F465129
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 315 | 566 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300050509|nmdc:mga0qj67_27643_c1|nmdc:mga0qj67_27643_c1_859_1938 |
| Length | 359 |
| Sequence | MNSPLPLPRVAGAESVRYYSIEDYNVLVRHRQLHTGGKMFVRILACAALALCVATPSWSQTYPTKPIRLIVGYAAGGSVDTTARIFAPKLSADLGQQVIVENRAGAASNIAADYVAKAPPDGYTLFWSSGTGLGTNLAFYQKMTYNPLKDFAPIALLMYQSNGLVVNPTVPATTTKELIALAKARPGQLNYGTAGTGTSQHMTAELFSKMTGIRXXXXAYKGGAPALVDLVGGHVDLVFSPLPEVIPYVRANRLRAIAVSGAKRTPAMSNVPTVGETVPGFAFEGFLGVVSPAGVSPDVVARINAVANKALQDPDVKNRLVDLGLGIAGSTPEQLGAHMREQSALMIRIAKDAGIKPLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 2 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 3 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 4 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 5 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 6 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 182 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 183 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 210 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 211 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 212 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 214 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 217 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 218 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 219 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 220 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 221 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 222 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 225 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 226 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 227 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 287 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 305 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 307 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 308 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 309 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0 |
| Isolates | 1.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.82 |
| Nodule | 0.52 |
| Rhizoplane | 2.45 |
| Rhizosphere | 88.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055534_1002254 | 3300003784 | Bacteria | 6817 |
| 2 | Ga0055540_1019252 | 3300003792 | Bacteria | 1842 |
| 3 | Ga0065707_10083489 | 3300005295 | Bacteria | 8984 |
| 4 | Ga0065707_10103539 | 3300005295 | Bacteria | 2743 |
| 5 | Ga0070676_10036355 | 3300005328 | Bacteria | 2837 |
| 6 | Ga0070676_10185380 | 3300005328 | Bacteria | 1355 |
| 7 | Ga0070683_100000347 | 3300005329 | Bacteria | 31865 |
| 8 | Ga0070683_100004990 | 3300005329 | Bacteria | 11016 |
| 9 | Ga0070683_100280767 | 3300005329 | Bacteria | 1584 |
| 10 | Ga0070690_100005081 | 3300005330 | Bacteria | 7375 |
| 11 | Ga0070670_100000309 | 3300005331 | Bacteria | 41915 |
| 12 | Ga0070670_100029278 | 3300005331 | Bacteria | 4739 |
| 13 | Ga0070670_100199003 | 3300005331 | Bacteria | 1740 |
| 14 | Ga0070670_100263249 | 3300005331 | Bacteria | 1503 |
| 15 | Ga0070670_100371982 | 3300005331 | Bacteria | 1258 |
| 16 | Ga0070677_10004019 | 3300005333 | Bacteria | 4776 |
| 17 | Ga0070677_10054342 | 3300005333 | Bacteria | 1631 |
| 18 | Ga0070677_10105483 | 3300005333 | Bacteria | 1250 |
| 19 | Ga0068869_100001859 | 3300005334 | Bacteria | 12697 |
| 20 | Ga0068869_100045994 | 3300005334 | Bacteria | 3145 |
| 21 | Ga0070666_10002081 | 3300005335 | Bacteria | 12159 |
| 22 | Ga0070666_10179699 | 3300005335 | Bacteria | 1484 |
| 23 | Ga0070680_100092263 | 3300005336 | Bacteria | 2508 |
| 24 | Ga0070682_100034514 | 3300005337 | Bacteria | 3081 |
| 25 | Ga0068868_100000930 | 3300005338 | Bacteria | 19942 |
| 26 | Ga0068868_100005400 | 3300005338 | Bacteria | 8982 |
| 27 | Ga0068868_100012111 | 3300005338 | Bacteria | 6298 |
| 28 | Ga0068868_100323962 | 3300005338 | Bacteria | 1313 |
| 29 | Ga0070689_100000939 | 3300005340 | Bacteria | 18114 |
| 30 | Ga0070689_100032710 | 3300005340 | Bacteria | 3957 |
| 31 | Ga0070687_100000199 | 3300005343 | Bacteria | 20848 |
| 32 | Ga0070661_100001422 | 3300005344 | Bacteria | 16639 |
| 33 | Ga0070661_100217906 | 3300005344 | Bacteria | 1463 |
| 34 | Ga0070661_100272912 | 3300005344 | Bacteria | 1310 |
| 35 | Ga0070668_100033964 | 3300005347 | Bacteria | 3887 |
| 36 | Ga0070668_100063383 | 3300005347 | Bacteria | 2865 |
| 37 | Ga0070668_100151436 | 3300005347 | Bacteria | 1876 |
| 38 | Ga0070669_100041925 | 3300005353 | Bacteria | 3330 |
| 39 | Ga0070669_100306416 | 3300005353 | Bacteria | 1279 |
| 40 | Ga0070675_100000049 | 3300005354 | Bacteria | 72492 |
| 41 | Ga0070675_100000926 | 3300005354 | Bacteria | 20887 |
| 42 | Ga0070675_100175869 | 3300005354 | Bacteria | 1848 |
| 43 | Ga0070671_100000137 | 3300005355 | Bacteria | 47124 |
| 44 | Ga0070671_100119494 | 3300005355 | Bacteria | 2217 |
| 45 | Ga0070674_100171049 | 3300005356 | Bacteria | 1656 |
| 46 | Ga0070673_100000394 | 3300005364 | Bacteria | 23087 |
| 47 | Ga0070673_100078227 | 3300005364 | Bacteria | 2675 |
| 48 | Ga0070673_100127486 | 3300005364 | Bacteria | 2131 |
| 49 | Ga0070673_100146302 | 3300005364 | Bacteria | 1998 |
| 50 | Ga0070688_100018238 | 3300005365 | Bacteria | 4046 |
| 51 | Ga0070688_100140427 | 3300005365 | Bacteria | 1640 |
| 52 | Ga0070659_100062258 | 3300005366 | Bacteria | 2949 |
| 53 | Ga0070659_100315456 | 3300005366 | Bacteria | 1306 |
| 54 | Ga0070667_100013715 | 3300005367 | Bacteria | 6698 |
| 55 | Ga0070667_100132100 | 3300005367 | Bacteria | 2180 |
| 56 | Ga0070667_100175560 | 3300005367 | Bacteria | 1893 |
| 57 | Ga0070667_100245849 | 3300005367 | Bacteria | 1598 |
| 58 | Ga0070714_100261069 | 3300005435 | Bacteria | 1604 |
| 59 | Ga0070714_100408266 | 3300005435 | Bacteria | 1285 |
| 60 | Ga0070713_100114554 | 3300005436 | Bacteria | 2356 |
| 61 | Ga0070701_10011085 | 3300005438 | Bacteria | 4012 |
| 62 | Ga0070705_100003046 | 3300005440 | Bacteria | 8258 |
| 63 | Ga0070700_100021308 | 3300005441 | Bacteria | 3766 |
| 64 | Ga0070700_100302532 | 3300005441 | Bacteria | 1168 |
| 65 | Ga0070694_100095420 | 3300005444 | Bacteria | 2094 |
| 66 | Ga0070678_100000771 | 3300005456 | Bacteria | 16065 |
| 67 | Ga0070678_100073303 | 3300005456 | Bacteria | 2569 |
| 68 | Ga0070678_100141993 | 3300005456 | Bacteria | 1923 |
| 69 | Ga0070662_100056003 | 3300005457 | Bacteria | 2862 |
| 70 | Ga0070662_100131172 | 3300005457 | Bacteria | 1932 |
| 71 | Ga0070681_10039992 | 3300005458 | Bacteria | 4701 |
| 72 | Ga0070681_10167301 | 3300005458 | Bacteria | 2121 |
| 73 | Ga0068867_100000824 | 3300005459 | Bacteria | 20865 |
| 74 | Ga0068867_100004978 | 3300005459 | Bacteria | 9361 |
| 75 | Ga0068867_100016771 | 3300005459 | Bacteria | 5204 |
| 76 | Ga0070685_10026991 | 3300005466 | Bacteria | 3170 |
| 77 | Ga0070679_100009445 | 3300005530 | Bacteria | 9224 |
| 78 | Ga0070679_100023923 | 3300005530 | Bacteria | 5985 |
| 79 | Ga0070679_100250482 | 3300005530 | Bacteria | 1728 |
| 80 | Ga0070679_100285377 | 3300005530 | Bacteria | 1603 |
| 81 | Ga0070684_100089855 | 3300005535 | Bacteria | 2730 |
| 82 | Ga0070672_100207665 | 3300005543 | Bacteria | 1639 |
| 83 | Ga0070686_100011913 | 3300005544 | Bacteria | 4944 |
| 84 | Ga0070695_100000728 | 3300005545 | Bacteria | 17589 |
| 85 | Ga0070696_100006658 | 3300005546 | Bacteria | 7718 |
| 86 | Ga0070693_100000072 | 3300005547 | Bacteria | 41480 |
| 87 | Ga0070693_100108500 | 3300005547 | Bacteria | 1703 |
| 88 | Ga0070693_100171358 | 3300005547 | Bacteria | 1390 |
| 89 | Ga0070665_100002809 | 3300005548 | Bacteria | 18859 |
| 90 | Ga0070665_100069685 | 3300005548 | Bacteria | 3525 |
| 91 | Ga0070665_100095868 | 3300005548 | Bacteria | 2972 |
| 92 | Ga0070665_100308262 | 3300005548 | Bacteria | 1586 |
| 93 | Ga0070704_100003550 | 3300005549 | Bacteria | 8965 |
| 94 | Ga0068855_100011949 | 3300005563 | Bacteria | 10497 |
| 95 | Ga0068855_100125900 | 3300005563 | Bacteria | 2929 |
| 96 | Ga0070664_100000054 | 3300005564 | Bacteria | 69166 |
| 97 | Ga0068857_100032236 | 3300005577 | Bacteria | 4633 |
| 98 | Ga0068857_100395650 | 3300005577 | Bacteria | 1285 |
| 99 | Ga0068854_100000714 | 3300005578 | Bacteria | 19666 |
| 100 | Ga0068854_100032767 | 3300005578 | Bacteria | 3617 |
| 101 | Ga0068856_100059045 | 3300005614 | Bacteria | 3788 |
| 102 | Ga0068856_100448281 | 3300005614 | Bacteria | 1311 |
| 103 | Ga0070702_100000084 | 3300005615 | Bacteria | 27525 |
| 104 | Ga0070702_100202335 | 3300005615 | Bacteria | 1315 |
| 105 | Ga0068852_100000065 | 3300005616 | Bacteria | 72149 |
| 106 | Ga0068852_100000654 | 3300005616 | Bacteria | 22706 |
| 107 | Ga0068852_100034748 | 3300005616 | Bacteria | 4198 |
| 108 | Ga0068859_100005387 | 3300005617 | Bacteria | 13012 |
| 109 | Ga0068859_100018280 | 3300005617 | Bacteria | 7048 |
| 110 | Ga0068859_100119947 | 3300005617 | Bacteria | 2697 |
| 111 | Ga0068859_100363258 | 3300005617 | Bacteria | 1543 |
| 112 | Ga0068864_100001420 | 3300005618 | Bacteria | 19796 |
| 113 | Ga0068864_100003720 | 3300005618 | Bacteria | 12594 |
| 114 | Ga0068864_100166232 | 3300005618 | Bacteria | 2009 |
| 115 | Ga0068864_100212908 | 3300005618 | Bacteria | 1780 |
| 116 | Ga0068866_10002137 | 3300005718 | Bacteria | 8225 |
| 117 | Ga0068866_10082629 | 3300005718 | Bacteria | 1729 |
| 118 | Ga0068861_100004429 | 3300005719 | Bacteria | 9421 |
| 119 | Ga0068861_100050276 | 3300005719 | Bacteria | 3160 |
| 120 | Ga0068861_100356137 | 3300005719 | Bacteria | 1285 |
| 121 | Ga0068851_10001105 | 3300005834 | Bacteria | 11693 |
| 122 | Ga0068863_100024030 | 3300005841 | Bacteria | 5816 |
| 123 | Ga0068863_100087722 | 3300005841 | Bacteria | 2948 |
| 124 | Ga0068863_100193985 | 3300005841 | Bacteria | 1952 |
| 125 | Ga0068863_100369378 | 3300005841 | Bacteria | 1400 |
| 126 | Ga0068863_100465044 | 3300005841 | Bacteria | 1242 |
| 127 | Ga0068858_100001292 | 3300005842 | Bacteria | 25859 |
| 128 | Ga0068858_100004784 | 3300005842 | Bacteria | 13258 |
| 129 | Ga0068858_100064072 | 3300005842 | Bacteria | 3401 |
| 130 | Ga0068858_100078513 | 3300005842 | Bacteria | 3067 |
| 131 | Ga0068858_100105678 | 3300005842 | Bacteria | 2627 |
| 132 | Ga0068858_100345172 | 3300005842 | Bacteria | 1425 |
| 133 | Ga0068858_100373794 | 3300005842 | Bacteria | 1367 |
| 134 | Ga0068860_100017811 | 3300005843 | Bacteria | 6920 |
| 135 | Ga0068860_100020854 | 3300005843 | Bacteria | 6349 |
| 136 | Ga0068860_100049428 | 3300005843 | Bacteria | 4005 |
| 137 | Ga0068860_100133462 | 3300005843 | Bacteria | 2383 |
| 138 | Ga0068860_100269120 | 3300005843 | Bacteria | 1663 |
| 139 | Ga0068860_100379177 | 3300005843 | Bacteria | 1396 |
| 140 | Ga0068860_100417519 | 3300005843 | Bacteria | 1329 |
| 141 | Ga0068862_100009057 | 3300005844 | Bacteria | 8242 |
| 142 | Ga0068862_100033323 | 3300005844 | Bacteria | 4353 |
| 143 | Ga0068862_100044081 | 3300005844 | Bacteria | 3805 |
| 144 | Ga0068862_100123210 | 3300005844 | Bacteria | 2287 |
| 145 | Ga0068862_100128818 | 3300005844 | Bacteria | 2237 |
| 146 | Ga0068862_100149038 | 3300005844 | Bacteria | 2081 |
| 147 | Ga0068862_100180781 | 3300005844 | Bacteria | 1893 |
| 148 | Ga0081540_1024715 | 3300005983 | Bacteria | 3479 |
| 149 | Ga0075363_100035363 | 3300006048 | Bacteria | 2614 |
| 150 | Ga0075364_10017505 | 3300006051 | Bacteria | 4478 |
| 151 | Ga0070716_100066260 | 3300006173 | Bacteria | 2106 |
| 152 | Ga0070712_100114065 | 3300006175 | Bacteria | 2022 |
| 153 | Ga0075362_10009787 | 3300006177 | Bacteria | 3719 |
| 154 | Ga0075369_10049988 | 3300006186 | Bacteria | 1807 |
| 155 | Ga0075366_10004370 | 3300006195 | Bacteria | 7581 |
| 156 | Ga0097621_100000051 | 3300006237 | Bacteria | 60495 |
| 157 | Ga0097621_100000794 | 3300006237 | Bacteria | 22198 |
| 158 | Ga0097621_100037041 | 3300006237 | Bacteria | 3905 |
| 159 | Ga0097621_100072303 | 3300006237 | Bacteria | 2852 |
| 160 | Ga0097621_100156113 | 3300006237 | Bacteria | 1959 |
| 161 | Ga0075370_10073897 | 3300006353 | Bacteria | 1953 |
| 162 | Ga0068871_100001133 | 3300006358 | Bacteria | 17866 |
| 163 | Ga0068871_100037263 | 3300006358 | Bacteria | 3877 |
| 164 | Ga0068871_100040416 | 3300006358 | Bacteria | 3736 |
| 165 | Ga0068871_100145647 | 3300006358 | Bacteria | 2016 |
| 166 | Ga0068871_100365659 | 3300006358 | Bacteria | 1278 |
| 167 | Ga0075428_100015214 | 3300006844 | Bacteria | 8536 |
| 168 | Ga0075430_100031263 | 3300006846 | Bacteria | 4518 |
| 169 | Ga0075431_100004522 | 3300006847 | Bacteria | 13657 |
| 170 | Ga0075433_10054907 | 3300006852 | Bacteria | 3476 |
| 171 | Ga0075434_100000073 | 3300006871 | Bacteria | 52987 |
| 172 | Ga0068865_100008183 | 3300006881 | Bacteria | 6456 |
| 173 | Ga0068865_100054894 | 3300006881 | Bacteria | 2771 |
| 174 | Ga0068865_100180687 | 3300006881 | Bacteria | 1624 |
| 175 | Ga0068865_100436918 | 3300006881 | Bacteria | 1079 |
| 176 | Ga0075436_100232184 | 3300006914 | Bacteria | 1311 |
| 177 | Ga0097620_100005387 | 3300006931 | Bacteria | 13012 |
| 178 | Ga0097620_100018280 | 3300006931 | Bacteria | 7048 |
| 179 | Ga0097620_100119945 | 3300006931 | Bacteria | 2697 |
| 180 | Ga0097620_100363303 | 3300006931 | Bacteria | 1543 |
| 181 | Ga0075435_100028335 | 3300007076 | Bacteria | 4392 |
| 182 | Ga0105250_10045733 | 3300009092 | Bacteria | 1755 |
| 183 | Ga0105240_10007799 | 3300009093 | Bacteria | 15467 |
| 184 | Ga0105240_10033241 | 3300009093 | Bacteria | 6667 |
| 185 | Ga0105240_10116687 | 3300009093 | Bacteria | 3220 |
| 186 | Ga0111539_10000288 | 3300009094 | Bacteria | 60623 |
| 187 | Ga0111539_10530474 | 3300009094 | Bacteria | 1371 |
| 188 | Ga0111539_10738483 | 3300009094 | Bacteria | 1146 |
| 189 | Ga0105245_10001603 | 3300009098 | Bacteria | 20580 |
| 190 | Ga0105245_10315345 | 3300009098 | Bacteria | 1539 |
| 191 | Ga0105243_10001817 | 3300009148 | Bacteria | 18269 |
| 192 | Ga0105243_10162006 | 3300009148 | Bacteria | 1930 |
| 193 | Ga0105243_10345805 | 3300009148 | Bacteria | 1364 |
| 194 | Ga0105242_10001017 | 3300009176 | Bacteria | 22032 |
| 195 | Ga0105242_10003543 | 3300009176 | Bacteria | 12137 |
| 196 | Ga0105242_10124752 | 3300009176 | Bacteria | 2215 |
| 197 | Ga0105242_10215605 | 3300009176 | Bacteria | 1713 |
| 198 | Ga0105248_10063971 | 3300009177 | Bacteria | 4130 |
| 199 | Ga0105248_10064605 | 3300009177 | Bacteria | 4109 |
| 200 | Ga0105248_10095368 | 3300009177 | Bacteria | 3350 |
| 201 | Ga0105248_10142497 | 3300009177 | Bacteria | 2704 |
| 202 | Ga0105248_10170421 | 3300009177 | Bacteria | 2453 |
| 203 | Ga0105248_10442281 | 3300009177 | Bacteria | 1465 |
| 204 | Ga0105238_10061117 | 3300009551 | Bacteria | 3771 |
| 205 | Ga0105238_10070239 | 3300009551 | Bacteria | 3501 |
| 206 | Ga0105249_10202557 | 3300009553 | Bacteria | 1943 |
| 207 | Ga0105249_10250572 | 3300009553 | Bacteria | 1756 |
| 208 | Ga0105249_10306750 | 3300009553 | Bacteria | 1594 |
| 209 | Ga0105239_10028862 | 3300010375 | Bacteria | 6099 |
| 210 | Ga0157371_10116250 | 3300013102 | Bacteria | 1900 |
| 211 | Ga0157369_10002100 | 3300013105 | Bacteria | 24031 |
| 212 | Ga0157374_10000144 | 3300013296 | Bacteria | 64667 |
| 213 | Ga0157374_10064400 | 3300013296 | Bacteria | 3440 |
| 214 | Ga0157374_10343763 | 3300013296 | Bacteria | 1481 |
| 215 | Ga0157378_10004938 | 3300013297 | Bacteria | 11690 |
| 216 | Ga0157378_10333690 | 3300013297 | Bacteria | 1476 |
| 217 | Ga0163162_10043379 | 3300013306 | Bacteria | 4503 |
| 218 | Ga0163162_10155654 | 3300013306 | Bacteria | 2405 |
| 219 | Ga0163162_10164463 | 3300013306 | Bacteria | 2342 |
| 220 | Ga0157372_10019363 | 3300013307 | Bacteria | 7334 |
| 221 | Ga0157375_10000528 | 3300013308 | Bacteria | 34322 |
| 222 | Ga0157375_10048662 | 3300013308 | Bacteria | 4148 |
| 223 | Ga0157375_10809002 | 3300013308 | Bacteria | 1085 |
| 224 | Ga0163163_10002538 | 3300014325 | Bacteria | 15454 |
| 225 | Ga0163163_10041003 | 3300014325 | Bacteria | 4525 |
| 226 | Ga0157380_10055946 | 3300014326 | Bacteria | 3135 |
| 227 | Ga0157380_10059030 | 3300014326 | Bacteria | 3060 |
| 228 | Ga0157380_10096950 | 3300014326 | Bacteria | 2446 |
| 229 | Ga0157380_10488867 | 3300014326 | Bacteria | 1192 |
| 230 | Ga0182008_10047877 | 3300014497 | Bacteria | 2124 |
| 231 | Ga0157377_10018832 | 3300014745 | Bacteria | 3595 |
| 232 | Ga0157377_10094913 | 3300014745 | Bacteria | 1767 |
| 233 | Ga0157379_10014302 | 3300014968 | Bacteria | 6962 |
| 234 | Ga0157379_10078851 | 3300014968 | Bacteria | 2950 |
| 235 | Ga0157379_10176331 | 3300014968 | Bacteria | 1930 |
| 236 | Ga0157376_10018401 | 3300014969 | Bacteria | 5356 |
| 237 | Ga0157376_10021252 | 3300014969 | Bacteria | 5040 |
| 238 | Ga0157376_10093792 | 3300014969 | Bacteria | 2607 |
| 239 | Ga0157376_10181537 | 3300014969 | Bacteria | 1924 |
| 240 | Ga0182007_10000741 | 3300015262 | Bacteria | 18460 |
| 241 | Ga0182005_1025689 | 3300015265 | Bacteria | 1607 |
| 242 | Ga0163161_10049347 | 3300017792 | Bacteria | 3041 |
| 243 | Ga0163161_10061439 | 3300017792 | Bacteria | 2735 |
| 244 | Ga0163161_10130729 | 3300017792 | Bacteria | 1894 |
| 245 | Ga0163161_10264596 | 3300017792 | Bacteria | 1344 |
| 246 | Ga0209675_1008603 | 3300025291 | Bacteria | 3724 |
| 247 | Ga0209676_1008732 | 3300025292 | Bacteria | 4470 |
| 248 | Ga0209564_1033405 | 3300025295 | Bacteria | 1530 |
| 249 | Ga0209050_1018234 | 3300025298 | Bacteria | 2738 |
| 250 | Ga0209051_1006725 | 3300025303 | Bacteria | 6418 |
| 251 | Ga0209257_1009876 | 3300025304 | Bacteria | 4982 |
| 252 | Ga0207656_10002656 | 3300025321 | Bacteria | 6055 |
| 253 | Ga0207682_10069293 | 3300025893 | Bacteria | 1491 |
| 254 | Ga0207682_10095739 | 3300025893 | Bacteria | 1293 |
| 255 | Ga0207682_10103052 | 3300025893 | Bacteria | 1249 |
| 256 | Ga0207642_10000462 | 3300025899 | Bacteria | 12434 |
| 257 | Ga0207642_10042146 | 3300025899 | Bacteria | 2004 |
| 258 | Ga0207688_10038310 | 3300025901 | Bacteria | 2660 |
| 259 | Ga0207680_10022089 | 3300025903 | Bacteria | 3455 |
| 260 | Ga0207647_10139997 | 3300025904 | Bacteria | 1418 |
| 261 | Ga0207685_10038767 | 3300025905 | Bacteria | 1764 |
| 262 | Ga0207707_10114125 | 3300025912 | Bacteria | 2361 |
| 263 | Ga0207707_10157789 | 3300025912 | Bacteria | 1984 |
| 264 | Ga0207695_10116254 | 3300025913 | Bacteria | 2649 |
| 265 | Ga0207695_10401103 | 3300025913 | Bacteria | 1256 |
| 266 | Ga0207693_10002296 | 3300025915 | Bacteria | 16616 |
| 267 | Ga0207660_10002278 | 3300025917 | Bacteria | 12642 |
| 268 | Ga0207662_10015491 | 3300025918 | Bacteria | 4289 |
| 269 | Ga0207649_10002872 | 3300025920 | Bacteria | 9482 |
| 270 | Ga0207649_10190348 | 3300025920 | Bacteria | 1443 |
| 271 | Ga0207652_10031211 | 3300025921 | Bacteria | 4473 |
| 272 | Ga0207652_10453835 | 3300025921 | Bacteria | 1155 |
| 273 | Ga0207681_10027388 | 3300025923 | Bacteria | 3684 |
| 274 | Ga0207681_10075524 | 3300025923 | Bacteria | 2364 |
| 275 | Ga0207681_10087612 | 3300025923 | Bacteria | 2215 |
| 276 | Ga0207681_10184165 | 3300025923 | Bacteria | 1593 |
| 277 | Ga0207681_10274913 | 3300025923 | Bacteria | 1324 |
| 278 | Ga0207694_10114919 | 3300025924 | Bacteria | 2144 |
| 279 | Ga0207694_10137323 | 3300025924 | Bacteria | 1964 |
| 280 | Ga0207650_10000339 | 3300025925 | Bacteria | 45234 |
| 281 | Ga0207659_10001257 | 3300025926 | Bacteria | 15167 |
| 282 | Ga0207659_10042224 | 3300025926 | Bacteria | 3196 |
| 283 | Ga0207659_10423723 | 3300025926 | Bacteria | 1117 |
| 284 | Ga0207687_10022407 | 3300025927 | Bacteria | 4204 |
| 285 | Ga0207687_10401561 | 3300025927 | Bacteria | 1127 |
| 286 | Ga0207664_10091168 | 3300025929 | Bacteria | 2499 |
| 287 | Ga0207664_10131007 | 3300025929 | Bacteria | 2111 |
| 288 | Ga0207644_10001499 | 3300025931 | Bacteria | 15042 |
| 289 | Ga0207644_10058637 | 3300025931 | Bacteria | 2783 |
| 290 | Ga0207706_10160664 | 3300025933 | Bacteria | 1975 |
| 291 | Ga0207706_10268642 | 3300025933 | Bacteria | 1488 |
| 292 | Ga0207686_10002549 | 3300025934 | Bacteria | 9896 |
| 293 | Ga0207686_10005522 | 3300025934 | Bacteria | 6781 |
| 294 | Ga0207686_10061029 | 3300025934 | Bacteria | 2389 |
| 295 | Ga0207686_10081165 | 3300025934 | Bacteria | 2116 |
| 296 | Ga0207670_10011269 | 3300025936 | Bacteria | 5182 |
| 297 | Ga0207670_10012105 | 3300025936 | Bacteria | 5034 |
| 298 | Ga0207670_10291573 | 3300025936 | Bacteria | 1275 |
| 299 | Ga0207669_10013095 | 3300025937 | Bacteria | 4106 |
| 300 | Ga0207704_10001219 | 3300025938 | Bacteria | 11456 |
| 301 | Ga0207704_10037862 | 3300025938 | Bacteria | 2791 |
| 302 | Ga0207704_10110312 | 3300025938 | Bacteria | 1858 |
| 303 | Ga0207691_10000147 | 3300025940 | Bacteria | 65176 |
| 304 | Ga0207691_10073763 | 3300025940 | Bacteria | 3078 |
| 305 | Ga0207691_10084386 | 3300025940 | Bacteria | 2851 |
| 306 | Ga0207691_10167488 | 3300025940 | Bacteria | 1925 |
| 307 | Ga0207711_10050737 | 3300025941 | Bacteria | 3552 |
| 308 | Ga0207711_10089291 | 3300025941 | Bacteria | 2707 |
| 309 | Ga0207711_10351868 | 3300025941 | Bacteria | 1364 |
| 310 | Ga0207689_10002203 | 3300025942 | Bacteria | 18272 |
| 311 | Ga0207689_10041096 | 3300025942 | Bacteria | 3827 |
| 312 | Ga0207689_10102265 | 3300025942 | Bacteria | 2354 |
| 313 | Ga0207661_10001065 | 3300025944 | Bacteria | 18247 |
| 314 | Ga0207661_10114188 | 3300025944 | Bacteria | 2290 |
| 315 | Ga0207661_10234363 | 3300025944 | Bacteria | 1627 |
| 316 | Ga0207679_10000307 | 3300025945 | Bacteria | 36847 |
| 317 | Ga0207651_10000364 | 3300025960 | Bacteria | 19183 |
| 318 | Ga0207651_10002644 | 3300025960 | Bacteria | 8565 |
| 319 | Ga0207651_10152611 | 3300025960 | Bacteria | 1800 |
| 320 | Ga0207651_10390920 | 3300025960 | Bacteria | 1181 |
| 321 | Ga0207712_10047904 | 3300025961 | Bacteria | 2970 |
| 322 | Ga0207668_10012084 | 3300025972 | Bacteria | 5273 |
| 323 | Ga0207640_10000771 | 3300025981 | Bacteria | 18312 |
| 324 | Ga0207658_10002924 | 3300025986 | Bacteria | 12231 |
| 325 | Ga0207658_10009514 | 3300025986 | Bacteria | 6598 |
| 326 | Ga0207658_10106479 | 3300025986 | Bacteria | 2208 |
| 327 | Ga0207658_10112737 | 3300025986 | Bacteria | 2153 |
| 328 | Ga0207677_10000130 | 3300026023 | Bacteria | 61813 |
| 329 | Ga0207677_10011733 | 3300026023 | Bacteria | 5006 |
| 330 | Ga0207703_10001647 | 3300026035 | Bacteria | 20096 |
| 331 | Ga0207703_10004567 | 3300026035 | Bacteria | 11350 |
| 332 | Ga0207703_10107768 | 3300026035 | Bacteria | 2372 |
| 333 | Ga0207703_10114252 | 3300026035 | Bacteria | 2308 |
| 334 | Ga0207703_10297838 | 3300026035 | Bacteria | 1470 |
| 335 | Ga0207639_10029204 | 3300026041 | Bacteria | 4035 |
| 336 | Ga0207678_10122250 | 3300026067 | Bacteria | 2221 |
| 337 | Ga0207708_10000164 | 3300026075 | Bacteria | 52172 |
| 338 | Ga0207641_10002593 | 3300026088 | Bacteria | 16611 |
| 339 | Ga0207641_10029675 | 3300026088 | Bacteria | 4524 |
| 340 | Ga0207641_10091210 | 3300026088 | Bacteria | 2666 |
| 341 | Ga0207648_10002874 | 3300026089 | Bacteria | 18229 |
| 342 | Ga0207648_10006920 | 3300026089 | Bacteria | 11238 |
| 343 | Ga0207648_10098095 | 3300026089 | Bacteria | 2565 |
| 344 | Ga0207648_10209768 | 3300026089 | Bacteria | 1729 |
| 345 | Ga0207676_10001498 | 3300026095 | Bacteria | 17239 |
| 346 | Ga0207676_10014132 | 3300026095 | Bacteria | 5735 |
| 347 | Ga0207676_10023435 | 3300026095 | Bacteria | 4555 |
| 348 | Ga0207676_10264522 | 3300026095 | Bacteria | 1554 |
| 349 | Ga0207674_10009798 | 3300026116 | Bacteria | 10911 |
| 350 | Ga0207675_100001661 | 3300026118 | Bacteria | 22258 |
| 351 | Ga0207675_100100994 | 3300026118 | Bacteria | 2717 |
| 352 | Ga0207675_100133276 | 3300026118 | Bacteria | 2356 |
| 353 | Ga0207675_100440755 | 3300026118 | Bacteria | 1289 |
| 354 | Ga0207683_10001384 | 3300026121 | Bacteria | 21858 |
| 355 | Ga0207683_10025214 | 3300026121 | Bacteria | 5127 |
| 356 | Ga0207683_10041084 | 3300026121 | Bacteria | 4037 |
| 357 | Ga0207683_10082720 | 3300026121 | Bacteria | 2852 |
| 358 | Ga0207698_10000135 | 3300026142 | Bacteria | 46357 |
| 359 | Ga0207698_10018613 | 3300026142 | Bacteria | 4738 |
| 360 | Ga0207698_10041202 | 3300026142 | Bacteria | 3439 |
| 361 | Ga0207698_10062748 | 3300026142 | Bacteria | 2904 |
| 362 | Ga0207698_10258721 | 3300026142 | Bacteria | 1598 |
| 363 | Ga0209995_1001717 | 3300027471 | Bacteria | 3408 |
| 364 | Ga0209983_1008336 | 3300027665 | Bacteria | 2119 |
| 365 | Ga0209974_10003726 | 3300027876 | Bacteria | 5469 |
| 366 | Ga0207428_10001183 | 3300027907 | Bacteria | 28096 |
| 367 | Ga0268266_10053080 | 3300028379 | Bacteria | 3482 |
| 368 | Ga0268266_10116379 | 3300028379 | Bacteria | 2374 |
| 369 | Ga0268266_10268920 | 3300028379 | Bacteria | 1582 |
| 370 | Ga0268266_10303491 | 3300028379 | Bacteria | 1490 |
| 371 | Ga0268265_10002260 | 3300028380 | Bacteria | 14728 |
| 372 | Ga0268265_10072023 | 3300028380 | Bacteria | 2694 |
| 373 | Ga0268265_10139537 | 3300028380 | Bacteria | 2027 |
| 374 | Ga0268265_10265392 | 3300028380 | Bacteria | 1529 |
| 375 | Ga0268265_10338018 | 3300028380 | Bacteria | 1370 |
| 376 | Ga0268264_10001897 | 3300028381 | Bacteria | 18963 |
| 377 | Ga0268264_10016306 | 3300028381 | Bacteria | 6084 |
| 378 | Ga0268264_10033693 | 3300028381 | Bacteria | 4211 |
| 379 | Ga0307515_10001078 | 3300028794 | Bacteria | 62511 |
| 380 | Ga0307515_10001329 | 3300028794 | Bacteria | 56020 |
| 381 | Ga0307515_10190055 | 3300028794 | Bacteria | 1967 |
| 382 | Ga0307515_10333826 | 3300028794 | Bacteria | 1173 |
| 383 | Ga0265338_10117760 | 3300028800 | Bacteria | 2124 |
| 384 | Ga0265325_10009273 | 3300031241 | Bacteria | 5752 |
| 385 | Ga0265339_10000064 | 3300031249 | Bacteria | 92992 |
| 386 | Ga0307513_10155353 | 3300031456 | Bacteria | 2189 |
| 387 | Ga0265313_10000020 | 3300031595 | Bacteria | 145873 |
| 388 | Ga0307514_10000810 | 3300031649 | Bacteria | 50948 |
| 389 | Ga0307516_10000398 | 3300031730 | Bacteria | 56825 |
| 390 | Ga0373930_0002261 | 3300034816 | Bacteria | 2968 |
| 391 | Ga0373930_0010068 | 3300034816 | Bacteria | 1682 |
| 392 | Ga0373950_0005017 | 3300034818 | Bacteria | 1960 |
| 393 | Ga0373929_0002234 | 3300035085 | Bacteria | 3581 |
| 394 | Ga0373949_0009306 | 3300035090 | Bacteria | 2152 |
| 395 | Ga0373951_0007362 | 3300035091 | Bacteria | 2500 |
| 396 | Ga0373923_0032981 | 3300035111 | Bacteria | 2095 |
| 397 | Ga0373932_0002181 | 3300035112 | Bacteria | 5054 |
| 398 | Ga0373936_0024620 | 3300035113 | Bacteria | 2351 |
| 399 | Ga0373939_0003147 | 3300035114 | Bacteria | 3881 |
| 400 | Ga0373945_0008852 | 3300035116 | Bacteria | 3288 |
| 401 | Ga0373945_0071085 | 3300035116 | Bacteria | 1317 |
| 402 | Ga0373943_0001338 | 3300035170 | Bacteria | 11099 |
| 403 | Ga0373946_0001949 | 3300035171 | Bacteria | 7222 |
| 404 | Ga0373955_0020180 | 3300035172 | Bacteria | 3346 |
| 405 | Ga0373942_0030553 | 3300035207 | Bacteria | 1420 |
| 406 | Ga0373942_0078606 | 3300035207 | Bacteria | 975 |
| 407 | Ga0373931_0000219 | 3300035691 | Bacteria | 24390 |
| 408 | Ga0373931_0016561 | 3300035691 | Bacteria | 3631 |
| 409 | Ga0373931_0059134 | 3300035691 | Bacteria | 2061 |
| 410 | Ga0373931_0090972 | 3300035691 | Bacteria | 1700 |
| 411 | Ga0373931_0117627 | 3300035691 | Bacteria | 1515 |
| 412 | Ga0373935_0021907 | 3300035692 | Bacteria | 3913 |
| 413 | Ga0373935_0099756 | 3300035692 | Bacteria | 1912 |
| 414 | Ga0373927_0000243 | 3300035695 | Bacteria | 42834 |
| 415 | Ga0373927_0013298 | 3300035695 | Bacteria | 5472 |
| 416 | Ga0373927_0015370 | 3300035695 | Bacteria | 5058 |
| 417 | Ga0373947_0000613 | 3300035725 | Bacteria | 21037 |
| 418 | Ga0373937_0333981 | 3300036401 | Bacteria | 1435 |
| 419 | Ga0373925_0002340 | 3300037068 | Bacteria | 15243 |
| 420 | Ga0373925_0054752 | 3300037068 | Bacteria | 2984 |
| 421 | Ga0373925_0096138 | 3300037068 | Bacteria | 2270 |
| 422 | Ga0373925_0115963 | 3300037068 | Bacteria | 2074 |
| 423 | Ga0395899_0008464 | 3300037312 | Bacteria | 7926 |
| 424 | Ga0395900_0060255 | 3300037418 | Bacteria | 3906 |
| 425 | Ga0395900_0072373 | 3300037418 | Bacteria | 3544 |
| 426 | Ga0395900_0125803 | 3300037418 | Bacteria | 2629 |
| 427 | Ga0395898_0016461 | 3300037466 | Bacteria | 7567 |
| 428 | Ga0395905_0002866 | 3300037471 | Bacteria | 18828 |
| 429 | Ga0395905_0062752 | 3300037471 | Bacteria | 3475 |
| 430 | Ga0395905_0228468 | 3300037471 | Bacteria | 1740 |
| 431 | Ga0395901_0067500 | 3300038443 | Bacteria | 3724 |
| 432 | Ga0395901_0195006 | 3300038443 | Unclassified | 2124 |
| 433 | Ga0436363_1379029 | 3300039450 | Bacteria | 1417 |
| 434 | Ga0439436_0008426 | 3300041404 | Bacteria | 3169 |
| 435 | Ga0439436_0020543 | 3300041404 | Bacteria | 1966 |
| 436 | Ga0439438_015880 | 3300041405 | Bacteria | 2202 |
| 437 | Ga0439447_012370 | 3300041407 | Bacteria | 2454 |
| 438 | Ga0439447_021533 | 3300041407 | Bacteria | 1697 |
| 439 | Ga0451807_0485629 | 3300041486 | Bacteria | 2144 |
| 440 | Ga0451853_0685456 | 3300041512 | Bacteria | 1691 |
| 441 | Ga0451853_1556115 | 3300041512 | Bacteria | 1726 |
| 442 | Ga0439433_0024380 | 3300041999 | Bacteria | 1362 |
| 443 | Ga0439442_005001 | 3300042002 | Bacteria | 2646 |
| 444 | Ga0439432_004431 | 3300042006 | Bacteria | 5129 |
| 445 | Ga0439449_0006207 | 3300042007 | Bacteria | 4566 |
| 446 | Ga0439449_0020184 | 3300042007 | Bacteria | 2496 |
| 447 | Ga0439450_021813 | 3300042008 | Bacteria | 1378 |
| 448 | Ga0439452_000966 | 3300042010 | Bacteria | 12916 |
| 449 | Ga0450897_002057 | 3300042128 | Bacteria | 1463 |
| 450 | Ga0439446_0000468 | 3300042156 | Bacteria | 7992 |
| 451 | Ga0450909_002696 | 3300042185 | Bacteria | 2520 |
| 452 | Ga0439434_0003711 | 3300042435 | Bacteria | 4468 |
| 453 | Ga0439460_0006330 | 3300042461 | Bacteria | 2933 |
| 454 | Ga0466968_0121105 | 3300044735 | Bacteria | 1184 |
| 455 | Ga0451576_0000326 | 3300045051 | Bacteria | 115294 |
| 456 | Ga0451576_0027529 | 3300045051 | Bacteria | 6104 |
| 457 | Ga0451576_0030696 | 3300045051 | Bacteria | 5740 |
| 458 | Ga0466958_0046506 | 3300045836 | Bacteria | 2619 |
| 459 | Ga0466967_0012686 | 3300045976 | Bacteria | 6466 |
| 460 | Ga0495592_0155941 | 3300046454 | Bacteria | 1575 |
| 461 | Ga0495629_0024150 | 3300046459 | Bacteria | 4329 |
| 462 | Ga0495629_0170093 | 3300046459 | Bacteria | 1512 |
| 463 | Ga0495580_0041874 | 3300046472 | Bacteria | 3264 |
| 464 | Ga0495662_0013109 | 3300046476 | Bacteria | 4037 |
| 465 | Ga0495662_0052314 | 3300046476 | Bacteria | 1971 |
| 466 | Ga0495664_0000473 | 3300046477 | Bacteria | 19941 |
| 467 | Ga0495664_0131124 | 3300046477 | Bacteria | 1518 |
| 468 | Ga0495618_0068172 | 3300046514 | Bacteria | 2262 |
| 469 | Ga0495630_0002253 | 3300046517 | Bacteria | 13430 |
| 470 | Ga0495630_0128784 | 3300046517 | Bacteria | 1921 |
| 471 | Ga0495643_0064099 | 3300046522 | Bacteria | 1942 |
| 472 | Ga0495652_0065783 | 3300046529 | Bacteria | 3045 |
| 473 | Ga0495652_0121797 | 3300046529 | Bacteria | 2078 |
| 474 | Ga0495665_0066777 | 3300046531 | Unclassified | 1897 |
| 475 | Ga0495640_0071586 | 3300046533 | Bacteria | 2326 |
| 476 | Ga0495586_0063207 | 3300046535 | Bacteria | 2016 |
| 477 | Ga0495587_0009425 | 3300046536 | Bacteria | 6258 |
| 478 | Ga0495621_0004590 | 3300046539 | Bacteria | 3901 |
| 479 | Ga0495645_0013255 | 3300046543 | Bacteria | 5826 |
| 480 | Ga0495667_0021767 | 3300046559 | Bacteria | 4325 |
| 481 | Ga0495656_0151071 | 3300046615 | Bacteria | 1122 |
| 482 | Ga0495634_0002152 | 3300046642 | Bacteria | 16576 |
| 483 | Ga0495634_0003099 | 3300046642 | Bacteria | 13511 |
| 484 | Ga0495634_0074386 | 3300046642 | Bacteria | 2232 |
| 485 | Ga0495635_0000375 | 3300046663 | Bacteria | 28276 |
| 486 | Ga0495657_0058695 | 3300046675 | Bacteria | 2554 |
| 487 | Ga0495599_0017511 | 3300046678 | Bacteria | 4454 |
| 488 | Ga0495623_0042262 | 3300046679 | Bacteria | 2904 |
| 489 | Ga0495647_0041418 | 3300046681 | Bacteria | 1754 |
| 490 | Ga0495658_0069550 | 3300046683 | Bacteria | 2041 |
| 491 | Ga0495624_0013647 | 3300046690 | Bacteria | 5534 |
| 492 | Ga0495624_0031067 | 3300046690 | Bacteria | 3476 |
| 493 | Ga0495581_0009688 | 3300047315 | Bacteria | 5576 |
| 494 | Ga0495604_0190945 | 3300047317 | Bacteria | 1427 |
| 495 | Ga0495636_0017371 | 3300047318 | Bacteria | 2880 |
| 496 | Ga0495674_0002065 | 3300047319 | Bacteria | 19693 |
| 497 | Ga0495684_0002177 | 3300047471 | Bacteria | 15689 |
| 498 | Ga0495684_0012832 | 3300047471 | Bacteria | 6466 |
| 499 | Ga0495684_0020663 | 3300047471 | Bacteria | 5073 |
| 500 | Ga0495593_0006727 | 3300047673 | Bacteria | 6730 |
| 501 | Ga0496100_0199232 | 3300048903 | Bacteria | 1458 |
| 502 | Ga0496101_0256982 | 3300048904 | Bacteria | 1362 |
| 503 | Ga0496104_0009568 | 3300048907 | Bacteria | 8628 |
| 504 | Ga0496105_0024505 | 3300048908 | Bacteria | 4903 |
| 505 | Ga0496108_0014657 | 3300048911 | Bacteria | 6400 |
| 506 | Ga0496108_0031269 | 3300048911 | Bacteria | 4416 |
| 507 | Ga0496109_0000996 | 3300048912 | Bacteria | 23382 |
| 508 | Ga0496109_0297687 | 3300048912 | Bacteria | 1521 |
| 509 | Ga0496110_0000396 | 3300048913 | Bacteria | 29470 |
| 510 | Ga0496111_0020711 | 3300048914 | Bacteria | 4583 |
| 511 | Ga0496111_0100667 | 3300048914 | Bacteria | 2123 |
| 512 | Ga0496112_0000240 | 3300048915 | Bacteria | 35240 |
| 513 | Ga0496114_0246678 | 3300048917 | Bacteria | 1571 |
| 514 | Ga0501036_0096587 | 3300049572 | Bacteria | 2498 |
| 515 | Ga0501037_0010018 | 3300049573 | Bacteria | 6952 |
| 516 | Ga0501038_0199990 | 3300049574 | Bacteria | 1604 |
| 517 | Ga0501039_0052069 | 3300049575 | Bacteria | 3168 |
| 518 | Ga0501040_0021383 | 3300049576 | Bacteria | 4320 |
| 519 | Ga0501041_0218703 | 3300049577 | Bacteria | 1195 |
| 520 | Ga0501043_0064707 | 3300049579 | Bacteria | 2872 |
| 521 | Ga0501046_0362199 | 3300049580 | Bacteria | 1051 |
| 522 | Ga0501075_0331119 | 3300049591 | Bacteria | 1160 |
| 523 | Ga0501076_0000731 | 3300049592 | Bacteria | 21260 |
| 524 | Ga0501079_0007561 | 3300049741 | Bacteria | 8225 |
| 525 | Ga0501080_0003285 | 3300049742 | Bacteria | 14289 |
| 526 | Ga0501081_0000115 | 3300049743 | Bacteria | 34620 |
| 527 | nmdc:mga03683_2590_c2 | 3300050489 | Bacteria | 4151 |
| 528 | nmdc:mga03n38_13587_c1 | 3300050490 | Bacteria | 3098 |
| 529 | nmdc:mga00v17_177919_c1 | 3300050491 | Bacteria | 1372 |
| 530 | nmdc:mga0k408_13046_c1 | 3300050493 | Bacteria | 4550 |
| 531 | nmdc:mga0k408_21732_c1 | 3300050493 | Bacteria | 3607 |
| 532 | nmdc:mga0k408_44802_c1 | 3300050493 | Bacteria | 2551 |
| 533 | nmdc:mga06z11_151292_c1 | 3300050494 | Bacteria | 1319 |
| 534 | nmdc:mga07m45_5833_c1 | 3300050496 | Bacteria | 6177 |
| 535 | nmdc:mga0qj67_27643_c1 | 3300050509 | Bacteria | 4398 |
| 536 | nmdc:mga06r32_13036_c1 | 3300050510 | Bacteria | 7522 |
| 537 | nmdc:mga08y16_103198_c1 | 3300050511 | Bacteria | 2969 |
| 538 | nmdc:mga08y16_752_c1 | 3300050511 | Bacteria | 30835 |
| 539 | nmdc:mga0n895_15164_c1 | 3300050512 | Bacteria | 7023 |
| 540 | nmdc:mga0rr50_955_c1 | 3300050513 | Bacteria | 15665 |
| 541 | nmdc:mga0a205_179808_c1 | 3300050515 | Bacteria | 2009 |
| 542 | nmdc:mga0a205_68785_c1 | 3300050515 | Bacteria | 3419 |
| 543 | nmdc:mga0sz30_78107_c1 | 3300050516 | Bacteria | 1430 |
| 544 | Ga0495601_0093158 | 3300053077 | Bacteria | 1940 |
| 545 | Ga0495612_0000652 | 3300053078 | Bacteria | 13953 |
| 546 | Ga0500610_0123732 | 3300053079 | Bacteria | 1320 |
| 547 | Ga0495619_0009712 | 3300053085 | Bacteria | 6066 |
| 548 | Ga0495619_0074994 | 3300053085 | Unclassified | 2269 |
| 549 | Ga0500644_0000485 | 3300053088 | Bacteria | 17515 |
| 550 | Ga0500651_0030627 | 3300053093 | Bacteria | 3386 |
| 551 | Ga0500566_0019839 | 3300053094 | Bacteria | 3947 |
| 552 | Ga0500641_0070089 | 3300053096 | Bacteria | 1474 |
| 553 | Ga0500562_020518 | 3300053108 | Bacteria | 1715 |
| 554 | Ga0500593_000105 | 3300053117 | Bacteria | 32307 |
| 555 | Ga0500593_142099 | 3300053117 | Bacteria | 943 |
| 556 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 557 | Ga0500652_002017 | 3300053131 | Bacteria | 6117 |
| 558 | Ga0500568_0005169 | 3300053139 | Bacteria | 6804 |
| 559 | Ga0500590_001662 | 3300053148 | Bacteria | 9305 |
| 560 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 561 | Ga0500616_0046389 | 3300053153 | Bacteria | 2310 |
| 562 | Ga0500619_000096 | 3300053154 | Bacteria | 23864 |
| 563 | Ga0500645_000078 | 3300053730 | Bacteria | 76931 |
| 564 | Ga0501084_0167016 | 3300054114 | Bacteria | 1857 |
| 565 | Ga0501082_0008698 | 3300060353 | Bacteria | 8756 |
| 566 | Ga0466962_0053207 | 3300061719 | Bacteria | 1935 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005842 | Ga0068858_100345172 | Ga0068858_1003451721 | 275 |
| 2 | 3300026035 | Ga0207703_10297838 | Ga0207703_102978381 | 275 |
| 3 | 3300028381 | Ga0268264_10033693 | Ga0268264_100336932 | 275 |
| 4 | 3300035207 | Ga0373942_0030553 | Ga0373942_0030553_543_1388 | 280 |
| 5 | 3300005331 | Ga0070670_100029278 | Ga0070670_1000292781 | 282 |
| 6 | 3300035113 | Ga0373936_0024620 | Ga0373936_0024620_275_1210 | 287 |
| 7 | 3300035116 | Ga0373945_0008852 | Ga0373945_0008852_1599_2534 | 287 |
| 8 | 3300035170 | Ga0373943_0001338 | Ga0373943_0001338_2454_3389 | 287 |
| 9 | 3300035171 | Ga0373946_0001949 | Ga0373946_0001949_1910_2845 | 287 |
| 10 | 3300035692 | Ga0373935_0021907 | Ga0373935_0021907_1653_2588 | 287 |
| 11 | 3300035695 | Ga0373927_0000243 | Ga0373927_0000243_24363_25298 | 287 |
| 12 | 3300035725 | Ga0373947_0000613 | Ga0373947_0000613_11735_12670 | 287 |
| 13 | 3300037068 | Ga0373925_0002340 | Ga0373925_0002340_2254_3189 | 287 |
| 14 | 3300046459 | Ga0495629_0024150 | Ga0495629_0024150_136_1071 | 287 |
| 15 | 3300046472 | Ga0495580_0041874 | Ga0495580_0041874_1892_2827 | 287 |
| 16 | 3300046476 | Ga0495662_0052314 | Ga0495662_0052314_138_1073 | 287 |
| 17 | 3300046517 | Ga0495630_0002253 | Ga0495630_0002253_7247_8182 | 287 |
| 18 | 3300046533 | Ga0495640_0071586 | Ga0495640_0071586_961_1896 | 287 |
| 19 | 3300046642 | Ga0495634_0074386 | Ga0495634_0074386_580_1515 | 287 |
| 20 | 3300046681 | Ga0495647_0041418 | Ga0495647_0041418_476_1411 | 287 |
| 21 | 3300046690 | Ga0495624_0013647 | Ga0495624_0013647_2480_3415 | 287 |
| 22 | 3300047315 | Ga0495581_0009688 | Ga0495581_0009688_3737_4672 | 287 |
| 23 | 3300047471 | Ga0495684_0002177 | Ga0495684_0002177_5422_6357 | 287 |
| 24 | 3300047673 | Ga0495593_0006727 | Ga0495593_0006727_3337_4272 | 287 |
| 25 | 3300048904 | Ga0496101_0256982 | Ga0496101_0256982_473_1345 | 289 |
| 26 | 3300048917 | Ga0496114_0246678 | Ga0496114_0246678_21_893 | 289 |
| 27 | 3300006852 | Ga0075433_10054907 | Ga0075433_100549073 | 290 |
| 28 | 3300041486 | Ga0451807_0485629 | Ga0451807_0485629_360_1316 | 290 |
| 29 | 3300041512 | Ga0451853_0685456 | Ga0451853_0685456_374_1330 | 290 |
| 30 | 3300050515 | nmdc:mga0a205_68785_c1 | nmdc:mga0a205_68785_c1_1758_2714 | 290 |
| 31 | 3300028379 | Ga0268266_10268920 | Ga0268266_102689202 | 291 |
| 32 | 3300053117 | Ga0500593_142099 | Ga0500593_142099_44_922 | 291 |
| 33 | 3300005329 | Ga0070683_100280767 | Ga0070683_1002807672 | 293 |
| 34 | 3300005353 | Ga0070669_100041925 | Ga0070669_1000419253 | 293 |
| 35 | 3300005354 | Ga0070675_100175869 | Ga0070675_1001758691 | 293 |
| 36 | 3300005355 | Ga0070671_100119494 | Ga0070671_1001194943 | 293 |
| 37 | 3300005356 | Ga0070674_100171049 | Ga0070674_1001710491 | 293 |
| 38 | 3300005367 | Ga0070667_100245849 | Ga0070667_1002458491 | 293 |
| 39 | 3300005456 | Ga0070678_100073303 | Ga0070678_1000733033 | 293 |
| 40 | 3300005844 | Ga0068862_100180781 | Ga0068862_1001807811 | 293 |
| 41 | 3300006881 | Ga0068865_100436918 | Ga0068865_1004369181 | 293 |
| 42 | 3300025899 | Ga0207642_10042146 | Ga0207642_100421462 | 293 |
| 43 | 3300025931 | Ga0207644_10058637 | Ga0207644_100586372 | 293 |
| 44 | 3300025944 | Ga0207661_10234363 | Ga0207661_102343632 | 293 |
| 45 | 3300025960 | Ga0207651_10152611 | Ga0207651_101526112 | 293 |
| 46 | 3300005530 | Ga0070679_100023923 | Ga0070679_1000239232 | 294 |
| 47 | 3300038443 | Ga0395901_0195006 | Ga0395901_0195006_963_1970 | 294 |
| 48 | 3300050493 | nmdc:mga0k408_44802_c1 | nmdc:mga0k408_44802_c1_97_1014 | 294 |
| 49 | 3300005435 | Ga0070714_100261069 | Ga0070714_1002610691 | 295 |
| 50 | 3300005438 | Ga0070701_10011085 | Ga0070701_100110852 | 295 |
| 51 | 3300005719 | Ga0068861_100004429 | Ga0068861_1000044296 | 296 |
| 52 | 3300026067 | Ga0207678_10122250 | Ga0207678_101222502 | 296 |
| 53 | 3300025893 | Ga0207682_10103052 | Ga0207682_101030522 | 297 |
| 54 | 3300005331 | Ga0070670_100371982 | Ga0070670_1003719822 | 298 |
| 55 | 3300005340 | Ga0070689_100032710 | Ga0070689_1000327105 | 298 |
| 56 | 3300005365 | Ga0070688_100018238 | Ga0070688_1000182383 | 298 |
| 57 | 3300005577 | Ga0068857_100032236 | Ga0068857_1000322362 | 298 |
| 58 | 3300013308 | Ga0157375_10048662 | Ga0157375_100486623 | 298 |
| 59 | 3300025901 | Ga0207688_10038310 | Ga0207688_100383102 | 298 |
| 60 | 3300025923 | Ga0207681_10075524 | Ga0207681_100755242 | 298 |
| 61 | 3300025926 | Ga0207659_10042224 | Ga0207659_100422241 | 298 |
| 62 | 3300025942 | Ga0207689_10041096 | Ga0207689_100410964 | 298 |
| 63 | 3300026116 | Ga0207674_10009798 | Ga0207674_1000979812 | 298 |
| 64 | 3300005842 | Ga0068858_100004784 | Ga0068858_1000047846 | 299 |
| 65 | 3300009176 | Ga0105242_10001017 | Ga0105242_1000101710 | 299 |
| 66 | 3300009177 | Ga0105248_10095368 | Ga0105248_100953683 | 299 |
| 67 | 3300009551 | Ga0105238_10070239 | Ga0105238_100702392 | 299 |
| 68 | 3300014968 | Ga0157379_10014302 | Ga0157379_100143022 | 299 |
| 69 | 3300025924 | Ga0207694_10137323 | Ga0207694_101373232 | 299 |
| 70 | 3300025934 | Ga0207686_10002549 | Ga0207686_100025491 | 299 |
| 71 | 3300025941 | Ga0207711_10050737 | Ga0207711_100507373 | 299 |
| 72 | 3300026035 | Ga0207703_10004567 | Ga0207703_1000456710 | 299 |
| 73 | 3300026089 | Ga0207648_10209768 | Ga0207648_102097682 | 299 |
| 74 | 3300028380 | Ga0268265_10265392 | Ga0268265_102653922 | 299 |
| 75 | 3300034816 | Ga0373930_0010068 | Ga0373930_0010068_103_1074 | 299 |
| 76 | 3300035085 | Ga0373929_0002234 | Ga0373929_0002234_179_1150 | 299 |
| 77 | 3300035691 | Ga0373931_0016561 | Ga0373931_0016561_2211_3182 | 299 |
| 78 | 3300045051 | Ga0451576_0000326 | Ga0451576_0000326_12446_13351 | 299 |
| 79 | 3300005441 | Ga0070700_100302532 | Ga0070700_1003025321 | 301 |
| 80 | 3300005617 | Ga0068859_100018280 | Ga0068859_1000182805 | 301 |
| 81 | 3300005842 | Ga0068858_100078513 | Ga0068858_1000785132 | 301 |
| 82 | 3300006931 | Ga0097620_100018280 | Ga0097620_1000182805 | 301 |
| 83 | 3300009553 | Ga0105249_10202557 | Ga0105249_102025572 | 301 |
| 84 | 3300014326 | Ga0157380_10059030 | Ga0157380_100590303 | 301 |
| 85 | 3300025893 | Ga0207682_10095739 | Ga0207682_100957392 | 301 |
| 86 | 3300025924 | Ga0207694_10114919 | Ga0207694_101149194 | 301 |
| 87 | 3300026035 | Ga0207703_10114252 | Ga0207703_101142522 | 301 |
| 88 | 3300005719 | Ga0068861_100356137 | Ga0068861_1003561372 | 302 |
| 89 | 3300006175 | Ga0070712_100114065 | Ga0070712_1001140652 | 302 |
| 90 | 3300025915 | Ga0207693_10002296 | Ga0207693_1000229617 | 302 |
| 91 | 3300026142 | Ga0207698_10062748 | Ga0207698_100627482 | 302 |
| 92 | 3300005456 | Ga0070678_100141993 | Ga0070678_1001419932 | 303 |
| 93 | 3300005459 | Ga0068867_100016771 | Ga0068867_1000167714 | 303 |
| 94 | 3300005843 | Ga0068860_100379177 | Ga0068860_1003791771 | 303 |
| 95 | 3300006237 | Ga0097621_100156113 | Ga0097621_1001561132 | 303 |
| 96 | 3300006881 | Ga0068865_100180687 | Ga0068865_1001806872 | 303 |
| 97 | 3300009176 | Ga0105242_10124752 | Ga0105242_101247521 | 303 |
| 98 | 3300017792 | Ga0163161_10061439 | Ga0163161_100614394 | 303 |
| 99 | 3300025934 | Ga0207686_10061029 | Ga0207686_100610294 | 303 |
| 100 | 3300025937 | Ga0207669_10013095 | Ga0207669_100130954 | 303 |
| 101 | 3300025986 | Ga0207658_10106479 | Ga0207658_101064794 | 303 |
| 102 | 3300026089 | Ga0207648_10006920 | Ga0207648_100069204 | 303 |
| 103 | 3300026121 | Ga0207683_10025214 | Ga0207683_100252142 | 303 |
| 104 | 3300037418 | Ga0395900_0125803 | Ga0395900_0125803_535_1464 | 303 |
| 105 | 3300005617 | Ga0068859_100363258 | Ga0068859_1003632582 | 304 |
| 106 | 3300006358 | Ga0068871_100365659 | Ga0068871_1003656592 | 304 |
| 107 | 3300006931 | Ga0097620_100363303 | Ga0097620_1003633032 | 304 |
| 108 | 3300009553 | Ga0105249_10306750 | Ga0105249_103067501 | 304 |
| 109 | 3300053153 | Ga0500616_0046389 | Ga0500616_0046389_206_1174 | 304 |
| 110 | 3300005366 | Ga0070659_100315456 | Ga0070659_1003154561 | 305 |
| 111 | 3300009094 | Ga0111539_10530474 | Ga0111539_105304742 | 305 |
| 112 | 3300014326 | Ga0157380_10096950 | Ga0157380_100969503 | 305 |
| 113 | 3300034818 | Ga0373950_0005017 | Ga0373950_0005017_950_1876 | 305 |
| 114 | 3300035090 | Ga0373949_0009306 | Ga0373949_0009306_1156_2082 | 305 |
| 115 | 3300035091 | Ga0373951_0007362 | Ga0373951_0007362_1533_2459 | 305 |
| 116 | 3300035112 | Ga0373932_0002181 | Ga0373932_0002181_3077_4003 | 305 |
| 117 | 3300035114 | Ga0373939_0003147 | Ga0373939_0003147_681_1607 | 305 |
| 118 | 3300035172 | Ga0373955_0020180 | Ga0373955_0020180_61_1017 | 305 |
| 119 | 3300035207 | Ga0373942_0078606 | Ga0373942_0078606_18_944 | 305 |
| 120 | 3300035691 | Ga0373931_0000219 | Ga0373931_0000219_14593_15519 | 305 |
| 121 | 3300045051 | Ga0451576_0027529 | Ga0451576_0027529_4561_5487 | 305 |
| 122 | 3300045051 | Ga0451576_0030696 | Ga0451576_0030696_553_1479 | 305 |
| 123 | 3300046454 | Ga0495592_0155941 | Ga0495592_0155941_381_1337 | 305 |
| 124 | 3300046477 | Ga0495664_0131124 | Ga0495664_0131124_515_1471 | 305 |
| 125 | 3300046529 | Ga0495652_0121797 | Ga0495652_0121797_859_1815 | 305 |
| 126 | 3300046536 | Ga0495587_0009425 | Ga0495587_0009425_2492_3448 | 305 |
| 127 | 3300046559 | Ga0495667_0021767 | Ga0495667_0021767_1406_2362 | 305 |
| 128 | 3300046675 | Ga0495657_0058695 | Ga0495657_0058695_1200_2156 | 305 |
| 129 | 3300046678 | Ga0495599_0017511 | Ga0495599_0017511_2041_2997 | 305 |
| 130 | 3300046679 | Ga0495623_0042262 | Ga0495623_0042262_577_1533 | 305 |
| 131 | 3300047317 | Ga0495604_0190945 | Ga0495604_0190945_344_1300 | 305 |
| 132 | iso_pu_bacteria | 2926754445 | 2926760124 | 305 |
| 133 | 3300039450 | Ga0436363_1379029 | Ga0436363_1379029_31_1026 | 306 |
| 134 | iso_pu_bacteria | 2894232714 | 2894238115 | 306 |
| 135 | 3300005331 | Ga0070670_100263249 | Ga0070670_1002632492 | 308 |
| 136 | 3300005335 | Ga0070666_10179699 | Ga0070666_101796991 | 308 |
| 137 | 3300005338 | Ga0068868_100323962 | Ga0068868_1003239622 | 308 |
| 138 | 3300005344 | Ga0070661_100272912 | Ga0070661_1002729121 | 308 |
| 139 | 3300005364 | Ga0070673_100078227 | Ga0070673_1000782273 | 308 |
| 140 | 3300005365 | Ga0070688_100140427 | Ga0070688_1001404271 | 308 |
| 141 | 3300005543 | Ga0070672_100207665 | Ga0070672_1002076651 | 308 |
| 142 | 3300005615 | Ga0070702_100202335 | Ga0070702_1002023352 | 308 |
| 143 | 3300005618 | Ga0068864_100212908 | Ga0068864_1002129081 | 308 |
| 144 | 3300005718 | Ga0068866_10082629 | Ga0068866_100826292 | 308 |
| 145 | 3300005841 | Ga0068863_100193985 | Ga0068863_1001939851 | 308 |
| 146 | 3300005842 | Ga0068858_100373794 | Ga0068858_1003737941 | 308 |
| 147 | 3300005843 | Ga0068860_100417519 | Ga0068860_1004175191 | 308 |
| 148 | 3300006358 | Ga0068871_100145647 | Ga0068871_1001456472 | 308 |
| 149 | 3300009094 | Ga0111539_10738483 | Ga0111539_107384831 | 308 |
| 150 | 3300009098 | Ga0105245_10315345 | Ga0105245_103153452 | 308 |
| 151 | 3300009148 | Ga0105243_10162006 | Ga0105243_101620062 | 308 |
| 152 | 3300009176 | Ga0105242_10215605 | Ga0105242_102156052 | 308 |
| 153 | 3300009177 | Ga0105248_10063971 | Ga0105248_100639714 | 308 |
| 154 | 3300009553 | Ga0105249_10250572 | Ga0105249_102505721 | 308 |
| 155 | 3300013297 | Ga0157378_10333690 | Ga0157378_103336901 | 308 |
| 156 | 3300013306 | Ga0163162_10164463 | Ga0163162_101644632 | 308 |
| 157 | 3300013308 | Ga0157375_10809002 | Ga0157375_108090021 | 308 |
| 158 | 3300014325 | Ga0163163_10041003 | Ga0163163_100410034 | 308 |
| 159 | 3300014326 | Ga0157380_10488867 | Ga0157380_104888672 | 308 |
| 160 | 3300014745 | Ga0157377_10094913 | Ga0157377_100949132 | 308 |
| 161 | 3300014968 | Ga0157379_10176331 | Ga0157379_101763311 | 308 |
| 162 | 3300014969 | Ga0157376_10093792 | Ga0157376_100937922 | 308 |
| 163 | 3300017792 | Ga0163161_10264596 | Ga0163161_102645962 | 308 |
| 164 | 3300025923 | Ga0207681_10087612 | Ga0207681_100876122 | 308 |
| 165 | 3300025927 | Ga0207687_10401561 | Ga0207687_104015611 | 308 |
| 166 | 3300025936 | Ga0207670_10291573 | Ga0207670_102915731 | 308 |
| 167 | 3300025938 | Ga0207704_10110312 | Ga0207704_101103122 | 308 |
| 168 | 3300025940 | Ga0207691_10073763 | Ga0207691_100737632 | 308 |
| 169 | 3300026089 | Ga0207648_10098095 | Ga0207648_100980952 | 308 |
| 170 | 3300026095 | Ga0207676_10264522 | Ga0207676_102645221 | 308 |
| 171 | 3300026118 | Ga0207675_100133276 | Ga0207675_1001332762 | 308 |
| 172 | 3300026121 | Ga0207683_10041084 | Ga0207683_100410841 | 308 |
| 173 | 3300027471 | Ga0209995_1001717 | Ga0209995_10017172 | 308 |
| 174 | 3300027665 | Ga0209983_1008336 | Ga0209983_10083362 | 308 |
| 175 | 3300027876 | Ga0209974_10003726 | Ga0209974_100037265 | 308 |
| 176 | 3300028380 | Ga0268265_10338018 | Ga0268265_103380182 | 308 |
| 177 | 3300035691 | Ga0373931_0090972 | Ga0373931_0090972_708_1664 | 308 |
| 178 | 3300050511 | nmdc:mga08y16_103198_c1 | nmdc:mga08y16_103198_c1_139_1104 | 308 |
| 179 | 3300006871 | Ga0075434_100000073 | Ga0075434_10000007360 | 312 |
| 180 | 3300007076 | Ga0075435_100028335 | Ga0075435_1000283353 | 312 |
| 181 | 3300035116 | Ga0373945_0071085 | Ga0373945_0071085_152_1147 | 312 |
| 182 | 3300035695 | Ga0373927_0013298 | Ga0373927_0013298_1384_2379 | 312 |
| 183 | 3300037068 | Ga0373925_0054752 | Ga0373925_0054752_1374_2369 | 312 |
| 184 | 3300046459 | Ga0495629_0170093 | Ga0495629_0170093_153_1148 | 312 |
| 185 | 3300046476 | Ga0495662_0013109 | Ga0495662_0013109_1786_2781 | 312 |
| 186 | 3300046477 | Ga0495664_0000473 | Ga0495664_0000473_7439_8434 | 312 |
| 187 | 3300046514 | Ga0495618_0068172 | Ga0495618_0068172_765_1760 | 312 |
| 188 | 3300046517 | Ga0495630_0128784 | Ga0495630_0128784_76_1071 | 312 |
| 189 | 3300046529 | Ga0495652_0065783 | Ga0495652_0065783_1320_2315 | 312 |
| 190 | 3300046535 | Ga0495586_0063207 | Ga0495586_0063207_422_1417 | 312 |
| 191 | 3300046543 | Ga0495645_0013255 | Ga0495645_0013255_222_1217 | 312 |
| 192 | 3300046642 | Ga0495634_0003099 | Ga0495634_0003099_7056_8051 | 312 |
| 193 | 3300046663 | Ga0495635_0000375 | Ga0495635_0000375_2243_3238 | 312 |
| 194 | 3300046690 | Ga0495624_0031067 | Ga0495624_0031067_603_1598 | 312 |
| 195 | 3300047319 | Ga0495674_0002065 | Ga0495674_0002065_324_1319 | 312 |
| 196 | 3300047471 | Ga0495684_0012832 | Ga0495684_0012832_4919_5914 | 312 |
| 197 | 3300049742 | Ga0501080_0003285 | Ga0501080_0003285_10820_11776 | 312 |
| 198 | 3300050512 | nmdc:mga0n895_15164_c1 | nmdc:mga0n895_15164_c1_1271_2227 | 312 |
| 199 | 3300050513 | nmdc:mga0rr50_955_c1 | nmdc:mga0rr50_955_c1_8311_9267 | 312 |
| 200 | 3300050515 | nmdc:mga0a205_179808_c1 | nmdc:mga0a205_179808_c1_1031_1987 | 312 |
| 201 | 3300053077 | Ga0495601_0093158 | Ga0495601_0093158_746_1741 | 312 |
| 202 | 3300053078 | Ga0495612_0000652 | Ga0495612_0000652_4384_5379 | 312 |
| 203 | 3300053079 | Ga0500610_0123732 | Ga0500610_0123732_115_1119 | 312 |
| 204 | 3300053085 | Ga0495619_0009712 | Ga0495619_0009712_3337_4332 | 312 |
| 205 | 3300005458 | Ga0070681_10039992 | Ga0070681_100399923 | 313 |
| 206 | 3300006173 | Ga0070716_100066260 | Ga0070716_1000662602 | 313 |
| 207 | 3300006195 | Ga0075366_10004370 | Ga0075366_100043701 | 313 |
| 208 | 3300009093 | Ga0105240_10116687 | Ga0105240_101166872 | 313 |
| 209 | 3300009094 | Ga0111539_10000288 | Ga0111539_1000028820 | 313 |
| 210 | 3300025912 | Ga0207707_10114125 | Ga0207707_101141251 | 313 |
| 211 | 3300025929 | Ga0207664_10091168 | Ga0207664_100911683 | 313 |
| 212 | 3300025986 | Ga0207658_10112737 | Ga0207658_101127372 | 313 |
| 213 | 3300028800 | Ga0265338_10117760 | Ga0265338_101177602 | 313 |
| 214 | 3300031241 | Ga0265325_10009273 | Ga0265325_100092732 | 313 |
| 215 | 3300031249 | Ga0265339_10000064 | Ga0265339_1000006479 | 313 |
| 216 | 3300031595 | Ga0265313_10000020 | Ga0265313_1000002062 | 313 |
| 217 | 3300035691 | Ga0373931_0117627 | Ga0373931_0117627_498_1445 | 313 |
| 218 | 3300045976 | Ga0466967_0012686 | Ga0466967_0012686_5040_5999 | 313 |
| 219 | 3300050494 | nmdc:mga06z11_151292_c1 | nmdc:mga06z11_151292_c1_323_1264 | 313 |
| 220 | 3300050511 | nmdc:mga08y16_752_c1 | nmdc:mga08y16_752_c1_13115_14065 | 313 |
| 221 | 3300053131 | Ga0500652_002017 | Ga0500652_002017_150_1115 | 313 |
| 222 | 3300053730 | Ga0500645_000078 | Ga0500645_000078_8024_8989 | 313 |
| 223 | 3300005344 | Ga0070661_100217906 | Ga0070661_1002179062 | 314 |
| 224 | 3300005435 | Ga0070714_100408266 | Ga0070714_1004082662 | 314 |
| 225 | 3300005530 | Ga0070679_100250482 | Ga0070679_1002504821 | 314 |
| 226 | 3300005563 | Ga0068855_100125900 | Ga0068855_1001259005 | 314 |
| 227 | 3300005577 | Ga0068857_100395650 | Ga0068857_1003956502 | 314 |
| 228 | 3300005614 | Ga0068856_100448281 | Ga0068856_1004482812 | 314 |
| 229 | 3300005616 | Ga0068852_100000654 | Ga0068852_10000065414 | 314 |
| 230 | 3300009093 | Ga0105240_10033241 | Ga0105240_100332416 | 314 |
| 231 | 3300009551 | Ga0105238_10061117 | Ga0105238_100611173 | 314 |
| 232 | 3300013102 | Ga0157371_10116250 | Ga0157371_101162502 | 314 |
| 233 | 3300013105 | Ga0157369_10002100 | Ga0157369_100021005 | 314 |
| 234 | 3300013307 | Ga0157372_10019363 | Ga0157372_100193636 | 314 |
| 235 | 3300025913 | Ga0207695_10401103 | Ga0207695_104011032 | 314 |
| 236 | 3300025920 | Ga0207649_10190348 | Ga0207649_101903482 | 314 |
| 237 | 3300025921 | Ga0207652_10453835 | Ga0207652_104538351 | 314 |
| 238 | 3300025929 | Ga0207664_10131007 | Ga0207664_101310073 | 314 |
| 239 | 3300026142 | Ga0207698_10041202 | Ga0207698_100412022 | 314 |
| 240 | 3300005295 | Ga0065707_10083489 | Ga0065707_100834897 | 315 |
| 241 | 3300005330 | Ga0070690_100005081 | Ga0070690_1000050818 | 315 |
| 242 | 3300005334 | Ga0068869_100001859 | Ga0068869_10000185917 | 315 |
| 243 | 3300005336 | Ga0070680_100092263 | Ga0070680_1000922632 | 315 |
| 244 | 3300005337 | Ga0070682_100034514 | Ga0070682_1000345141 | 315 |
| 245 | 3300005338 | Ga0068868_100012111 | Ga0068868_1000121112 | 315 |
| 246 | 3300005340 | Ga0070689_100000939 | Ga0070689_1000009392 | 315 |
| 247 | 3300005343 | Ga0070687_100000199 | Ga0070687_1000001992 | 315 |
| 248 | 3300005353 | Ga0070669_100306416 | Ga0070669_1003064161 | 315 |
| 249 | 3300005440 | Ga0070705_100003046 | Ga0070705_1000030467 | 315 |
| 250 | 3300005441 | Ga0070700_100021308 | Ga0070700_1000213082 | 315 |
| 251 | 3300005458 | Ga0070681_10167301 | Ga0070681_101673012 | 315 |
| 252 | 3300005459 | Ga0068867_100000824 | Ga0068867_1000008242 | 315 |
| 253 | 3300005530 | Ga0070679_100009445 | Ga0070679_10000944513 | 315 |
| 254 | 3300005544 | Ga0070686_100011913 | Ga0070686_1000119132 | 315 |
| 255 | 3300005545 | Ga0070695_100000728 | Ga0070695_1000007283 | 315 |
| 256 | 3300005546 | Ga0070696_100006658 | Ga0070696_1000066584 | 315 |
| 257 | 3300005547 | Ga0070693_100000072 | Ga0070693_10000007223 | 315 |
| 258 | 3300005549 | Ga0070704_100003550 | Ga0070704_1000035504 | 315 |
| 259 | 3300005563 | Ga0068855_100011949 | Ga0068855_10001194913 | 315 |
| 260 | 3300005578 | Ga0068854_100032767 | Ga0068854_1000327673 | 315 |
| 261 | 3300005614 | Ga0068856_100059045 | Ga0068856_1000590453 | 315 |
| 262 | 3300005615 | Ga0070702_100000084 | Ga0070702_10000008417 | 315 |
| 263 | 3300005616 | Ga0068852_100034748 | Ga0068852_1000347484 | 315 |
| 264 | 3300005617 | Ga0068859_100005387 | Ga0068859_1000053874 | 315 |
| 265 | 3300005718 | Ga0068866_10002137 | Ga0068866_100021377 | 315 |
| 266 | 3300005842 | Ga0068858_100105678 | Ga0068858_1001056781 | 315 |
| 267 | 3300005843 | Ga0068860_100017811 | Ga0068860_1000178118 | 315 |
| 268 | 3300005844 | Ga0068862_100009057 | Ga0068862_1000090577 | 315 |
| 269 | 3300006237 | Ga0097621_100000794 | Ga0097621_10000079414 | 315 |
| 270 | 3300006358 | Ga0068871_100040416 | Ga0068871_1000404163 | 315 |
| 271 | 3300006844 | Ga0075428_100015214 | Ga0075428_1000152146 | 315 |
| 272 | 3300006881 | Ga0068865_100008183 | Ga0068865_1000081831 | 315 |
| 273 | 3300006931 | Ga0097620_100005387 | Ga0097620_1000053874 | 315 |
| 274 | 3300009092 | Ga0105250_10045733 | Ga0105250_100457332 | 315 |
| 275 | 3300009098 | Ga0105245_10001603 | Ga0105245_100016032 | 315 |
| 276 | 3300009148 | Ga0105243_10001817 | Ga0105243_1000181723 | 315 |
| 277 | 3300009176 | Ga0105242_10003543 | Ga0105242_100035436 | 315 |
| 278 | 3300010375 | Ga0105239_10028862 | Ga0105239_100288627 | 315 |
| 279 | 3300014326 | Ga0157380_10055946 | Ga0157380_100559463 | 315 |
| 280 | 3300025893 | Ga0207682_10069293 | Ga0207682_100692932 | 315 |
| 281 | 3300025899 | Ga0207642_10000462 | Ga0207642_1000046213 | 315 |
| 282 | 3300025904 | Ga0207647_10139997 | Ga0207647_101399971 | 315 |
| 283 | 3300025912 | Ga0207707_10157789 | Ga0207707_101577892 | 315 |
| 284 | 3300025917 | Ga0207660_10002278 | Ga0207660_1000227813 | 315 |
| 285 | 3300025918 | Ga0207662_10015491 | Ga0207662_100154912 | 315 |
| 286 | 3300025921 | Ga0207652_10031211 | Ga0207652_100312114 | 315 |
| 287 | 3300025923 | Ga0207681_10184165 | Ga0207681_101841652 | 315 |
| 288 | 3300025934 | Ga0207686_10005522 | Ga0207686_100055222 | 315 |
| 289 | 3300025936 | Ga0207670_10011269 | Ga0207670_100112693 | 315 |
| 290 | 3300025938 | Ga0207704_10001219 | Ga0207704_100012192 | 315 |
| 291 | 3300025942 | Ga0207689_10002203 | Ga0207689_100022031 | 315 |
| 292 | 3300025961 | Ga0207712_10047904 | Ga0207712_100479043 | 315 |
| 293 | 3300026041 | Ga0207639_10029204 | Ga0207639_100292042 | 315 |
| 294 | 3300026075 | Ga0207708_10000164 | Ga0207708_1000016434 | 315 |
| 295 | 3300026089 | Ga0207648_10002874 | Ga0207648_1000287423 | 315 |
| 296 | 3300026118 | Ga0207675_100001661 | Ga0207675_1000016614 | 315 |
| 297 | 3300026142 | Ga0207698_10018613 | Ga0207698_100186134 | 315 |
| 298 | 3300027907 | Ga0207428_10001183 | Ga0207428_100011833 | 315 |
| 299 | 3300028380 | Ga0268265_10002260 | Ga0268265_100022602 | 315 |
| 300 | 3300028381 | Ga0268264_10001897 | Ga0268264_1000189723 | 315 |
| 301 | 3300034816 | Ga0373930_0002261 | Ga0373930_0002261_1919_2884 | 315 |
| 302 | 3300035691 | Ga0373931_0059134 | Ga0373931_0059134_598_1563 | 315 |
| 303 | 3300005617 | Ga0068859_100119947 | Ga0068859_1001199473 | 316 |
| 304 | 3300005842 | Ga0068858_100064072 | Ga0068858_1000640722 | 316 |
| 305 | 3300006237 | Ga0097621_100037041 | Ga0097621_1000370413 | 316 |
| 306 | 3300006358 | Ga0068871_100037263 | Ga0068871_1000372632 | 316 |
| 307 | 3300006931 | Ga0097620_100119945 | Ga0097620_1001199452 | 316 |
| 308 | 3300009148 | Ga0105243_10345805 | Ga0105243_103458052 | 316 |
| 309 | 3300009177 | Ga0105248_10442281 | Ga0105248_104422812 | 316 |
| 310 | 3300013296 | Ga0157374_10064400 | Ga0157374_100644004 | 316 |
| 311 | 3300025905 | Ga0207685_10038767 | Ga0207685_100387671 | 316 |
| 312 | 3300025927 | Ga0207687_10022407 | Ga0207687_100224073 | 316 |
| 313 | 3300025934 | Ga0207686_10081165 | Ga0207686_100811652 | 316 |
| 314 | 3300006186 | Ga0075369_10049988 | Ga0075369_100499881 | 317 |
| 315 | 3300013306 | Ga0163162_10155654 | Ga0163162_101556542 | 317 |
| 316 | 3300014969 | Ga0157376_10181537 | Ga0157376_101815372 | 317 |
| 317 | 3300026118 | Ga0207675_100440755 | Ga0207675_1004407552 | 317 |
| 318 | 3300028794 | Ga0307515_10190055 | Ga0307515_101900552 | 317 |
| 319 | 3300050516 | nmdc:mga0sz30_78107_c1 | nmdc:mga0sz30_78107_c1_311_1273 | 317 |
| 320 | 3300053108 | Ga0500562_020518 | Ga0500562_020518_723_1688 | 317 |
| 321 | iso_pu_bacteria | 2841911363 | 2841914553 | 317 |
| 322 | iso_pu_bacteria | 2841917233 | 2841920282 | 317 |
| 323 | 3300005843 | Ga0068860_100049428 | Ga0068860_1000494282 | 318 |
| 324 | 3300006846 | Ga0075430_100031263 | Ga0075430_1000312633 | 318 |
| 325 | 3300006847 | Ga0075431_100004522 | Ga0075431_1000045222 | 318 |
| 326 | 3300006914 | Ga0075436_100232184 | Ga0075436_1002321842 | 318 |
| 327 | 3300044735 | Ga0466968_0121105 | Ga0466968_0121105_89_1066 | 318 |
| 328 | 3300047318 | Ga0495636_0017371 | Ga0495636_0017371_142_1119 | 318 |
| 329 | 3300025933 | Ga0207706_10160664 | Ga0207706_101606642 | 319 |
| 330 | 3300025944 | Ga0207661_10114188 | Ga0207661_101141885 | 319 |
| 331 | 3300035111 | Ga0373923_0032981 | Ga0373923_0032981_518_1492 | 319 |
| 332 | 3300035692 | Ga0373935_0099756 | Ga0373935_0099756_189_1163 | 319 |
| 333 | 3300035695 | Ga0373927_0015370 | Ga0373927_0015370_3631_4605 | 319 |
| 334 | 3300036401 | Ga0373937_0333981 | Ga0373937_0333981_125_1099 | 319 |
| 335 | 3300037068 | Ga0373925_0096138 | Ga0373925_0096138_1094_2059 | 319 |
| 336 | 3300037068 | Ga0373925_0115963 | Ga0373925_0115963_123_1097 | 319 |
| 337 | 3300037471 | Ga0395905_0002866 | Ga0395905_0002866_17767_18732 | 319 |
| 338 | 3300046683 | Ga0495658_0069550 | Ga0495658_0069550_525_1490 | 319 |
| 339 | 3300048907 | Ga0496104_0009568 | Ga0496104_0009568_2428_3393 | 319 |
| 340 | 3300048908 | Ga0496105_0024505 | Ga0496105_0024505_1759_2724 | 319 |
| 341 | 3300053148 | Ga0500590_001662 | Ga0500590_001662_2441_3409 | 319 |
| 342 | 3300053154 | Ga0500619_000096 | Ga0500619_000096_1780_2748 | 319 |
| 343 | 3300005328 | Ga0070676_10036355 | Ga0070676_100363551 | 320 |
| 344 | 3300005328 | Ga0070676_10185380 | Ga0070676_101853802 | 320 |
| 345 | 3300005329 | Ga0070683_100000347 | Ga0070683_10000034726 | 320 |
| 346 | 3300005331 | Ga0070670_100000309 | Ga0070670_10000030916 | 320 |
| 347 | 3300005331 | Ga0070670_100199003 | Ga0070670_1001990032 | 320 |
| 348 | 3300005333 | Ga0070677_10004019 | Ga0070677_100040192 | 320 |
| 349 | 3300005333 | Ga0070677_10054342 | Ga0070677_100543421 | 320 |
| 350 | 3300005334 | Ga0068869_100045994 | Ga0068869_1000459942 | 320 |
| 351 | 3300005335 | Ga0070666_10002081 | Ga0070666_1000208112 | 320 |
| 352 | 3300005338 | Ga0068868_100000930 | Ga0068868_1000009305 | 320 |
| 353 | 3300005338 | Ga0068868_100005400 | Ga0068868_1000054002 | 320 |
| 354 | 3300005344 | Ga0070661_100001422 | Ga0070661_1000014224 | 320 |
| 355 | 3300005347 | Ga0070668_100063383 | Ga0070668_1000633833 | 320 |
| 356 | 3300005354 | Ga0070675_100000049 | Ga0070675_10000004956 | 320 |
| 357 | 3300005354 | Ga0070675_100000926 | Ga0070675_10000092616 | 320 |
| 358 | 3300005355 | Ga0070671_100000137 | Ga0070671_10000013726 | 320 |
| 359 | 3300005364 | Ga0070673_100000394 | Ga0070673_1000003949 | 320 |
| 360 | 3300005366 | Ga0070659_100062258 | Ga0070659_1000622583 | 320 |
| 361 | 3300005367 | Ga0070667_100013715 | Ga0070667_1000137156 | 320 |
| 362 | 3300005367 | Ga0070667_100175560 | Ga0070667_1001755602 | 320 |
| 363 | 3300005444 | Ga0070694_100095420 | Ga0070694_1000954202 | 320 |
| 364 | 3300005456 | Ga0070678_100000771 | Ga0070678_10000077114 | 320 |
| 365 | 3300005457 | Ga0070662_100056003 | Ga0070662_1000560033 | 320 |
| 366 | 3300005457 | Ga0070662_100131172 | Ga0070662_1001311722 | 320 |
| 367 | 3300005459 | Ga0068867_100004978 | Ga0068867_1000049784 | 320 |
| 368 | 3300005466 | Ga0070685_10026991 | Ga0070685_100269913 | 320 |
| 369 | 3300005535 | Ga0070684_100089855 | Ga0070684_1000898553 | 320 |
| 370 | 3300005547 | Ga0070693_100108500 | Ga0070693_1001085002 | 320 |
| 371 | 3300005548 | Ga0070665_100069685 | Ga0070665_1000696852 | 320 |
| 372 | 3300005548 | Ga0070665_100308262 | Ga0070665_1003082622 | 320 |
| 373 | 3300005564 | Ga0070664_100000054 | Ga0070664_10000005424 | 320 |
| 374 | 3300005578 | Ga0068854_100000714 | Ga0068854_10000071414 | 320 |
| 375 | 3300005616 | Ga0068852_100000065 | Ga0068852_10000006526 | 320 |
| 376 | 3300005618 | Ga0068864_100001420 | Ga0068864_10000142016 | 320 |
| 377 | 3300005618 | Ga0068864_100003720 | Ga0068864_1000037204 | 320 |
| 378 | 3300005719 | Ga0068861_100050276 | Ga0068861_1000502763 | 320 |
| 379 | 3300005834 | Ga0068851_10001105 | Ga0068851_100011055 | 320 |
| 380 | 3300005841 | Ga0068863_100024030 | Ga0068863_1000240306 | 320 |
| 381 | 3300005841 | Ga0068863_100087722 | Ga0068863_1000877223 | 320 |
| 382 | 3300005842 | Ga0068858_100001292 | Ga0068858_10000129216 | 320 |
| 383 | 3300005843 | Ga0068860_100133462 | Ga0068860_1001334623 | 320 |
| 384 | 3300005844 | Ga0068862_100149038 | Ga0068862_1001490382 | 320 |
| 385 | 3300006051 | Ga0075364_10017505 | Ga0075364_100175055 | 320 |
| 386 | 3300006237 | Ga0097621_100000051 | Ga0097621_10000005156 | 320 |
| 387 | 3300006237 | Ga0097621_100072303 | Ga0097621_1000723033 | 320 |
| 388 | 3300006358 | Ga0068871_100001133 | Ga0068871_1000011334 | 320 |
| 389 | 3300006881 | Ga0068865_100054894 | Ga0068865_1000548944 | 320 |
| 390 | 3300009177 | Ga0105248_10142497 | Ga0105248_101424973 | 320 |
| 391 | 3300009177 | Ga0105248_10170421 | Ga0105248_101704213 | 320 |
| 392 | 3300013296 | Ga0157374_10343763 | Ga0157374_103437633 | 320 |
| 393 | 3300014325 | Ga0163163_10002538 | Ga0163163_1000253812 | 320 |
| 394 | 3300014968 | Ga0157379_10078851 | Ga0157379_100788513 | 320 |
| 395 | 3300014969 | Ga0157376_10021252 | Ga0157376_100212522 | 320 |
| 396 | 3300017792 | Ga0163161_10130729 | Ga0163161_101307292 | 320 |
| 397 | 3300025321 | Ga0207656_10002656 | Ga0207656_100026565 | 320 |
| 398 | 3300025903 | Ga0207680_10022089 | Ga0207680_100220894 | 320 |
| 399 | 3300025920 | Ga0207649_10002872 | Ga0207649_100028724 | 320 |
| 400 | 3300025923 | Ga0207681_10027388 | Ga0207681_100273882 | 320 |
| 401 | 3300025925 | Ga0207650_10000339 | Ga0207650_1000033921 | 320 |
| 402 | 3300025926 | Ga0207659_10001257 | Ga0207659_100012572 | 320 |
| 403 | 3300025931 | Ga0207644_10001499 | Ga0207644_100014996 | 320 |
| 404 | 3300025933 | Ga0207706_10268642 | Ga0207706_102686421 | 320 |
| 405 | 3300025936 | Ga0207670_10012105 | Ga0207670_100121053 | 320 |
| 406 | 3300025938 | Ga0207704_10037862 | Ga0207704_100378622 | 320 |
| 407 | 3300025940 | Ga0207691_10000147 | Ga0207691_1000014733 | 320 |
| 408 | 3300025940 | Ga0207691_10084386 | Ga0207691_100843862 | 320 |
| 409 | 3300025940 | Ga0207691_10167488 | Ga0207691_101674882 | 320 |
| 410 | 3300025941 | Ga0207711_10089291 | Ga0207711_100892912 | 320 |
| 411 | 3300025941 | Ga0207711_10351868 | Ga0207711_103518681 | 320 |
| 412 | 3300025942 | Ga0207689_10102265 | Ga0207689_101022653 | 320 |
| 413 | 3300025944 | Ga0207661_10001065 | Ga0207661_1000106517 | 320 |
| 414 | 3300025945 | Ga0207679_10000307 | Ga0207679_1000030724 | 320 |
| 415 | 3300025960 | Ga0207651_10000364 | Ga0207651_100003643 | 320 |
| 416 | 3300025960 | Ga0207651_10002644 | Ga0207651_100026445 | 320 |
| 417 | 3300025960 | Ga0207651_10390920 | Ga0207651_103909202 | 320 |
| 418 | 3300025972 | Ga0207668_10012084 | Ga0207668_100120844 | 320 |
| 419 | 3300025981 | Ga0207640_10000771 | Ga0207640_1000077110 | 320 |
| 420 | 3300025986 | Ga0207658_10002924 | Ga0207658_1000292410 | 320 |
| 421 | 3300025986 | Ga0207658_10009514 | Ga0207658_100095146 | 320 |
| 422 | 3300026023 | Ga0207677_10000130 | Ga0207677_1000013024 | 320 |
| 423 | 3300026023 | Ga0207677_10011733 | Ga0207677_100117331 | 320 |
| 424 | 3300026035 | Ga0207703_10001647 | Ga0207703_1000164716 | 320 |
| 425 | 3300026088 | Ga0207641_10002593 | Ga0207641_1000259314 | 320 |
| 426 | 3300026088 | Ga0207641_10091210 | Ga0207641_100912103 | 320 |
| 427 | 3300026095 | Ga0207676_10001498 | Ga0207676_100014984 | 320 |
| 428 | 3300026095 | Ga0207676_10014132 | Ga0207676_100141324 | 320 |
| 429 | 3300026118 | Ga0207675_100100994 | Ga0207675_1001009943 | 320 |
| 430 | 3300026121 | Ga0207683_10001384 | Ga0207683_1000138415 | 320 |
| 431 | 3300026142 | Ga0207698_10000135 | Ga0207698_1000013525 | 320 |
| 432 | 3300028379 | Ga0268266_10053080 | Ga0268266_100530804 | 320 |
| 433 | 3300028379 | Ga0268266_10303491 | Ga0268266_103034912 | 320 |
| 434 | 3300028380 | Ga0268265_10139537 | Ga0268265_101395373 | 320 |
| 435 | 3300037312 | Ga0395899_0008464 | Ga0395899_0008464_5939_6919 | 320 |
| 436 | 3300037418 | Ga0395900_0060255 | Ga0395900_0060255_2324_3304 | 320 |
| 437 | 3300037418 | Ga0395900_0072373 | Ga0395900_0072373_2195_3175 | 320 |
| 438 | 3300037466 | Ga0395898_0016461 | Ga0395898_0016461_1066_2046 | 320 |
| 439 | 3300037471 | Ga0395905_0062752 | Ga0395905_0062752_2359_3339 | 320 |
| 440 | 3300037471 | Ga0395905_0228468 | Ga0395905_0228468_644_1624 | 320 |
| 441 | 3300038443 | Ga0395901_0067500 | Ga0395901_0067500_1792_2772 | 320 |
| 442 | 3300042008 | Ga0439450_021813 | Ga0439450_021813_76_1044 | 320 |
| 443 | 3300042461 | Ga0439460_0006330 | Ga0439460_0006330_1155_2123 | 320 |
| 444 | 3300048911 | Ga0496108_0031269 | Ga0496108_0031269_1051_2019 | 320 |
| 445 | 3300053088 | Ga0500644_0000485 | Ga0500644_0000485_5071_6057 | 320 |
| 446 | 3300053093 | Ga0500651_0030627 | Ga0500651_0030627_1981_2967 | 320 |
| 447 | 3300053096 | Ga0500641_0070089 | Ga0500641_0070089_142_1113 | 320 |
| 448 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_91828_92823 | 320 |
| 449 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1272084_1273073 | 320 |
| 450 | 3300005347 | Ga0070668_100033964 | Ga0070668_1000339644 | 321 |
| 451 | 3300005547 | Ga0070693_100171358 | Ga0070693_1001713581 | 321 |
| 452 | 3300005618 | Ga0068864_100166232 | Ga0068864_1001662322 | 321 |
| 453 | 3300005841 | Ga0068863_100465044 | Ga0068863_1004650442 | 321 |
| 454 | 3300005843 | Ga0068860_100020854 | Ga0068860_1000208544 | 321 |
| 455 | 3300005844 | Ga0068862_100123210 | Ga0068862_1001232102 | 321 |
| 456 | 3300005983 | Ga0081540_1024715 | Ga0081540_10247153 | 321 |
| 457 | 3300026035 | Ga0207703_10107768 | Ga0207703_101077682 | 321 |
| 458 | 3300026088 | Ga0207641_10029675 | Ga0207641_100296753 | 321 |
| 459 | 3300026095 | Ga0207676_10023435 | Ga0207676_100234352 | 321 |
| 460 | 3300028380 | Ga0268265_10072023 | Ga0268265_100720232 | 321 |
| 461 | 3300028381 | Ga0268264_10016306 | Ga0268264_100163064 | 321 |
| 462 | 3300048912 | Ga0496109_0297687 | Ga0496109_0297687_359_1330 | 321 |
| 463 | 3300048914 | Ga0496111_0100667 | Ga0496111_0100667_833_1804 | 321 |
| 464 | 3300048915 | Ga0496112_0000240 | Ga0496112_0000240_2369_3340 | 321 |
| 465 | 3300005295 | Ga0065707_10103539 | Ga0065707_101035393 | 322 |
| 466 | 3300005329 | Ga0070683_100004990 | Ga0070683_1000049908 | 322 |
| 467 | 3300005367 | Ga0070667_100132100 | Ga0070667_1001321002 | 322 |
| 468 | 3300005530 | Ga0070679_100285377 | Ga0070679_1002853772 | 322 |
| 469 | 3300005844 | Ga0068862_100033323 | Ga0068862_1000333233 | 322 |
| 470 | 3300028379 | Ga0268266_10116379 | Ga0268266_101163792 | 322 |
| 471 | 3300049572 | Ga0501036_0096587 | Ga0501036_0096587_775_1761 | 322 |
| 472 | 3300049573 | Ga0501037_0010018 | Ga0501037_0010018_2189_3175 | 322 |
| 473 | 3300049574 | Ga0501038_0199990 | Ga0501038_0199990_144_1130 | 322 |
| 474 | 3300049575 | Ga0501039_0052069 | Ga0501039_0052069_1695_2681 | 322 |
| 475 | 3300049576 | Ga0501040_0021383 | Ga0501040_0021383_1825_2811 | 322 |
| 476 | 3300049577 | Ga0501041_0218703 | Ga0501041_0218703_52_1038 | 322 |
| 477 | 3300049579 | Ga0501043_0064707 | Ga0501043_0064707_1637_2623 | 322 |
| 478 | 3300049580 | Ga0501046_0362199 | Ga0501046_0362199_36_1022 | 322 |
| 479 | 3300049591 | Ga0501075_0331119 | Ga0501075_0331119_20_1006 | 322 |
| 480 | 3300049592 | Ga0501076_0000731 | Ga0501076_0000731_6990_7976 | 322 |
| 481 | 3300049741 | Ga0501079_0007561 | Ga0501079_0007561_6829_7815 | 322 |
| 482 | 3300049743 | Ga0501081_0000115 | Ga0501081_0000115_26620_27606 | 322 |
| 483 | 3300054114 | Ga0501084_0167016 | Ga0501084_0167016_251_1237 | 322 |
| 484 | 3300060353 | Ga0501082_0008698 | Ga0501082_0008698_6837_7823 | 322 |
| 485 | 3300005841 | Ga0068863_100369378 | Ga0068863_1003693782 | 323 |
| 486 | 3300005843 | Ga0068860_100269120 | Ga0068860_1002691202 | 323 |
| 487 | 3300005844 | Ga0068862_100044081 | Ga0068862_1000440813 | 323 |
| 488 | 3300005844 | Ga0068862_100128818 | Ga0068862_1001288182 | 323 |
| 489 | 3300009093 | Ga0105240_10007799 | Ga0105240_100077992 | 323 |
| 490 | 3300009177 | Ga0105248_10064605 | Ga0105248_100646053 | 323 |
| 491 | 3300013296 | Ga0157374_10000144 | Ga0157374_1000014424 | 323 |
| 492 | 3300013297 | Ga0157378_10004938 | Ga0157378_100049387 | 323 |
| 493 | 3300013306 | Ga0163162_10043379 | Ga0163162_100433793 | 323 |
| 494 | 3300013308 | Ga0157375_10000528 | Ga0157375_1000052811 | 323 |
| 495 | 3300014745 | Ga0157377_10018832 | Ga0157377_100188324 | 323 |
| 496 | 3300014969 | Ga0157376_10018401 | Ga0157376_100184014 | 323 |
| 497 | 3300025913 | Ga0207695_10116254 | Ga0207695_101162542 | 323 |
| 498 | 3300025926 | Ga0207659_10423723 | Ga0207659_104237231 | 323 |
| 499 | 3300031730 | Ga0307516_10000398 | Ga0307516_1000039842 | 323 |
| 500 | 3300045836 | Ga0466958_0046506 | Ga0466958_0046506_1025_2020 | 323 |
| 501 | 3300046531 | Ga0495665_0066777 | Ga0495665_0066777_160_1155 | 323 |
| 502 | 3300046642 | Ga0495634_0002152 | Ga0495634_0002152_475_1470 | 323 |
| 503 | 3300047471 | Ga0495684_0020663 | Ga0495684_0020663_3591_4586 | 323 |
| 504 | 3300048903 | Ga0496100_0199232 | Ga0496100_0199232_21_1013 | 323 |
| 505 | 3300048911 | Ga0496108_0014657 | Ga0496108_0014657_4056_5048 | 323 |
| 506 | 3300048912 | Ga0496109_0000996 | Ga0496109_0000996_19746_20738 | 323 |
| 507 | 3300048913 | Ga0496110_0000396 | Ga0496110_0000396_3262_4254 | 323 |
| 508 | 3300048914 | Ga0496111_0020711 | Ga0496111_0020711_3466_4458 | 323 |
| 509 | 3300050493 | nmdc:mga0k408_13046_c1 | nmdc:mga0k408_13046_c1_23_1018 | 323 |
| 510 | 3300053085 | Ga0495619_0074994 | Ga0495619_0074994_271_1266 | 323 |
| 511 | 3300053094 | Ga0500566_0019839 | Ga0500566_0019839_274_1278 | 323 |
| 512 | 3300053139 | Ga0500568_0005169 | Ga0500568_0005169_3492_4472 | 323 |
| 513 | 3300061719 | Ga0466962_0053207 | Ga0466962_0053207_65_1060 | 323 |
| 514 | 3300005364 | Ga0070673_100146302 | Ga0070673_1001463022 | 324 |
| 515 | 3300005548 | Ga0070665_100095868 | Ga0070665_1000958685 | 324 |
| 516 | 3300046539 | Ga0495621_0004590 | Ga0495621_0004590_560_1576 | 324 |
| 517 | 3300005436 | Ga0070713_100114554 | Ga0070713_1001145541 | 325 |
| 518 | 3300031649 | Ga0307514_10000810 | Ga0307514_1000081017 | 326 |
| 519 | 3300053117 | Ga0500593_000105 | Ga0500593_000105_22752_23750 | 326 |
| 520 | 3300005333 | Ga0070677_10105483 | Ga0070677_101054831 | 327 |
| 521 | 3300005347 | Ga0070668_100151436 | Ga0070668_1001514362 | 327 |
| 522 | 3300017792 | Ga0163161_10049347 | Ga0163161_100493475 | 327 |
| 523 | 3300026142 | Ga0207698_10258721 | Ga0207698_102587211 | 327 |
| 524 | 3300050509 | nmdc:mga0qj67_27643_c1 | nmdc:mga0qj67_27643_c1_859_1938 | 327 |
| 525 | 3300050510 | nmdc:mga06r32_13036_c1 | nmdc:mga06r32_13036_c1_3027_4106 | 327 |
| 526 | 3300028794 | Ga0307515_10001078 | Ga0307515_100010782 | 328 |
| 527 | 3300028794 | Ga0307515_10333826 | Ga0307515_103338262 | 328 |
| 528 | 3300031456 | Ga0307513_10155353 | Ga0307513_101553532 | 328 |
| 529 | 3300050491 | nmdc:mga00v17_177919_c1 | nmdc:mga00v17_177919_c1_129_1148 | 328 |
| 530 | 3300041512 | Ga0451853_1556115 | Ga0451853_1556115_690_1691 | 330 |
| 531 | iso_pu_bacteria | 2643221654 | 2644301195 | 330 |
| 532 | iso_pu_bacteria | 2885192300 | 2885193742 | 334 |
| 533 | 3300006353 | Ga0075370_10073897 | Ga0075370_100738972 | 336 |
| 534 | 3300050493 | nmdc:mga0k408_21732_c1 | nmdc:mga0k408_21732_c1_1889_2953 | 336 |
| 535 | 3300050496 | nmdc:mga07m45_5833_c1 | nmdc:mga07m45_5833_c1_4290_5354 | 336 |
| 536 | 3300042185 | Ga0450909_002696 | Ga0450909_002696_1219_2232 | 337 |
| 537 | 3300026121 | Ga0207683_10082720 | Ga0207683_100827203 | 338 |
| 538 | 3300041404 | Ga0439436_0020543 | Ga0439436_0020543_603_1619 | 338 |
| 539 | 3300041407 | Ga0439447_012370 | Ga0439447_012370_741_1757 | 338 |
| 540 | 3300041999 | Ga0439433_0024380 | Ga0439433_0024380_80_1096 | 338 |
| 541 | 3300042002 | Ga0439442_005001 | Ga0439442_005001_110_1126 | 338 |
| 542 | 3300042006 | Ga0439432_004431 | Ga0439432_004431_3677_4693 | 338 |
| 543 | 3300042007 | Ga0439449_0020184 | Ga0439449_0020184_1307_2323 | 338 |
| 544 | 3300042010 | Ga0439452_000966 | Ga0439452_000966_1949_2965 | 338 |
| 545 | 3300042156 | Ga0439446_0000468 | Ga0439446_0000468_830_1846 | 338 |
| 546 | 3300042435 | Ga0439434_0003711 | Ga0439434_0003711_359_1375 | 338 |
| 547 | 3300005364 | Ga0070673_100127486 | Ga0070673_1001274862 | 339 |
| 548 | 3300005548 | Ga0070665_100002809 | Ga0070665_1000028099 | 339 |
| 549 | 3300014497 | Ga0182008_10047877 | Ga0182008_100478772 | 339 |
| 550 | 3300015262 | Ga0182007_10000741 | Ga0182007_100007419 | 339 |
| 551 | 3300015265 | Ga0182005_1025689 | Ga0182005_10256891 | 339 |
| 552 | 3300025923 | Ga0207681_10274913 | Ga0207681_102749132 | 339 |
| 553 | 3300028794 | Ga0307515_10001329 | Ga0307515_1000132942 | 339 |
| 554 | 3300041407 | Ga0439447_021533 | Ga0439447_021533_216_1235 | 339 |
| 555 | 3300042007 | Ga0439449_0006207 | Ga0439449_0006207_2374_3393 | 339 |
| 556 | 3300046522 | Ga0495643_0064099 | Ga0495643_0064099_273_1292 | 339 |
| 557 | 3300046615 | Ga0495656_0151071 | Ga0495656_0151071_75_1094 | 339 |
| 558 | 3300006048 | Ga0075363_100035363 | Ga0075363_1000353633 | 340 |
| 559 | 3300006177 | Ga0075362_10009787 | Ga0075362_100097874 | 340 |
| 560 | 3300041404 | Ga0439436_0008426 | Ga0439436_0008426_717_1739 | 340 |
| 561 | 3300041405 | Ga0439438_015880 | Ga0439438_015880_1035_2057 | 340 |
| 562 | 3300042128 | Ga0450897_002057 | Ga0450897_002057_350_1372 | 340 |
| 563 | 3300050489 | nmdc:mga03683_2590_c2 | nmdc:mga03683_2590_c2_1420_2442 | 340 |
| 564 | 3300050490 | nmdc:mga03n38_13587_c1 | nmdc:mga03n38_13587_c1_366_1388 | 340 |
| 565 | 3300003784 | Ga0055534_1002254 | Ga0055534_10022547 | 344 |
| 566 | 3300003792 | Ga0055540_1019252 | Ga0055540_10192523 | 344 |
| 567 | 3300025291 | Ga0209675_1008603 | Ga0209675_10086033 | 344 |
| 568 | 3300025292 | Ga0209676_1008732 | Ga0209676_10087323 | 344 |
| 569 | 3300025295 | Ga0209564_1033405 | Ga0209564_10334051 | 344 |
| 570 | 3300025298 | Ga0209050_1018234 | Ga0209050_10182344 | 344 |
| 571 | 3300025303 | Ga0209051_1006725 | Ga0209051_10067252 | 344 |
| 572 | 3300025304 | Ga0209257_1009876 | Ga0209257_10098763 | 344 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9458 | 44 | 344 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9427 | 44 | 344 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9376 | 43 | 344 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9368 | 47 | 344 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9345 | 43 | 344 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9591 | 143 | 265 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9471 | 143 | 269 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9409 | 144 | 269 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.933 | 43 | 344 | 3.40.190.150 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9325 | 143 | 269 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P3Z6M4-F1-model_v4 | Uncharacterized protein LOC107407903 | 0.97 | 72 | 344 |
|
| AF-A0A536XT46-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9693 | 72 | 344 |
|
| AF-A0A1F4DIF3-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9665 | 138 | 344 |
|
| AF-H0BVV3-F1-model_v4 | Uncharacterized protein | 0.9657 | 40 | 344 |
|
| AF-A0A536XGM1-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9634 | 44 | 344 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar