 | Ga0373936_0001332_2458_3576 | 370 |
| 353 | 3300035114 | Ga0373939_0010545 | Ga0373939_0010545_703_1815 | 370 |
| 354 | 3300035115 | Ga0373941_0017529 | Ga0373941_0017529_617_1729 | 370 |
| 355 | 3300035117 | Ga0373953_0068991 | Ga0373953_0068991_34_1146 | 370 |
| 356 | 3300035118 | Ga0373954_0009547 | Ga0373954_0009547_1251_2369 | 370 |
| 357 | 3300035170 | Ga0373943_0001174 | Ga0373943_0001174_9473_10591 | 370 |
| 358 | 3300035171 | Ga0373946_0013528 | Ga0373946_0013528_1496_2614 | 370 |
| 359 | 3300035172 | Ga0373955_0000069 | Ga0373955_0000069_34570_35688 | 370 |
| 360 | 3300035241 | Ga0373961_0013304 | Ga0373961_0013304_202_1320 | 370 |
| 361 | 3300035410 | Ga0373924_0000869 | Ga0373924_0000869_685_1803 | 370 |
| 362 | 3300035691 | Ga0373931_0000835 | Ga0373931_0000835_8483_9595 | 370 |
| 363 | 3300035691 | Ga0373931_0007500 | Ga0373931_0007500_470_1582 | 370 |
| 364 | 3300035692 | Ga0373935_0000938 | Ga0373935_0000938_4082_5200 | 370 |
| 365 | 3300035695 | Ga0373927_0001966 | Ga0373927_0001966_7298_8416 | 370 |
| 366 | 3300035695 | Ga0373927_0045006 | Ga0373927_0045006_377_1534 | 370 |
| 367 | 3300035724 | Ga0373933_0001354 | Ga0373933_0001354_12705_13823 | 370 |
| 368 | 3300035724 | Ga0373933_0092929 | Ga0373933_0092929_661_1773 | 370 |
| 369 | 3300035725 | Ga0373947_0001670 | Ga0373947_0001670_7843_8961 | 370 |
| 370 | 3300035725 | Ga0373947_0077794 | Ga0373947_0077794_448_1560 | 370 |
| 371 | 3300036401 | Ga0373937_0000356 | Ga0373937_0000356_17384_18502 | 370 |
| 372 | 3300036401 | Ga0373937_0052822 | Ga0373937_0052822_274_1386 | 370 |
| 373 | 3300037068 | Ga0373925_0000462 | Ga0373925_0000462_18304_19422 | 370 |
| 374 | 3300037068 | Ga0373925_0248657 | Ga0373925_0248657_146_1258 | 370 |
| 375 | 3300037418 | Ga0395900_0260560 | Ga0395900_0260560_234_1346 | 370 |
| 376 | 3300038443 | Ga0395901_0112636 | Ga0395901_0112636_438_1550 | 370 |
| 377 | 3300039437 | Ga0436365_0015250 | Ga0436365_0015250_340_1548 | 370 |
| 378 | 3300039437 | Ga0436365_0394916 | Ga0436365_0394916_1435_2598 | 370 |
| 379 | 3300039447 | Ga0436361_0129646 | Ga0436361_0129646_1834_2991 | 370 |
| 380 | 3300039447 | Ga0436361_0142459 | Ga0436361_0142459_5359_6501 | 370 |
| 381 | 3300044719 | Ga0466971_0067674 | Ga0466971_0067674_322_1533 | 370 |
| 382 | 3300045049 | Ga0466959_0143938 | Ga0466959_0143938_91_1206 | 370 |
| 383 | 3300045836 | Ga0466958_0000314 | Ga0466958_0000314_13323_14534 | 370 |
| 384 | 3300046454 | Ga0495592_0000090 | Ga0495592_0000090_21496_22614 | 370 |
| 385 | 3300046455 | Ga0495603_0062537 | Ga0495603_0062537_532_1644 | 370 |
| 386 | 3300046459 | Ga0495629_0071834 | Ga0495629_0071834_757_1914 | 370 |
| 387 | 3300046459 | Ga0495629_0104385 | Ga0495629_0104385_35_1147 | 370 |
| 388 | 3300046461 | Ga0495641_0036499 | Ga0495641_0036499_298_1410 | 370 |
| 389 | 3300046462 | Ga0495651_0000682 | Ga0495651_0000682_21508_22626 | 370 |
| 390 | 3300046463 | Ga0495653_0000322 | Ga0495653_0000322_16333_17451 | 370 |
| 391 | 3300046473 | Ga0495582_0042181 | Ga0495582_0042181_1107_2264 | 370 |
| 392 | 3300046474 | Ga0495605_0055995 | Ga0495605_0055995_418_1539 | 370 |
| 393 | 3300046476 | Ga0495662_0001023 | Ga0495662_0001023_5862_6980 | 370 |
| 394 | 3300046477 | Ga0495664_0000078 | Ga0495664_0000078_22472_23590 | 370 |
| 395 | 3300046491 | Ga0495584_0092106 | Ga0495584_0092106_43_1200 | 370 |
| 396 | 3300046499 | Ga0495594_0021004 | Ga0495594_0021004_674_1786 | 370 |
| 397 | 3300046511 | Ga0495608_0000022 | Ga0495608_0000022_140206_141324 | 370 |
| 398 | 3300046514 | Ga0495618_0000229 | Ga0495618_0000229_18324_19442 | 370 |
| 399 | 3300046516 | Ga0495628_0000035 | Ga0495628_0000035_88030_89148 | 370 |
| 400 | 3300046517 | Ga0495630_0000377 | Ga0495630_0000377_13078_14196 | 370 |
| 401 | 3300046517 | Ga0495630_0092713 | Ga0495630_0092713_547_1704 | 370 |
| 402 | 3300046529 | Ga0495652_0000062 | Ga0495652_0000062_88042_89160 | 370 |
| 403 | 3300046531 | Ga0495665_0036019 | Ga0495665_0036019_422_1534 | 370 |
| 404 | 3300046533 | Ga0495640_0000021 | Ga0495640_0000021_23788_24906 | 370 |
| 405 | 3300046533 | Ga0495640_0094009 | Ga0495640_0094009_360_1517 | 370 |
| 406 | 3300046536 | Ga0495587_0000006 | Ga0495587_0000006_88042_89160 | 370 |
| 407 | 3300046538 | Ga0495609_0029391 | Ga0495609_0029391_1297_2409 | 370 |
| 408 | 3300046543 | Ga0495645_0000174 | Ga0495645_0000174_22195_23313 | 370 |
| 409 | 3300046559 | Ga0495667_0000161 | Ga0495667_0000161_22251_23369 | 370 |
| 410 | 3300046615 | Ga0495656_0001474 | Ga0495656_0001474_4710_5822 | 370 |
| 411 | 3300046615 | Ga0495656_0062586 | Ga0495656_0062586_19_1176 | 370 |
| 412 | 3300046642 | Ga0495634_0000350 | Ga0495634_0000350_21487_22605 | 370 |
| 413 | 3300046663 | Ga0495635_0000018 | Ga0495635_0000018_170959_172077 | 370 |
| 414 | 3300046665 | Ga0495661_0139652 | Ga0495661_0139652_76_1233 | 370 |
| 415 | 3300046675 | Ga0495657_0000245 | Ga0495657_0000245_26759_27877 | 370 |
| 416 | 3300046678 | Ga0495599_0000032 | Ga0495599_0000032_85642_86760 | 370 |
| 417 | 3300046679 | Ga0495623_0000004 | Ga0495623_0000004_12262_13380 | 370 |
| 418 | 3300046680 | Ga0495646_0000083 | Ga0495646_0000083_21815_22933 | 370 |
| 419 | 3300046681 | Ga0495647_0020993 | Ga0495647_0020993_847_2004 | 370 |
| 420 | 3300046683 | Ga0495658_0082083 | Ga0495658_0082083_67_1224 | 370 |
| 421 | 3300046683 | Ga0495658_0094956 | Ga0495658_0094956_363_1520 | 370 |
| 422 | 3300046689 | Ga0495613_0081717 | Ga0495613_0081717_128_1246 | 370 |
| 423 | 3300046691 | Ga0495670_0076295 | Ga0495670_0076295_267_1424 | 370 |
| 424 | 3300046809 | Ga0495600_0000022 | Ga0495600_0000022_69884_71002 | 370 |
| 425 | 3300047315 | Ga0495581_0026783 | Ga0495581_0026783_2121_3239 | 370 |
| 426 | 3300047317 | Ga0495604_0000011 | Ga0495604_0000011_21515_22633 | 370 |
| 427 | 3300047319 | Ga0495674_0000034 | Ga0495674_0000034_88042_89160 | 370 |
| 428 | 3300047321 | Ga0495676_0092637 | Ga0495676_0092637_624_1736 | 370 |
| 429 | 3300047322 | Ga0495680_0000290 | Ga0495680_0000290_21508_22626 | 370 |
| 430 | 3300047444 | Ga0495675_0000352 | Ga0495675_0000352_7403_8521 | 370 |
| 431 | 3300047445 | Ga0495677_0031302 | Ga0495677_0031302_143_1300 | 370 |
| 432 | 3300047471 | Ga0495684_0000012 | Ga0495684_0000012_162328_163446 | 370 |
| 433 | 3300047673 | Ga0495593_0005499 | Ga0495593_0005499_380_1498 | 370 |
| 434 | 3300048088 | Ga0495602_0000064 | Ga0495602_0000064_21515_22633 | 370 |
| 435 | 3300048903 | Ga0496100_0007364 | Ga0496100_0007364_4611_5723 | 370 |
| 436 | 3300048903 | Ga0496100_0078035 | Ga0496100_0078035_719_1876 | 370 |
| 437 | 3300048903 | Ga0496100_0108032 | Ga0496100_0108032_504_1661 | 370 |
| 438 | 3300048904 | Ga0496101_0009345 | Ga0496101_0009345_504_1661 | 370 |
| 439 | 3300048904 | Ga0496101_0022365 | Ga0496101_0022365_1184_2296 | 370 |
| 440 | 3300048905 | Ga0496102_0031690 | Ga0496102_0031690_3246_4403 | 370 |
| 441 | 3300048905 | Ga0496102_0047152 | Ga0496102_0047152_617_1729 | 370 |
| 442 | 3300048906 | Ga0496103_0002040 | Ga0496103_0002040_8480_9637 | 370 |
| 443 | 3300048906 | Ga0496103_0030032 | Ga0496103_0030032_732_1889 | 370 |
| 444 | 3300048906 | Ga0496103_0096621 | Ga0496103_0096621_326_1483 | 370 |
| 445 | 3300048907 | Ga0496104_0001609 | Ga0496104_0001609_4399_5556 | 370 |
| 446 | 3300048907 | Ga0496104_0002163 | Ga0496104_0002163_11296_12453 | 370 |
| 447 | 3300048907 | Ga0496104_0011126 | Ga0496104_0011126_2506_3618 | 370 |
| 448 | 3300048907 | Ga0496104_0289415 | Ga0496104_0289415_342_1499 | 370 |
| 449 | 3300048908 | Ga0496105_0000754 | Ga0496105_0000754_8945_10102 | 370 |
| 450 | 3300048908 | Ga0496105_0006795 | Ga0496105_0006795_3182_4294 | 370 |
| 451 | 3300048908 | Ga0496105_0017420 | Ga0496105_0017420_3452_4609 | 370 |
| 452 | 3300048908 | Ga0496105_0065563 | Ga0496105_0065563_817_1974 | 370 |
| 453 | 3300048908 | Ga0496105_0119900 | Ga0496105_0119900_892_2049 | 370 |
| 454 | 3300048909 | Ga0496106_0003637 | Ga0496106_0003637_2878_4035 | 370 |
| 455 | 3300048909 | Ga0496106_0039379 | Ga0496106_0039379_1259_2371 | 370 |
| 456 | 3300048909 | Ga0496106_0045309 | Ga0496106_0045309_50_1207 | 370 |
| 457 | 3300048910 | Ga0496107_0000810 | Ga0496107_0000810_2925_4082 | 370 |
| 458 | 3300048910 | Ga0496107_0060281 | Ga0496107_0060281_1398_2510 | 370 |
| 459 | 3300048910 | Ga0496107_0157447 | Ga0496107_0157447_182_1339 | 370 |
| 460 | 3300048911 | Ga0496108_0005275 | Ga0496108_0005275_2108_3220 | 370 |
| 461 | 3300048911 | Ga0496108_0005539 | Ga0496108_0005539_4551_5708 | 370 |
| 462 | 3300048911 | Ga0496108_0215129 | Ga0496108_0215129_518_1630 | 370 |
| 463 | 3300048912 | Ga0496109_0001755 | Ga0496109_0001755_2177_3334 | 370 |
| 464 | 3300048912 | Ga0496109_0008088 | Ga0496109_0008088_7113_8225 | 370 |
| 465 | 3300048912 | Ga0496109_0043286 | Ga0496109_0043286_1459_2571 | 370 |
| 466 | 3300048912 | Ga0496109_0120921 | Ga0496109_0120921_923_2080 | 370 |
| 467 | 3300048912 | Ga0496109_0158562 | Ga0496109_0158562_376_1533 | 370 |
| 468 | 3300048913 | Ga0496110_0001702 | Ga0496110_0001702_9230_10342 | 370 |
| 469 | 3300048913 | Ga0496110_0016646 | Ga0496110_0016646_4643_5800 | 370 |
| 470 | 3300048913 | Ga0496110_0062726 | Ga0496110_0062726_628_1785 | 370 |
| 471 | 3300048913 | Ga0496110_0121018 | Ga0496110_0121018_943_2055 | 370 |
| 472 | 3300048914 | Ga0496111_0001059 | Ga0496111_0001059_7043_8200 | 370 |
| 473 | 3300048914 | Ga0496111_0018711 | Ga0496111_0018711_2717_3874 | 370 |
| 474 | 3300048914 | Ga0496111_0028517 | Ga0496111_0028517_2403_3515 | 370 |
| 475 | 3300048914 | Ga0496111_0164772 | Ga0496111_0164772_440_1597 | 370 |
| 476 | 3300048915 | Ga0496112_0030580 | Ga0496112_0030580_3452_4609 | 370 |
| 477 | 3300048915 | Ga0496112_0106728 | Ga0496112_0106728_739_1851 | 370 |
| 478 | 3300048915 | Ga0496112_0188225 | Ga0496112_0188225_838_1995 | 370 |
| 479 | 3300048916 | Ga0496113_0000933 | Ga0496113_0000933_7299_8456 | 370 |
| 480 | 3300048916 | Ga0496113_0005049 | Ga0496113_0005049_4987_6144 | 370 |
| 481 | 3300048917 | Ga0496114_0002210 | Ga0496114_0002210_2888_4000 | 370 |
| 482 | 3300048917 | Ga0496114_0004133 | Ga0496114_0004133_6016_7173 | 370 |
| 483 | 3300048917 | Ga0496114_0027277 | Ga0496114_0027277_2790_3947 | 370 |
| 484 | 3300048918 | Ga0496115_0007233 | Ga0496115_0007233_169_1281 | 370 |
| 485 | 3300048918 | Ga0496115_0012531 | Ga0496115_0012531_342_1499 | 370 |
| 486 | 3300048918 | Ga0496115_0101829 | Ga0496115_0101829_256_1413 | 370 |
| 487 | 3300048918 | Ga0496115_0129801 | Ga0496115_0129801_682_1803 | 370 |
| 488 | 3300048918 | Ga0496115_0138372 | Ga0496115_0138372_843_1955 | 370 |
| 489 | 3300048918 | Ga0496115_0168678 | Ga0496115_0168678_472_1629 | 370 |
| 490 | 3300049568 | Ga0501031_0005837 | Ga0501031_0005837_3907_5070 | 370 |
| 491 | 3300049569 | Ga0501032_0119854 | Ga0501032_0119854_519_1631 | 370 |
| 492 | 3300049570 | Ga0501033_0084935 | Ga0501033_0084935_27_1190 | 370 |
| 493 | 3300049571 | Ga0501034_0050156 | Ga0501034_0050156_2449_3567 | 370 |
| 494 | 3300049571 | Ga0501034_0060014 | Ga0501034_0060014_1941_3104 | 370 |
| 495 | 3300049571 | Ga0501034_0207973 | Ga0501034_0207973_274_1392 | 370 |
| 496 | 3300049572 | Ga0501036_0008715 | Ga0501036_0008715_461_1624 | 370 |
| 497 | 3300049573 | Ga0501037_0010069 | Ga0501037_0010069_3373_4536 | 370 |
| 498 | 3300049574 | Ga0501038_0010460 | Ga0501038_0010460_6192_7355 | 370 |
| 499 | 3300049575 | Ga0501039_0149434 | Ga0501039_0149434_16_1137 | 370 |
| 500 | 3300049578 | Ga0501042_0024204 | Ga0501042_0024204_1510_2673 | 370 |
| 501 | 3300049579 | Ga0501043_0046681 | Ga0501043_0046681_1131_2294 | 370 |
| 502 | 3300049580 | Ga0501046_0004428 | Ga0501046_0004428_4094_5257 | 370 |
| 503 | 3300049581 | Ga0501047_0082281 | Ga0501047_0082281_27_1190 | 370 |
| 504 | 3300049581 | Ga0501047_0197597 | Ga0501047_0197597_624_1742 | 370 |
| 505 | 3300049582 | Ga0501048_0008331 | Ga0501048_0008331_2696_3859 | 370 |
| 506 | 3300049583 | Ga0501067_0051201 | Ga0501067_0051201_233_1396 | 370 |
| 507 | 3300049584 | Ga0501068_0010438 | Ga0501068_0010438_1588_2751 | 370 |
| 508 | 3300049585 | Ga0501069_0021567 | Ga0501069_0021567_322_1485 | 370 |
| 509 | 3300049587 | Ga0501071_0051618 | Ga0501071_0051618_415_1578 | 370 |
| 510 | 3300049588 | Ga0501072_0016826 | Ga0501072_0016826_2642_3763 | 370 |
| 511 | 3300049589 | Ga0501073_0002666 | Ga0501073_0002666_5692_6855 | 370 |
| 512 | 3300049590 | Ga0501074_0001621 | Ga0501074_0001621_6464_7627 | 370 |
| 513 | 3300049591 | Ga0501075_0140867 | Ga0501075_0140867_80_1192 | 370 |
| 514 | 3300049741 | Ga0501079_0156664 | Ga0501079_0156664_282_1439 | 370 |
| 515 | 3300049741 | Ga0501079_0166166 | Ga0501079_0166166_581_1693 | 370 |
| 516 | 3300049742 | Ga0501080_0066382 | Ga0501080_0066382_783_1901 | 370 |
| 517 | 3300049742 | Ga0501080_0106572 | Ga0501080_0106572_322_1485 | 370 |
| 518 | 3300049743 | Ga0501081_0097592 | Ga0501081_0097592_288_1445 | 370 |
| 519 | 3300049743 | Ga0501081_0221814 | Ga0501081_0221814_15_1178 | 370 |
| 520 | 3300049744 | Ga0501083_0000986 | Ga0501083_0000986_13701_14828 | 370 |
| 521 | 3300049744 | Ga0501083_0063961 | Ga0501083_0063961_1061_2182 | 370 |
| 522 | 3300049744 | Ga0501083_0114516 | Ga0501083_0114516_626_1744 | 370 |
| 523 | 3300049744 | Ga0501083_0130798 | Ga0501083_0130798_402_1565 | 370 |
| 524 | 3300049822 | Ga0501035_0052977 | Ga0501035_0052977_529_1692 | 370 |
| 525 | 3300049823 | Ga0501044_0001050 | Ga0501044_0001050_3919_5037 | 370 |
| 526 | 3300049823 | Ga0501044_0017930 | Ga0501044_0017930_717_1880 | 370 |
| 527 | 3300049824 | Ga0501045_0055627 | Ga0501045_0055627_1691_2854 | 370 |
| 528 | 3300049824 | Ga0501045_0102263 | Ga0501045_0102263_319_1440 | 370 |
| 529 | 3300050489 | nmdc:mga03683_42287_c1 | nmdc:mga03683_42287_c1_409_1590 | 370 |
| 530 | 3300050490 | nmdc:mga03n38_45502_c1 | nmdc:mga03n38_45502_c1_401_1522 | 370 |
| 531 | 3300050491 | nmdc:mga00v17_51901_c1 | nmdc:mga00v17_51901_c1_724_1869 | 370 |
| 532 | 3300050492 | nmdc:mga0yw44_19625_c1 | nmdc:mga0yw44_19625_c1_554_1711 | 370 |
| 533 | 3300050492 | nmdc:mga0yw44_94440_c1 | nmdc:mga0yw44_94440_c1_48_1160 | 370 |
| 534 | 3300050493 | nmdc:mga0k408_805_c2 | nmdc:mga0k408_805_c2_3063_4184 | 370 |
| 535 | 3300050494 | nmdc:mga06z11_31448_c1 | nmdc:mga06z11_31448_c1_459_1604 | 370 |
| 536 | 3300050494 | nmdc:mga06z11_72399_c1 | nmdc:mga06z11_72399_c1_195_1316 | 370 |
| 537 | 3300050507 | nmdc:mga05p37_109346_c1 | nmdc:mga05p37_109346_c1_490_1602 | 370 |
| 538 | 3300050507 | nmdc:mga05p37_30275_c1 | nmdc:mga05p37_30275_c1_4703_5860 | 370 |
| 539 | 3300050507 | nmdc:mga05p37_55142_c1 | nmdc:mga05p37_55142_c1_1749_2861 | 370 |
| 540 | 3300050507 | nmdc:mga05p37_66731_c1 | nmdc:mga05p37_66731_c1_1049_2173 | 370 |
| 541 | 3300050508 | nmdc:mga09592_205928_c1 | nmdc:mga09592_205928_c1_120_1232 | 370 |
| 542 | 3300050508 | nmdc:mga09592_96825_c1 | nmdc:mga09592_96825_c1_82_1194 | 370 |
| 543 | 3300050509 | nmdc:mga0qj67_132081_c1 | nmdc:mga0qj67_132081_c1_32_1144 | 370 |
| 544 | 3300050509 | nmdc:mga0qj67_144642_c1 | nmdc:mga0qj67_144642_c1_360_1481 | 370 |
| 545 | 3300050509 | nmdc:mga0qj67_60_c1 | nmdc:mga0qj67_60_c1_61071_62183 | 370 |
| 546 | 3300050510 | nmdc:mga06r32_268023_c1 | nmdc:mga06r32_268023_c1_130_1251 | 370 |
| 547 | 3300050511 | nmdc:mga08y16_126950_c1 | nmdc:mga08y16_126950_c1_537_1694 | 370 |
| 548 | 3300050511 | nmdc:mga08y16_353105_c1 | nmdc:mga08y16_353105_c1_328_1440 | 370 |
| 549 | 3300050511 | nmdc:mga08y16_61962_c1 | nmdc:mga08y16_61962_c1_1564_2685 | 370 |
| 550 | 3300050512 | nmdc:mga0n895_3017_c1 | nmdc:mga0n895_3017_c1_1555_2703 | 370 |
| 551 | 3300050514 | nmdc:mga08x19_227291_c1 | nmdc:mga08x19_227291_c1_103_1221 | 370 |
| 552 | 3300050515 | nmdc:mga0a205_200884_c1 | nmdc:mga0a205_200884_c1_146_1267 | 370 |
| 553 | 3300053077 | Ga0495601_0000015 | Ga0495601_0000015_21515_22633 | 370 |
| 554 | 3300053077 | Ga0495601_0105928 | Ga0495601_0105928_645_1757 | 370 |
| 555 | 3300053077 | Ga0495601_0211169 | Ga0495601_0211169_123_1235 | 370 |
| 556 | 3300053078 | Ga0495612_0000096 | Ga0495612_0000096_15385_16503 | 370 |
| 557 | 3300053083 | Ga0495655_0011263 | Ga0495655_0011263_390_1547 | 370 |
| 558 | 3300053084 | Ga0495595_0000035 | Ga0495595_0000035_57247_58365 | 370 |
| 559 | 3300053084 | Ga0495595_0003933 | Ga0495595_0003933_821_1933 | 370 |
| 560 | 3300053085 | Ga0495619_0000044 | Ga0495619_0000044_21815_22933 | 370 |
| 561 | 3300053085 | Ga0495619_0074257 | Ga0495619_0074257_155_1267 | 370 |
| 562 | 3300053096 | Ga0500641_0014824 | Ga0500641_0014824_43_1161 | 370 |
| 563 | 3300053099 | Ga0500654_089093 | Ga0500654_089093_184_1305 | 370 |
| 564 | 3300053131 | Ga0500652_000488 | Ga0500652_000488_12798_13916 | 370 |
| 565 | 3300053134 | Ga0500658_0061944 | Ga0500658_0061944_297_1442 | 370 |
| 566 | 3300053139 | Ga0500568_0002398 | Ga0500568_0002398_178_1359 | 370 |
| 567 | 3300053153 | Ga0500616_0106686 | Ga0500616_0106686_65_1177 | 370 |
| 568 | 3300053177 | Ga0500636_0101606 | Ga0500636_0101606_31_1149 | 370 |
| 569 | 3300053730 | Ga0500645_028599 | Ga0500645_028599_159_1277 | 370 |
| 570 | 3300054114 | Ga0501084_0030993 | Ga0501084_0030993_2945_4108 | 370 |
| 571 | 3300060353 | Ga0501082_0000016 | Ga0501082_0000016_11235_12356 | 370 |
| 572 | 3300060353 | Ga0501082_0030709 | Ga0501082_0030709_1493_2656 | 370 |
| 573 | 3300060353 | Ga0501082_0194171 | Ga0501082_0194171_13_1134 | 370 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tt4-assembly1.cif.gz_B | structure of np459575, a predicted glutathione synthase from salmonella typhimurium | 0.8927 | 2 | 362 |
| 1r8g-assembly1.cif.gz_B | structure and function of ybdk | 0.888 | 2 | 362 |
| 1r8g-assembly1.cif.gz_A | structure and function of ybdk | 0.8872 | 2 | 367 |
| 1tt4-assembly1.cif.gz_B | structure of np459575, a predicted glutathione synthase from salmonella typhimurium | 0.8736 | 2 | 362 |
| 1r8g-assembly1.cif.gz_A | structure and function of ybdk | 0.8658 | 2 | 367 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WPK9_8_375_3.30.590.20 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9361 | 2 | 366 | 3.30.590.20 |
| af_P9WPK9_8_375_3.30.590.20 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.9092 | 2 | 366 | 3.30.590.20 |
| 1r8gA00 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.873 | 2 | 367 | 3.30.590.20 |
| 1r8gA00 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.8514 | 2 | 367 | 3.30.590.20 |
| af_I6YCS6_35_480_3.30.590.20 | Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2; | 0.8294 | 2 | 346 | 3.30.590.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327L2A5-F1-model_v4 | Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) | 0.9797 | 4 | 370 |
GO:0004357
GO:0005524 GO:0042398 |
| AF-A4YLK4-F1-model_v4 | Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) | 0.9779 | 1 | 370 |
GO:0004357
GO:0005524 GO:0042398 |
| AF-A0A363TMY8-F1-model_v4 | Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) | 0.9778 | 1 | 370 |
GO:0004357
GO:0005524 GO:0042398 |
| AF-A0A0R3CPT8-F1-model_v4 | Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) | 0.9769 | 5 | 369 |
GO:0004357
GO:0005524 GO:0042398 |
| AF-A0A363TMY8-F1-model_v4 | Putative glutamate--cysteine ligase 2 (EC 6.3.2.2) (Gamma-glutamylcysteine synthetase 2) (GCS 2) (Gamma-GCS 2) | 0.9752 | 1 | 370 |
GO:0004357
GO:0005524 GO:0042398 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar