F465129

General Info

Members Datasets Scaffolds Average Seq Length
572 315 566 318

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_27643_c1|nmdc:mga0qj67_27643_c1_859_1938
Length 359
Sequence MNSPLPLPRVAGAESVRYYSIEDYNVLVRHRQLHTGGKMFVRILACAALALCVATPSWSQTYPTKPIRLIVGYAAGGSVDTTARIFAPKLSADLGQQVIVENRAGAASNIAADYVAKAPPDGYTLFWSSGTGLGTNLAFYQKMTYNPLKDFAPIALLMYQSNGLVVNPTVPATTTKELIALAKARPGQLNYGTAGTGTSQHMTAELFSKMTGIRXXXXAYKGGAPALVDLVGGHVDLVFSPLPEVIPYVRANRLRAIAVSGAKRTPAMSNVPTVGETVPGFAFEGFLGVVSPAGVSPDVVARINAVANKALQDPDVKNRLVDLGLGIAGSTPEQLGAHMREQSALMIRIAKDAGIKPLD

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
3 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
4 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
5 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
6 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
211 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
212 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
218 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
219 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
220 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
221 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
222 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
303 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
304 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
305 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
306 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
307 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
308 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
309 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
312 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0.52
Rhizoplane 2.45
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055534_1002254 3300003784 Bacteria 6817
2 Ga0055540_1019252 3300003792 Bacteria 1842
3 Ga0065707_10083489 3300005295 Bacteria 8984
4 Ga0065707_10103539 3300005295 Bacteria 2743
5 Ga0070676_10036355 3300005328 Bacteria 2837
6 Ga0070676_10185380 3300005328 Bacteria 1355
7 Ga0070683_100000347 3300005329 Bacteria 31865
8 Ga0070683_100004990 3300005329 Bacteria 11016
9 Ga0070683_100280767 3300005329 Bacteria 1584
10 Ga0070690_100005081 3300005330 Bacteria 7375
11 Ga0070670_100000309 3300005331 Bacteria 41915
12 Ga0070670_100029278 3300005331 Bacteria 4739
13 Ga0070670_100199003 3300005331 Bacteria 1740
14 Ga0070670_100263249 3300005331 Bacteria 1503
15 Ga0070670_100371982 3300005331 Bacteria 1258
16 Ga0070677_10004019 3300005333 Bacteria 4776
17 Ga0070677_10054342 3300005333 Bacteria 1631
18 Ga0070677_10105483 3300005333 Bacteria 1250
19 Ga0068869_100001859 3300005334 Bacteria 12697
20 Ga0068869_100045994 3300005334 Bacteria 3145
21 Ga0070666_10002081 3300005335 Bacteria 12159
22 Ga0070666_10179699 3300005335 Bacteria 1484
23 Ga0070680_100092263 3300005336 Bacteria 2508
24 Ga0070682_100034514 3300005337 Bacteria 3081
25 Ga0068868_100000930 3300005338 Bacteria 19942
26 Ga0068868_100005400 3300005338 Bacteria 8982
27 Ga0068868_100012111 3300005338 Bacteria 6298
28 Ga0068868_100323962 3300005338 Bacteria 1313
29 Ga0070689_100000939 3300005340 Bacteria 18114
30 Ga0070689_100032710 3300005340 Bacteria 3957
31 Ga0070687_100000199 3300005343 Bacteria 20848
32 Ga0070661_100001422 3300005344 Bacteria 16639
33 Ga0070661_100217906 3300005344 Bacteria 1463
34 Ga0070661_100272912 3300005344 Bacteria 1310
35 Ga0070668_100033964 3300005347 Bacteria 3887
36 Ga0070668_100063383 3300005347 Bacteria 2865
37 Ga0070668_100151436 3300005347 Bacteria 1876
38 Ga0070669_100041925 3300005353 Bacteria 3330
39 Ga0070669_100306416 3300005353 Bacteria 1279
40 Ga0070675_100000049 3300005354 Bacteria 72492
41 Ga0070675_100000926 3300005354 Bacteria 20887
42 Ga0070675_100175869 3300005354 Bacteria 1848
43 Ga0070671_100000137 3300005355 Bacteria 47124
44 Ga0070671_100119494 3300005355 Bacteria 2217
45 Ga0070674_100171049 3300005356 Bacteria 1656
46 Ga0070673_100000394 3300005364 Bacteria 23087
47 Ga0070673_100078227 3300005364 Bacteria 2675
48 Ga0070673_100127486 3300005364 Bacteria 2131
49 Ga0070673_100146302 3300005364 Bacteria 1998
50 Ga0070688_100018238 3300005365 Bacteria 4046
51 Ga0070688_100140427 3300005365 Bacteria 1640
52 Ga0070659_100062258 3300005366 Bacteria 2949
53 Ga0070659_100315456 3300005366 Bacteria 1306
54 Ga0070667_100013715 3300005367 Bacteria 6698
55 Ga0070667_100132100 3300005367 Bacteria 2180
56 Ga0070667_100175560 3300005367 Bacteria 1893
57 Ga0070667_100245849 3300005367 Bacteria 1598
58 Ga0070714_100261069 3300005435 Bacteria 1604
59 Ga0070714_100408266 3300005435 Bacteria 1285
60 Ga0070713_100114554 3300005436 Bacteria 2356
61 Ga0070701_10011085 3300005438 Bacteria 4012
62 Ga0070705_100003046 3300005440 Bacteria 8258
63 Ga0070700_100021308 3300005441 Bacteria 3766
64 Ga0070700_100302532 3300005441 Bacteria 1168
65 Ga0070694_100095420 3300005444 Bacteria 2094
66 Ga0070678_100000771 3300005456 Bacteria 16065
67 Ga0070678_100073303 3300005456 Bacteria 2569
68 Ga0070678_100141993 3300005456 Bacteria 1923
69 Ga0070662_100056003 3300005457 Bacteria 2862
70 Ga0070662_100131172 3300005457 Bacteria 1932
71 Ga0070681_10039992 3300005458 Bacteria 4701
72 Ga0070681_10167301 3300005458 Bacteria 2121
73 Ga0068867_100000824 3300005459 Bacteria 20865
74 Ga0068867_100004978 3300005459 Bacteria 9361
75 Ga0068867_100016771 3300005459 Bacteria 5204
76 Ga0070685_10026991 3300005466 Bacteria 3170
77 Ga0070679_100009445 3300005530 Bacteria 9224
78 Ga0070679_100023923 3300005530 Bacteria 5985
79 Ga0070679_100250482 3300005530 Bacteria 1728
80 Ga0070679_100285377 3300005530 Bacteria 1603
81 Ga0070684_100089855 3300005535 Bacteria 2730
82 Ga0070672_100207665 3300005543 Bacteria 1639
83 Ga0070686_100011913 3300005544 Bacteria 4944
84 Ga0070695_100000728 3300005545 Bacteria 17589
85 Ga0070696_100006658 3300005546 Bacteria 7718
86 Ga0070693_100000072 3300005547 Bacteria 41480
87 Ga0070693_100108500 3300005547 Bacteria 1703
88 Ga0070693_100171358 3300005547 Bacteria 1390
89 Ga0070665_100002809 3300005548 Bacteria 18859
90 Ga0070665_100069685 3300005548 Bacteria 3525
91 Ga0070665_100095868 3300005548 Bacteria 2972
92 Ga0070665_100308262 3300005548 Bacteria 1586
93 Ga0070704_100003550 3300005549 Bacteria 8965
94 Ga0068855_100011949 3300005563 Bacteria 10497
95 Ga0068855_100125900 3300005563 Bacteria 2929
96 Ga0070664_100000054 3300005564 Bacteria 69166
97 Ga0068857_100032236 3300005577 Bacteria 4633
98 Ga0068857_100395650 3300005577 Bacteria 1285
99 Ga0068854_100000714 3300005578 Bacteria 19666
100 Ga0068854_100032767 3300005578 Bacteria 3617
101 Ga0068856_100059045 3300005614 Bacteria 3788
102 Ga0068856_100448281 3300005614 Bacteria 1311
103 Ga0070702_100000084 3300005615 Bacteria 27525
104 Ga0070702_100202335 3300005615 Bacteria 1315
105 Ga0068852_100000065 3300005616 Bacteria 72149
106 Ga0068852_100000654 3300005616 Bacteria 22706
107 Ga0068852_100034748 3300005616 Bacteria 4198
108 Ga0068859_100005387 3300005617 Bacteria 13012
109 Ga0068859_100018280 3300005617 Bacteria 7048
110 Ga0068859_100119947 3300005617 Bacteria 2697
111 Ga0068859_100363258 3300005617 Bacteria 1543
112 Ga0068864_100001420 3300005618 Bacteria 19796
113 Ga0068864_100003720 3300005618 Bacteria 12594
114 Ga0068864_100166232 3300005618 Bacteria 2009
115 Ga0068864_100212908 3300005618 Bacteria 1780
116 Ga0068866_10002137 3300005718 Bacteria 8225
117 Ga0068866_10082629 3300005718 Bacteria 1729
118 Ga0068861_100004429 3300005719 Bacteria 9421
119 Ga0068861_100050276 3300005719 Bacteria 3160
120 Ga0068861_100356137 3300005719 Bacteria 1285
121 Ga0068851_10001105 3300005834 Bacteria 11693
122 Ga0068863_100024030 3300005841 Bacteria 5816
123 Ga0068863_100087722 3300005841 Bacteria 2948
124 Ga0068863_100193985 3300005841 Bacteria 1952
125 Ga0068863_100369378 3300005841 Bacteria 1400
126 Ga0068863_100465044 3300005841 Bacteria 1242
127 Ga0068858_100001292 3300005842 Bacteria 25859
128 Ga0068858_100004784 3300005842 Bacteria 13258
129 Ga0068858_100064072 3300005842 Bacteria 3401
130 Ga0068858_100078513 3300005842 Bacteria 3067
131 Ga0068858_100105678 3300005842 Bacteria 2627
132 Ga0068858_100345172 3300005842 Bacteria 1425
133 Ga0068858_100373794 3300005842 Bacteria 1367
134 Ga0068860_100017811 3300005843 Bacteria 6920
135 Ga0068860_100020854 3300005843 Bacteria 6349
136 Ga0068860_100049428 3300005843 Bacteria 4005
137 Ga0068860_100133462 3300005843 Bacteria 2383
138 Ga0068860_100269120 3300005843 Bacteria 1663
139 Ga0068860_100379177 3300005843 Bacteria 1396
140 Ga0068860_100417519 3300005843 Bacteria 1329
141 Ga0068862_100009057 3300005844 Bacteria 8242
142 Ga0068862_100033323 3300005844 Bacteria 4353
143 Ga0068862_100044081 3300005844 Bacteria 3805
144 Ga0068862_100123210 3300005844 Bacteria 2287
145 Ga0068862_100128818 3300005844 Bacteria 2237
146 Ga0068862_100149038 3300005844 Bacteria 2081
147 Ga0068862_100180781 3300005844 Bacteria 1893
148 Ga0081540_1024715 3300005983 Bacteria 3479
149 Ga0075363_100035363 3300006048 Bacteria 2614
150 Ga0075364_10017505 3300006051 Bacteria 4478
151 Ga0070716_100066260 3300006173 Bacteria 2106
152 Ga0070712_100114065 3300006175 Bacteria 2022
153 Ga0075362_10009787 3300006177 Bacteria 3719
154 Ga0075369_10049988 3300006186 Bacteria 1807
155 Ga0075366_10004370 3300006195 Bacteria 7581
156 Ga0097621_100000051 3300006237 Bacteria 60495
157 Ga0097621_100000794 3300006237 Bacteria 22198
158 Ga0097621_100037041 3300006237 Bacteria 3905
159 Ga0097621_100072303 3300006237 Bacteria 2852
160 Ga0097621_100156113 3300006237 Bacteria 1959
161 Ga0075370_10073897 3300006353 Bacteria 1953
162 Ga0068871_100001133 3300006358 Bacteria 17866
163 Ga0068871_100037263 3300006358 Bacteria 3877
164 Ga0068871_100040416 3300006358 Bacteria 3736
165 Ga0068871_100145647 3300006358 Bacteria 2016
166 Ga0068871_100365659 3300006358 Bacteria 1278
167 Ga0075428_100015214 3300006844 Bacteria 8536
168 Ga0075430_100031263 3300006846 Bacteria 4518
169 Ga0075431_100004522 3300006847 Bacteria 13657
170 Ga0075433_10054907 3300006852 Bacteria 3476
171 Ga0075434_100000073 3300006871 Bacteria 52987
172 Ga0068865_100008183 3300006881 Bacteria 6456
173 Ga0068865_100054894 3300006881 Bacteria 2771
174 Ga0068865_100180687 3300006881 Bacteria 1624
175 Ga0068865_100436918 3300006881 Bacteria 1079
176 Ga0075436_100232184 3300006914 Bacteria 1311
177 Ga0097620_100005387 3300006931 Bacteria 13012
178 Ga0097620_100018280 3300006931 Bacteria 7048
179 Ga0097620_100119945 3300006931 Bacteria 2697
180 Ga0097620_100363303 3300006931 Bacteria 1543
181 Ga0075435_100028335 3300007076 Bacteria 4392
182 Ga0105250_10045733 3300009092 Bacteria 1755
183 Ga0105240_10007799 3300009093 Bacteria 15467
184 Ga0105240_10033241 3300009093 Bacteria 6667
185 Ga0105240_10116687 3300009093 Bacteria 3220
186 Ga0111539_10000288 3300009094 Bacteria 60623
187 Ga0111539_10530474 3300009094 Bacteria 1371
188 Ga0111539_10738483 3300009094 Bacteria 1146
189 Ga0105245_10001603 3300009098 Bacteria 20580
190 Ga0105245_10315345 3300009098 Bacteria 1539
191 Ga0105243_10001817 3300009148 Bacteria 18269
192 Ga0105243_10162006 3300009148 Bacteria 1930
193 Ga0105243_10345805 3300009148 Bacteria 1364
194 Ga0105242_10001017 3300009176 Bacteria 22032
195 Ga0105242_10003543 3300009176 Bacteria 12137
196 Ga0105242_10124752 3300009176 Bacteria 2215
197 Ga0105242_10215605 3300009176 Bacteria 1713
198 Ga0105248_10063971 3300009177 Bacteria 4130
199 Ga0105248_10064605 3300009177 Bacteria 4109
200 Ga0105248_10095368 3300009177 Bacteria 3350
201 Ga0105248_10142497 3300009177 Bacteria 2704
202 Ga0105248_10170421 3300009177 Bacteria 2453
203 Ga0105248_10442281 3300009177 Bacteria 1465
204 Ga0105238_10061117 3300009551 Bacteria 3771
205 Ga0105238_10070239 3300009551 Bacteria 3501
206 Ga0105249_10202557 3300009553 Bacteria 1943
207 Ga0105249_10250572 3300009553 Bacteria 1756
208 Ga0105249_10306750 3300009553 Bacteria 1594
209 Ga0105239_10028862 3300010375 Bacteria 6099
210 Ga0157371_10116250 3300013102 Bacteria 1900
211 Ga0157369_10002100 3300013105 Bacteria 24031
212 Ga0157374_10000144 3300013296 Bacteria 64667
213 Ga0157374_10064400 3300013296 Bacteria 3440
214 Ga0157374_10343763 3300013296 Bacteria 1481
215 Ga0157378_10004938 3300013297 Bacteria 11690
216 Ga0157378_10333690 3300013297 Bacteria 1476
217 Ga0163162_10043379 3300013306 Bacteria 4503
218 Ga0163162_10155654 3300013306 Bacteria 2405
219 Ga0163162_10164463 3300013306 Bacteria 2342
220 Ga0157372_10019363 3300013307 Bacteria 7334
221 Ga0157375_10000528 3300013308 Bacteria 34322
222 Ga0157375_10048662 3300013308 Bacteria 4148
223 Ga0157375_10809002 3300013308 Bacteria 1085
224 Ga0163163_10002538 3300014325 Bacteria 15454
225 Ga0163163_10041003 3300014325 Bacteria 4525
226 Ga0157380_10055946 3300014326 Bacteria 3135
227 Ga0157380_10059030 3300014326 Bacteria 3060
228 Ga0157380_10096950 3300014326 Bacteria 2446
229 Ga0157380_10488867 3300014326 Bacteria 1192
230 Ga0182008_10047877 3300014497 Bacteria 2124
231 Ga0157377_10018832 3300014745 Bacteria 3595
232 Ga0157377_10094913 3300014745 Bacteria 1767
233 Ga0157379_10014302 3300014968 Bacteria 6962
234 Ga0157379_10078851 3300014968 Bacteria 2950
235 Ga0157379_10176331 3300014968 Bacteria 1930
236 Ga0157376_10018401 3300014969 Bacteria 5356
237 Ga0157376_10021252 3300014969 Bacteria 5040
238 Ga0157376_10093792 3300014969 Bacteria 2607
239 Ga0157376_10181537 3300014969 Bacteria 1924
240 Ga0182007_10000741 3300015262 Bacteria 18460
241 Ga0182005_1025689 3300015265 Bacteria 1607
242 Ga0163161_10049347 3300017792 Bacteria 3041
243 Ga0163161_10061439 3300017792 Bacteria 2735
244 Ga0163161_10130729 3300017792 Bacteria 1894
245 Ga0163161_10264596 3300017792 Bacteria 1344
246 Ga0209675_1008603 3300025291 Bacteria 3724
247 Ga0209676_1008732 3300025292 Bacteria 4470
248 Ga0209564_1033405 3300025295 Bacteria 1530
249 Ga0209050_1018234 3300025298 Bacteria 2738
250 Ga0209051_1006725 3300025303 Bacteria 6418
251 Ga0209257_1009876 3300025304 Bacteria 4982
252 Ga0207656_10002656 3300025321 Bacteria 6055
253 Ga0207682_10069293 3300025893 Bacteria 1491
254 Ga0207682_10095739 3300025893 Bacteria 1293
255 Ga0207682_10103052 3300025893 Bacteria 1249
256 Ga0207642_10000462 3300025899 Bacteria 12434
257 Ga0207642_10042146 3300025899 Bacteria 2004
258 Ga0207688_10038310 3300025901 Bacteria 2660
259 Ga0207680_10022089 3300025903 Bacteria 3455
260 Ga0207647_10139997 3300025904 Bacteria 1418
261 Ga0207685_10038767 3300025905 Bacteria 1764
262 Ga0207707_10114125 3300025912 Bacteria 2361
263 Ga0207707_10157789 3300025912 Bacteria 1984
264 Ga0207695_10116254 3300025913 Bacteria 2649
265 Ga0207695_10401103 3300025913 Bacteria 1256
266 Ga0207693_10002296 3300025915 Bacteria 16616
267 Ga0207660_10002278 3300025917 Bacteria 12642
268 Ga0207662_10015491 3300025918 Bacteria 4289
269 Ga0207649_10002872 3300025920 Bacteria 9482
270 Ga0207649_10190348 3300025920 Bacteria 1443
271 Ga0207652_10031211 3300025921 Bacteria 4473
272 Ga0207652_10453835 3300025921 Bacteria 1155
273 Ga0207681_10027388 3300025923 Bacteria 3684
274 Ga0207681_10075524 3300025923 Bacteria 2364
275 Ga0207681_10087612 3300025923 Bacteria 2215
276 Ga0207681_10184165 3300025923 Bacteria 1593
277 Ga0207681_10274913 3300025923 Bacteria 1324
278 Ga0207694_10114919 3300025924 Bacteria 2144
279 Ga0207694_10137323 3300025924 Bacteria 1964
280 Ga0207650_10000339 3300025925 Bacteria 45234
281 Ga0207659_10001257 3300025926 Bacteria 15167
282 Ga0207659_10042224 3300025926 Bacteria 3196
283 Ga0207659_10423723 3300025926 Bacteria 1117
284 Ga0207687_10022407 3300025927 Bacteria 4204
285 Ga0207687_10401561 3300025927 Bacteria 1127
286 Ga0207664_10091168 3300025929 Bacteria 2499
287 Ga0207664_10131007 3300025929 Bacteria 2111
288 Ga0207644_10001499 3300025931 Bacteria 15042
289 Ga0207644_10058637 3300025931 Bacteria 2783
290 Ga0207706_10160664 3300025933 Bacteria 1975
291 Ga0207706_10268642 3300025933 Bacteria 1488
292 Ga0207686_10002549 3300025934 Bacteria 9896
293 Ga0207686_10005522 3300025934 Bacteria 6781
294 Ga0207686_10061029 3300025934 Bacteria 2389
295 Ga0207686_10081165 3300025934 Bacteria 2116
296 Ga0207670_10011269 3300025936 Bacteria 5182
297 Ga0207670_10012105 3300025936 Bacteria 5034
298 Ga0207670_10291573 3300025936 Bacteria 1275
299 Ga0207669_10013095 3300025937 Bacteria 4106
300 Ga0207704_10001219 3300025938 Bacteria 11456
301 Ga0207704_10037862 3300025938 Bacteria 2791
302 Ga0207704_10110312 3300025938 Bacteria 1858
303 Ga0207691_10000147 3300025940 Bacteria 65176
304 Ga0207691_10073763 3300025940 Bacteria 3078
305 Ga0207691_10084386 3300025940 Bacteria 2851
306 Ga0207691_10167488 3300025940 Bacteria 1925
307 Ga0207711_10050737 3300025941 Bacteria 3552
308 Ga0207711_10089291 3300025941 Bacteria 2707
309 Ga0207711_10351868 3300025941 Bacteria 1364
310 Ga0207689_10002203 3300025942 Bacteria 18272
311 Ga0207689_10041096 3300025942 Bacteria 3827
312 Ga0207689_10102265 3300025942 Bacteria 2354
313 Ga0207661_10001065 3300025944 Bacteria 18247
314 Ga0207661_10114188 3300025944 Bacteria 2290
315 Ga0207661_10234363 3300025944 Bacteria 1627
316 Ga0207679_10000307 3300025945 Bacteria 36847
317 Ga0207651_10000364 3300025960 Bacteria 19183
318 Ga0207651_10002644 3300025960 Bacteria 8565
319 Ga0207651_10152611 3300025960 Bacteria 1800
320 Ga0207651_10390920 3300025960 Bacteria 1181
321 Ga0207712_10047904 3300025961 Bacteria 2970
322 Ga0207668_10012084 3300025972 Bacteria 5273
323 Ga0207640_10000771 3300025981 Bacteria 18312
324 Ga0207658_10002924 3300025986 Bacteria 12231
325 Ga0207658_10009514 3300025986 Bacteria 6598
326 Ga0207658_10106479 3300025986 Bacteria 2208
327 Ga0207658_10112737 3300025986 Bacteria 2153
328 Ga0207677_10000130 3300026023 Bacteria 61813
329 Ga0207677_10011733 3300026023 Bacteria 5006
330 Ga0207703_10001647 3300026035 Bacteria 20096
331 Ga0207703_10004567 3300026035 Bacteria 11350
332 Ga0207703_10107768 3300026035 Bacteria 2372
333 Ga0207703_10114252 3300026035 Bacteria 2308
334 Ga0207703_10297838 3300026035 Bacteria 1470
335 Ga0207639_10029204 3300026041 Bacteria 4035
336 Ga0207678_10122250 3300026067 Bacteria 2221
337 Ga0207708_10000164 3300026075 Bacteria 52172
338 Ga0207641_10002593 3300026088 Bacteria 16611
339 Ga0207641_10029675 3300026088 Bacteria 4524
340 Ga0207641_10091210 3300026088 Bacteria 2666
341 Ga0207648_10002874 3300026089 Bacteria 18229
342 Ga0207648_10006920 3300026089 Bacteria 11238
343 Ga0207648_10098095 3300026089 Bacteria 2565
344 Ga0207648_10209768 3300026089 Bacteria 1729
345 Ga0207676_10001498 3300026095 Bacteria 17239
346 Ga0207676_10014132 3300026095 Bacteria 5735
347 Ga0207676_10023435 3300026095 Bacteria 4555
348 Ga0207676_10264522 3300026095 Bacteria 1554
349 Ga0207674_10009798 3300026116 Bacteria 10911
350 Ga0207675_100001661 3300026118 Bacteria 22258
351 Ga0207675_100100994 3300026118 Bacteria 2717
352 Ga0207675_100133276 3300026118 Bacteria 2356
353 Ga0207675_100440755 3300026118 Bacteria 1289
354 Ga0207683_10001384 3300026121 Bacteria 21858
355 Ga0207683_10025214 3300026121 Bacteria 5127
356 Ga0207683_10041084 3300026121 Bacteria 4037
357 Ga0207683_10082720 3300026121 Bacteria 2852
358 Ga0207698_10000135 3300026142 Bacteria 46357
359 Ga0207698_10018613 3300026142 Bacteria 4738
360 Ga0207698_10041202 3300026142 Bacteria 3439
361 Ga0207698_10062748 3300026142 Bacteria 2904
362 Ga0207698_10258721 3300026142 Bacteria 1598
363 Ga0209995_1001717 3300027471 Bacteria 3408
364 Ga0209983_1008336 3300027665 Bacteria 2119
365 Ga0209974_10003726 3300027876 Bacteria 5469
366 Ga0207428_10001183 3300027907 Bacteria 28096
367 Ga0268266_10053080 3300028379 Bacteria 3482
368 Ga0268266_10116379 3300028379 Bacteria 2374
369 Ga0268266_10268920 3300028379 Bacteria 1582
370 Ga0268266_10303491 3300028379 Bacteria 1490
371 Ga0268265_10002260 3300028380 Bacteria 14728
372 Ga0268265_10072023 3300028380 Bacteria 2694
373 Ga0268265_10139537 3300028380 Bacteria 2027
374 Ga0268265_10265392 3300028380 Bacteria 1529
375 Ga0268265_10338018 3300028380 Bacteria 1370
376 Ga0268264_10001897 3300028381 Bacteria 18963
377 Ga0268264_10016306 3300028381 Bacteria 6084
378 Ga0268264_10033693 3300028381 Bacteria 4211
379 Ga0307515_10001078 3300028794 Bacteria 62511
380 Ga0307515_10001329 3300028794 Bacteria 56020
381 Ga0307515_10190055 3300028794 Bacteria 1967
382 Ga0307515_10333826 3300028794 Bacteria 1173
383 Ga0265338_10117760 3300028800 Bacteria 2124
384 Ga0265325_10009273 3300031241 Bacteria 5752
385 Ga0265339_10000064 3300031249 Bacteria 92992
386 Ga0307513_10155353 3300031456 Bacteria 2189
387 Ga0265313_10000020 3300031595 Bacteria 145873
388 Ga0307514_10000810 3300031649 Bacteria 50948
389 Ga0307516_10000398 3300031730 Bacteria 56825
390 Ga0373930_0002261 3300034816 Bacteria 2968
391 Ga0373930_0010068 3300034816 Bacteria 1682
392 Ga0373950_0005017 3300034818 Bacteria 1960
393 Ga0373929_0002234 3300035085 Bacteria 3581
394 Ga0373949_0009306 3300035090 Bacteria 2152
395 Ga0373951_0007362 3300035091 Bacteria 2500
396 Ga0373923_0032981 3300035111 Bacteria 2095
397 Ga0373932_0002181 3300035112 Bacteria 5054
398 Ga0373936_0024620 3300035113 Bacteria 2351
399 Ga0373939_0003147 3300035114 Bacteria 3881
400 Ga0373945_0008852 3300035116 Bacteria 3288
401 Ga0373945_0071085 3300035116 Bacteria 1317
402 Ga0373943_0001338 3300035170 Bacteria 11099
403 Ga0373946_0001949 3300035171 Bacteria 7222
404 Ga0373955_0020180 3300035172 Bacteria 3346
405 Ga0373942_0030553 3300035207 Bacteria 1420
406 Ga0373942_0078606 3300035207 Bacteria 975
407 Ga0373931_0000219 3300035691 Bacteria 24390
408 Ga0373931_0016561 3300035691 Bacteria 3631
409 Ga0373931_0059134 3300035691 Bacteria 2061
410 Ga0373931_0090972 3300035691 Bacteria 1700
411 Ga0373931_0117627 3300035691 Bacteria 1515
412 Ga0373935_0021907 3300035692 Bacteria 3913
413 Ga0373935_0099756 3300035692 Bacteria 1912
414 Ga0373927_0000243 3300035695 Bacteria 42834
415 Ga0373927_0013298 3300035695 Bacteria 5472
416 Ga0373927_0015370 3300035695 Bacteria 5058
417 Ga0373947_0000613 3300035725 Bacteria 21037
418 Ga0373937_0333981 3300036401 Bacteria 1435
419 Ga0373925_0002340 3300037068 Bacteria 15243
420 Ga0373925_0054752 3300037068 Bacteria 2984
421 Ga0373925_0096138 3300037068 Bacteria 2270
422 Ga0373925_0115963 3300037068 Bacteria 2074
423 Ga0395899_0008464 3300037312 Bacteria 7926
424 Ga0395900_0060255 3300037418 Bacteria 3906
425 Ga0395900_0072373 3300037418 Bacteria 3544
426 Ga0395900_0125803 3300037418 Bacteria 2629
427 Ga0395898_0016461 3300037466 Bacteria 7567
428 Ga0395905_0002866 3300037471 Bacteria 18828
429 Ga0395905_0062752 3300037471 Bacteria 3475
430 Ga0395905_0228468 3300037471 Bacteria 1740
431 Ga0395901_0067500 3300038443 Bacteria 3724
432 Ga0395901_0195006 3300038443 Unclassified 2124
433 Ga0436363_1379029 3300039450 Bacteria 1417
434 Ga0439436_0008426 3300041404 Bacteria 3169
435 Ga0439436_0020543 3300041404 Bacteria 1966
436 Ga0439438_015880 3300041405 Bacteria 2202
437 Ga0439447_012370 3300041407 Bacteria 2454
438 Ga0439447_021533 3300041407 Bacteria 1697
439 Ga0451807_0485629 3300041486 Bacteria 2144
440 Ga0451853_0685456 3300041512 Bacteria 1691
441 Ga0451853_1556115 3300041512 Bacteria 1726
442 Ga0439433_0024380 3300041999 Bacteria 1362
443 Ga0439442_005001 3300042002 Bacteria 2646
444 Ga0439432_004431 3300042006 Bacteria 5129
445 Ga0439449_0006207 3300042007 Bacteria 4566
446 Ga0439449_0020184 3300042007 Bacteria 2496
447 Ga0439450_021813 3300042008 Bacteria 1378
448 Ga0439452_000966 3300042010 Bacteria 12916
449 Ga0450897_002057 3300042128 Bacteria 1463
450 Ga0439446_0000468 3300042156 Bacteria 7992
451 Ga0450909_002696 3300042185 Bacteria 2520
452 Ga0439434_0003711 3300042435 Bacteria 4468
453 Ga0439460_0006330 3300042461 Bacteria 2933
454 Ga0466968_0121105 3300044735 Bacteria 1184
455 Ga0451576_0000326 3300045051 Bacteria 115294
456 Ga0451576_0027529 3300045051 Bacteria 6104
457 Ga0451576_0030696 3300045051 Bacteria 5740
458 Ga0466958_0046506 3300045836 Bacteria 2619
459 Ga0466967_0012686 3300045976 Bacteria 6466
460 Ga0495592_0155941 3300046454 Bacteria 1575
461 Ga0495629_0024150 3300046459 Bacteria 4329
462 Ga0495629_0170093 3300046459 Bacteria 1512
463 Ga0495580_0041874 3300046472 Bacteria 3264
464 Ga0495662_0013109 3300046476 Bacteria 4037
465 Ga0495662_0052314 3300046476 Bacteria 1971
466 Ga0495664_0000473 3300046477 Bacteria 19941
467 Ga0495664_0131124 3300046477 Bacteria 1518
468 Ga0495618_0068172 3300046514 Bacteria 2262
469 Ga0495630_0002253 3300046517 Bacteria 13430
470 Ga0495630_0128784 3300046517 Bacteria 1921
471 Ga0495643_0064099 3300046522 Bacteria 1942
472 Ga0495652_0065783 3300046529 Bacteria 3045
473 Ga0495652_0121797 3300046529 Bacteria 2078
474 Ga0495665_0066777 3300046531 Unclassified 1897
475 Ga0495640_0071586 3300046533 Bacteria 2326
476 Ga0495586_0063207 3300046535 Bacteria 2016
477 Ga0495587_0009425 3300046536 Bacteria 6258
478 Ga0495621_0004590 3300046539 Bacteria 3901
479 Ga0495645_0013255 3300046543 Bacteria 5826
480 Ga0495667_0021767 3300046559 Bacteria 4325
481 Ga0495656_0151071 3300046615 Bacteria 1122
482 Ga0495634_0002152 3300046642 Bacteria 16576
483 Ga0495634_0003099 3300046642 Bacteria 13511
484 Ga0495634_0074386 3300046642 Bacteria 2232
485 Ga0495635_0000375 3300046663 Bacteria 28276
486 Ga0495657_0058695 3300046675 Bacteria 2554
487 Ga0495599_0017511 3300046678 Bacteria 4454
488 Ga0495623_0042262 3300046679 Bacteria 2904
489 Ga0495647_0041418 3300046681 Bacteria 1754
490 Ga0495658_0069550 3300046683 Bacteria 2041
491 Ga0495624_0013647 3300046690 Bacteria 5534
492 Ga0495624_0031067 3300046690 Bacteria 3476
493 Ga0495581_0009688 3300047315 Bacteria 5576
494 Ga0495604_0190945 3300047317 Bacteria 1427
495 Ga0495636_0017371 3300047318 Bacteria 2880
496 Ga0495674_0002065 3300047319 Bacteria 19693
497 Ga0495684_0002177 3300047471 Bacteria 15689
498 Ga0495684_0012832 3300047471 Bacteria 6466
499 Ga0495684_0020663 3300047471 Bacteria 5073
500 Ga0495593_0006727 3300047673 Bacteria 6730
501 Ga0496100_0199232 3300048903 Bacteria 1458
502 Ga0496101_0256982 3300048904 Bacteria 1362
503 Ga0496104_0009568 3300048907 Bacteria 8628
504 Ga0496105_0024505 3300048908 Bacteria 4903
505 Ga0496108_0014657 3300048911 Bacteria 6400
506 Ga0496108_0031269 3300048911 Bacteria 4416
507 Ga0496109_0000996 3300048912 Bacteria 23382
508 Ga0496109_0297687 3300048912 Bacteria 1521
509 Ga0496110_0000396 3300048913 Bacteria 29470
510 Ga0496111_0020711 3300048914 Bacteria 4583
511 Ga0496111_0100667 3300048914 Bacteria 2123
512 Ga0496112_0000240 3300048915 Bacteria 35240
513 Ga0496114_0246678 3300048917 Bacteria 1571
514 Ga0501036_0096587 3300049572 Bacteria 2498
515 Ga0501037_0010018 3300049573 Bacteria 6952
516 Ga0501038_0199990 3300049574 Bacteria 1604
517 Ga0501039_0052069 3300049575 Bacteria 3168
518 Ga0501040_0021383 3300049576 Bacteria 4320
519 Ga0501041_0218703 3300049577 Bacteria 1195
520 Ga0501043_0064707 3300049579 Bacteria 2872
521 Ga0501046_0362199 3300049580 Bacteria 1051
522 Ga0501075_0331119 3300049591 Bacteria 1160
523 Ga0501076_0000731 3300049592 Bacteria 21260
524 Ga0501079_0007561 3300049741 Bacteria 8225
525 Ga0501080_0003285 3300049742 Bacteria 14289
526 Ga0501081_0000115 3300049743 Bacteria 34620
527 nmdc:mga03683_2590_c2 3300050489 Bacteria 4151
528 nmdc:mga03n38_13587_c1 3300050490 Bacteria 3098
529 nmdc:mga00v17_177919_c1 3300050491 Bacteria 1372
530 nmdc:mga0k408_13046_c1 3300050493 Bacteria 4550
531 nmdc:mga0k408_21732_c1 3300050493 Bacteria 3607
532 nmdc:mga0k408_44802_c1 3300050493 Bacteria 2551
533 nmdc:mga06z11_151292_c1 3300050494 Bacteria 1319
534 nmdc:mga07m45_5833_c1 3300050496 Bacteria 6177
535 nmdc:mga0qj67_27643_c1 3300050509 Bacteria 4398
536 nmdc:mga06r32_13036_c1 3300050510 Bacteria 7522
537 nmdc:mga08y16_103198_c1 3300050511 Bacteria 2969
538 nmdc:mga08y16_752_c1 3300050511 Bacteria 30835
539 nmdc:mga0n895_15164_c1 3300050512 Bacteria 7023
540 nmdc:mga0rr50_955_c1 3300050513 Bacteria 15665
541 nmdc:mga0a205_179808_c1 3300050515 Bacteria 2009
542 nmdc:mga0a205_68785_c1 3300050515 Bacteria 3419
543 nmdc:mga0sz30_78107_c1 3300050516 Bacteria 1430
544 Ga0495601_0093158 3300053077 Bacteria 1940
545 Ga0495612_0000652 3300053078 Bacteria 13953
546 Ga0500610_0123732 3300053079 Bacteria 1320
547 Ga0495619_0009712 3300053085 Bacteria 6066
548 Ga0495619_0074994 3300053085 Unclassified 2269
549 Ga0500644_0000485 3300053088 Bacteria 17515
550 Ga0500651_0030627 3300053093 Bacteria 3386
551 Ga0500566_0019839 3300053094 Bacteria 3947
552 Ga0500641_0070089 3300053096 Bacteria 1474
553 Ga0500562_020518 3300053108 Bacteria 1715
554 Ga0500593_000105 3300053117 Bacteria 32307
555 Ga0500593_142099 3300053117 Bacteria 943
556 Ga0500595_000003 3300053119 Bacteria 419332
557 Ga0500652_002017 3300053131 Bacteria 6117
558 Ga0500568_0005169 3300053139 Bacteria 6804
559 Ga0500590_001662 3300053148 Bacteria 9305
560 Ga0500616_0000002 3300053153 Bacteria 1611257
561 Ga0500616_0046389 3300053153 Bacteria 2310
562 Ga0500619_000096 3300053154 Bacteria 23864
563 Ga0500645_000078 3300053730 Bacteria 76931
564 Ga0501084_0167016 3300054114 Bacteria 1857
565 Ga0501082_0008698 3300060353 Bacteria 8756
566 Ga0466962_0053207 3300061719 Bacteria 1935

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100345172 Ga0068858_1003451721 275
2 3300026035 Ga0207703_10297838 Ga0207703_102978381 275
3 3300028381 Ga0268264_10033693 Ga0268264_100336932 275
4 3300035207 Ga0373942_0030553 Ga0373942_0030553_543_1388 280
5 3300005331 Ga0070670_100029278 Ga0070670_1000292781 282
6 3300035113 Ga0373936_0024620 Ga0373936_0024620_275_1210 287
7 3300035116 Ga0373945_0008852 Ga0373945_0008852_1599_2534 287
8 3300035170 Ga0373943_0001338 Ga0373943_0001338_2454_3389 287
9 3300035171 Ga0373946_0001949 Ga0373946_0001949_1910_2845 287
10 3300035692 Ga0373935_0021907 Ga0373935_0021907_1653_2588 287
11 3300035695 Ga0373927_0000243 Ga0373927_0000243_24363_25298 287
12 3300035725 Ga0373947_0000613 Ga0373947_0000613_11735_12670 287
13 3300037068 Ga0373925_0002340 Ga0373925_0002340_2254_3189 287
14 3300046459 Ga0495629_0024150 Ga0495629_0024150_136_1071 287
15 3300046472 Ga0495580_0041874 Ga0495580_0041874_1892_2827 287
16 3300046476 Ga0495662_0052314 Ga0495662_0052314_138_1073 287
17 3300046517 Ga0495630_0002253 Ga0495630_0002253_7247_8182 287
18 3300046533 Ga0495640_0071586 Ga0495640_0071586_961_1896 287
19 3300046642 Ga0495634_0074386 Ga0495634_0074386_580_1515 287
20 3300046681 Ga0495647_0041418 Ga0495647_0041418_476_1411 287
21 3300046690 Ga0495624_0013647 Ga0495624_0013647_2480_3415 287
22 3300047315 Ga0495581_0009688 Ga0495581_0009688_3737_4672 287
23 3300047471 Ga0495684_0002177 Ga0495684_0002177_5422_6357 287
24 3300047673 Ga0495593_0006727 Ga0495593_0006727_3337_4272 287
25 3300048904 Ga0496101_0256982 Ga0496101_0256982_473_1345 289
26 3300048917 Ga0496114_0246678 Ga0496114_0246678_21_893 289
27 3300006852 Ga0075433_10054907 Ga0075433_100549073 290
28 3300041486 Ga0451807_0485629 Ga0451807_0485629_360_1316 290
29 3300041512 Ga0451853_0685456 Ga0451853_0685456_374_1330 290
30 3300050515 nmdc:mga0a205_68785_c1 nmdc:mga0a205_68785_c1_1758_2714 290
31 3300028379 Ga0268266_10268920 Ga0268266_102689202 291
32 3300053117 Ga0500593_142099 Ga0500593_142099_44_922 291
33 3300005329 Ga0070683_100280767 Ga0070683_1002807672 293
34 3300005353 Ga0070669_100041925 Ga0070669_1000419253 293
35 3300005354 Ga0070675_100175869 Ga0070675_1001758691 293
36 3300005355 Ga0070671_100119494 Ga0070671_1001194943 293
37 3300005356 Ga0070674_100171049 Ga0070674_1001710491 293
38 3300005367 Ga0070667_100245849 Ga0070667_1002458491 293
39 3300005456 Ga0070678_100073303 Ga0070678_1000733033 293
40 3300005844 Ga0068862_100180781 Ga0068862_1001807811 293
41 3300006881 Ga0068865_100436918 Ga0068865_1004369181 293
42 3300025899 Ga0207642_10042146 Ga0207642_100421462 293
43 3300025931 Ga0207644_10058637 Ga0207644_100586372 293
44 3300025944 Ga0207661_10234363 Ga0207661_102343632 293
45 3300025960 Ga0207651_10152611 Ga0207651_101526112 293
46 3300005530 Ga0070679_100023923 Ga0070679_1000239232 294
47 3300038443 Ga0395901_0195006 Ga0395901_0195006_963_1970 294
48 3300050493 nmdc:mga0k408_44802_c1 nmdc:mga0k408_44802_c1_97_1014 294
49 3300005435 Ga0070714_100261069 Ga0070714_1002610691 295
50 3300005438 Ga0070701_10011085 Ga0070701_100110852 295
51 3300005719 Ga0068861_100004429 Ga0068861_1000044296 296
52 3300026067 Ga0207678_10122250 Ga0207678_101222502 296
53 3300025893 Ga0207682_10103052 Ga0207682_101030522 297
54 3300005331 Ga0070670_100371982 Ga0070670_1003719822 298
55 3300005340 Ga0070689_100032710 Ga0070689_1000327105 298
56 3300005365 Ga0070688_100018238 Ga0070688_1000182383 298
57 3300005577 Ga0068857_100032236 Ga0068857_1000322362 298
58 3300013308 Ga0157375_10048662 Ga0157375_100486623 298
59 3300025901 Ga0207688_10038310 Ga0207688_100383102 298
60 3300025923 Ga0207681_10075524 Ga0207681_100755242 298
61 3300025926 Ga0207659_10042224 Ga0207659_100422241 298
62 3300025942 Ga0207689_10041096 Ga0207689_100410964 298
63 3300026116 Ga0207674_10009798 Ga0207674_1000979812 298
64 3300005842 Ga0068858_100004784 Ga0068858_1000047846 299
65 3300009176 Ga0105242_10001017 Ga0105242_1000101710 299
66 3300009177 Ga0105248_10095368 Ga0105248_100953683 299
67 3300009551 Ga0105238_10070239 Ga0105238_100702392 299
68 3300014968 Ga0157379_10014302 Ga0157379_100143022 299
69 3300025924 Ga0207694_10137323 Ga0207694_101373232 299
70 3300025934 Ga0207686_10002549 Ga0207686_100025491 299
71 3300025941 Ga0207711_10050737 Ga0207711_100507373 299
72 3300026035 Ga0207703_10004567 Ga0207703_1000456710 299
73 3300026089 Ga0207648_10209768 Ga0207648_102097682 299
74 3300028380 Ga0268265_10265392 Ga0268265_102653922 299
75 3300034816 Ga0373930_0010068 Ga0373930_0010068_103_1074 299
76 3300035085 Ga0373929_0002234 Ga0373929_0002234_179_1150 299
77 3300035691 Ga0373931_0016561 Ga0373931_0016561_2211_3182 299
78 3300045051 Ga0451576_0000326 Ga0451576_0000326_12446_13351 299
79 3300005441 Ga0070700_100302532 Ga0070700_1003025321 301
80 3300005617 Ga0068859_100018280 Ga0068859_1000182805 301
81 3300005842 Ga0068858_100078513 Ga0068858_1000785132 301
82 3300006931 Ga0097620_100018280 Ga0097620_1000182805 301
83 3300009553 Ga0105249_10202557 Ga0105249_102025572 301
84 3300014326 Ga0157380_10059030 Ga0157380_100590303 301
85 3300025893 Ga0207682_10095739 Ga0207682_100957392 301
86 3300025924 Ga0207694_10114919 Ga0207694_101149194 301
87 3300026035 Ga0207703_10114252 Ga0207703_101142522 301
88 3300005719 Ga0068861_100356137 Ga0068861_1003561372 302
89 3300006175 Ga0070712_100114065 Ga0070712_1001140652 302
90 3300025915 Ga0207693_10002296 Ga0207693_1000229617 302
91 3300026142 Ga0207698_10062748 Ga0207698_100627482 302
92 3300005456 Ga0070678_100141993 Ga0070678_1001419932 303
93 3300005459 Ga0068867_100016771 Ga0068867_1000167714 303
94 3300005843 Ga0068860_100379177 Ga0068860_1003791771 303
95 3300006237 Ga0097621_100156113 Ga0097621_1001561132 303
96 3300006881 Ga0068865_100180687 Ga0068865_1001806872 303
97 3300009176 Ga0105242_10124752 Ga0105242_101247521 303
98 3300017792 Ga0163161_10061439 Ga0163161_100614394 303
99 3300025934 Ga0207686_10061029 Ga0207686_100610294 303
100 3300025937 Ga0207669_10013095 Ga0207669_100130954 303
101 3300025986 Ga0207658_10106479 Ga0207658_101064794 303
102 3300026089 Ga0207648_10006920 Ga0207648_100069204 303
103 3300026121 Ga0207683_10025214 Ga0207683_100252142 303
104 3300037418 Ga0395900_0125803 Ga0395900_0125803_535_1464 303
105 3300005617 Ga0068859_100363258 Ga0068859_1003632582 304
106 3300006358 Ga0068871_100365659 Ga0068871_1003656592 304
107 3300006931 Ga0097620_100363303 Ga0097620_1003633032 304
108 3300009553 Ga0105249_10306750 Ga0105249_103067501 304
109 3300053153 Ga0500616_0046389 Ga0500616_0046389_206_1174 304
110 3300005366 Ga0070659_100315456 Ga0070659_1003154561 305
111 3300009094 Ga0111539_10530474 Ga0111539_105304742 305
112 3300014326 Ga0157380_10096950 Ga0157380_100969503 305
113 3300034818 Ga0373950_0005017 Ga0373950_0005017_950_1876 305
114 3300035090 Ga0373949_0009306 Ga0373949_0009306_1156_2082 305
115 3300035091 Ga0373951_0007362 Ga0373951_0007362_1533_2459 305
116 3300035112 Ga0373932_0002181 Ga0373932_0002181_3077_4003 305
117 3300035114 Ga0373939_0003147 Ga0373939_0003147_681_1607 305
118 3300035172 Ga0373955_0020180 Ga0373955_0020180_61_1017 305
119 3300035207 Ga0373942_0078606 Ga0373942_0078606_18_944 305
120 3300035691 Ga0373931_0000219 Ga0373931_0000219_14593_15519 305
121 3300045051 Ga0451576_0027529 Ga0451576_0027529_4561_5487 305
122 3300045051 Ga0451576_0030696 Ga0451576_0030696_553_1479 305
123 3300046454 Ga0495592_0155941 Ga0495592_0155941_381_1337 305
124 3300046477 Ga0495664_0131124 Ga0495664_0131124_515_1471 305
125 3300046529 Ga0495652_0121797 Ga0495652_0121797_859_1815 305
126 3300046536 Ga0495587_0009425 Ga0495587_0009425_2492_3448 305
127 3300046559 Ga0495667_0021767 Ga0495667_0021767_1406_2362 305
128 3300046675 Ga0495657_0058695 Ga0495657_0058695_1200_2156 305
129 3300046678 Ga0495599_0017511 Ga0495599_0017511_2041_2997 305
130 3300046679 Ga0495623_0042262 Ga0495623_0042262_577_1533 305
131 3300047317 Ga0495604_0190945 Ga0495604_0190945_344_1300 305
132 iso_pu_bacteria 2926754445 2926760124 305
133 3300039450 Ga0436363_1379029 Ga0436363_1379029_31_1026 306
134 iso_pu_bacteria 2894232714 2894238115 306
135 3300005331 Ga0070670_100263249 Ga0070670_1002632492 308
136 3300005335 Ga0070666_10179699 Ga0070666_101796991 308
137 3300005338 Ga0068868_100323962 Ga0068868_1003239622 308
138 3300005344 Ga0070661_100272912 Ga0070661_1002729121 308
139 3300005364 Ga0070673_100078227 Ga0070673_1000782273 308
140 3300005365 Ga0070688_100140427 Ga0070688_1001404271 308
141 3300005543 Ga0070672_100207665 Ga0070672_1002076651 308
142 3300005615 Ga0070702_100202335 Ga0070702_1002023352 308
143 3300005618 Ga0068864_100212908 Ga0068864_1002129081 308
144 3300005718 Ga0068866_10082629 Ga0068866_100826292 308
145 3300005841 Ga0068863_100193985 Ga0068863_1001939851 308
146 3300005842 Ga0068858_100373794 Ga0068858_1003737941 308
147 3300005843 Ga0068860_100417519 Ga0068860_1004175191 308
148 3300006358 Ga0068871_100145647 Ga0068871_1001456472 308
149 3300009094 Ga0111539_10738483 Ga0111539_107384831 308
150 3300009098 Ga0105245_10315345 Ga0105245_103153452 308
151 3300009148 Ga0105243_10162006 Ga0105243_101620062 308
152 3300009176 Ga0105242_10215605 Ga0105242_102156052 308
153 3300009177 Ga0105248_10063971 Ga0105248_100639714 308
154 3300009553 Ga0105249_10250572 Ga0105249_102505721 308
155 3300013297 Ga0157378_10333690 Ga0157378_103336901 308
156 3300013306 Ga0163162_10164463 Ga0163162_101644632 308
157 3300013308 Ga0157375_10809002 Ga0157375_108090021 308
158 3300014325 Ga0163163_10041003 Ga0163163_100410034 308
159 3300014326 Ga0157380_10488867 Ga0157380_104888672 308
160 3300014745 Ga0157377_10094913 Ga0157377_100949132 308
161 3300014968 Ga0157379_10176331 Ga0157379_101763311 308
162 3300014969 Ga0157376_10093792 Ga0157376_100937922 308
163 3300017792 Ga0163161_10264596 Ga0163161_102645962 308
164 3300025923 Ga0207681_10087612 Ga0207681_100876122 308
165 3300025927 Ga0207687_10401561 Ga0207687_104015611 308
166 3300025936 Ga0207670_10291573 Ga0207670_102915731 308
167 3300025938 Ga0207704_10110312 Ga0207704_101103122 308
168 3300025940 Ga0207691_10073763 Ga0207691_100737632 308
169 3300026089 Ga0207648_10098095 Ga0207648_100980952 308
170 3300026095 Ga0207676_10264522 Ga0207676_102645221 308
171 3300026118 Ga0207675_100133276 Ga0207675_1001332762 308
172 3300026121 Ga0207683_10041084 Ga0207683_100410841 308
173 3300027471 Ga0209995_1001717 Ga0209995_10017172 308
174 3300027665 Ga0209983_1008336 Ga0209983_10083362 308
175 3300027876 Ga0209974_10003726 Ga0209974_100037265 308
176 3300028380 Ga0268265_10338018 Ga0268265_103380182 308
177 3300035691 Ga0373931_0090972 Ga0373931_0090972_708_1664 308
178 3300050511 nmdc:mga08y16_103198_c1 nmdc:mga08y16_103198_c1_139_1104 308
179 3300006871 Ga0075434_100000073 Ga0075434_10000007360 312
180 3300007076 Ga0075435_100028335 Ga0075435_1000283353 312
181 3300035116 Ga0373945_0071085 Ga0373945_0071085_152_1147 312
182 3300035695 Ga0373927_0013298 Ga0373927_0013298_1384_2379 312
183 3300037068 Ga0373925_0054752 Ga0373925_0054752_1374_2369 312
184 3300046459 Ga0495629_0170093 Ga0495629_0170093_153_1148 312
185 3300046476 Ga0495662_0013109 Ga0495662_0013109_1786_2781 312
186 3300046477 Ga0495664_0000473 Ga0495664_0000473_7439_8434 312
187 3300046514 Ga0495618_0068172 Ga0495618_0068172_765_1760 312
188 3300046517 Ga0495630_0128784 Ga0495630_0128784_76_1071 312
189 3300046529 Ga0495652_0065783 Ga0495652_0065783_1320_2315 312
190 3300046535 Ga0495586_0063207 Ga0495586_0063207_422_1417 312
191 3300046543 Ga0495645_0013255 Ga0495645_0013255_222_1217 312
192 3300046642 Ga0495634_0003099 Ga0495634_0003099_7056_8051 312
193 3300046663 Ga0495635_0000375 Ga0495635_0000375_2243_3238 312
194 3300046690 Ga0495624_0031067 Ga0495624_0031067_603_1598 312
195 3300047319 Ga0495674_0002065 Ga0495674_0002065_324_1319 312
196 3300047471 Ga0495684_0012832 Ga0495684_0012832_4919_5914 312
197 3300049742 Ga0501080_0003285 Ga0501080_0003285_10820_11776 312
198 3300050512 nmdc:mga0n895_15164_c1 nmdc:mga0n895_15164_c1_1271_2227 312
199 3300050513 nmdc:mga0rr50_955_c1 nmdc:mga0rr50_955_c1_8311_9267 312
200 3300050515 nmdc:mga0a205_179808_c1 nmdc:mga0a205_179808_c1_1031_1987 312
201 3300053077 Ga0495601_0093158 Ga0495601_0093158_746_1741 312
202 3300053078 Ga0495612_0000652 Ga0495612_0000652_4384_5379 312
203 3300053079 Ga0500610_0123732 Ga0500610_0123732_115_1119 312
204 3300053085 Ga0495619_0009712 Ga0495619_0009712_3337_4332 312
205 3300005458 Ga0070681_10039992 Ga0070681_100399923 313
206 3300006173 Ga0070716_100066260 Ga0070716_1000662602 313
207 3300006195 Ga0075366_10004370 Ga0075366_100043701 313
208 3300009093 Ga0105240_10116687 Ga0105240_101166872 313
209 3300009094 Ga0111539_10000288 Ga0111539_1000028820 313
210 3300025912 Ga0207707_10114125 Ga0207707_101141251 313
211 3300025929 Ga0207664_10091168 Ga0207664_100911683 313
212 3300025986 Ga0207658_10112737 Ga0207658_101127372 313
213 3300028800 Ga0265338_10117760 Ga0265338_101177602 313
214 3300031241 Ga0265325_10009273 Ga0265325_100092732 313
215 3300031249 Ga0265339_10000064 Ga0265339_1000006479 313
216 3300031595 Ga0265313_10000020 Ga0265313_1000002062 313
217 3300035691 Ga0373931_0117627 Ga0373931_0117627_498_1445 313
218 3300045976 Ga0466967_0012686 Ga0466967_0012686_5040_5999 313
219 3300050494 nmdc:mga06z11_151292_c1 nmdc:mga06z11_151292_c1_323_1264 313
220 3300050511 nmdc:mga08y16_752_c1 nmdc:mga08y16_752_c1_13115_14065 313
221 3300053131 Ga0500652_002017 Ga0500652_002017_150_1115 313
222 3300053730 Ga0500645_000078 Ga0500645_000078_8024_8989 313
223 3300005344 Ga0070661_100217906 Ga0070661_1002179062 314
224 3300005435 Ga0070714_100408266 Ga0070714_1004082662 314
225 3300005530 Ga0070679_100250482 Ga0070679_1002504821 314
226 3300005563 Ga0068855_100125900 Ga0068855_1001259005 314
227 3300005577 Ga0068857_100395650 Ga0068857_1003956502 314
228 3300005614 Ga0068856_100448281 Ga0068856_1004482812 314
229 3300005616 Ga0068852_100000654 Ga0068852_10000065414 314
230 3300009093 Ga0105240_10033241 Ga0105240_100332416 314
231 3300009551 Ga0105238_10061117 Ga0105238_100611173 314
232 3300013102 Ga0157371_10116250 Ga0157371_101162502 314
233 3300013105 Ga0157369_10002100 Ga0157369_100021005 314
234 3300013307 Ga0157372_10019363 Ga0157372_100193636 314
235 3300025913 Ga0207695_10401103 Ga0207695_104011032 314
236 3300025920 Ga0207649_10190348 Ga0207649_101903482 314
237 3300025921 Ga0207652_10453835 Ga0207652_104538351 314
238 3300025929 Ga0207664_10131007 Ga0207664_101310073 314
239 3300026142 Ga0207698_10041202 Ga0207698_100412022 314
240 3300005295 Ga0065707_10083489 Ga0065707_100834897 315
241 3300005330 Ga0070690_100005081 Ga0070690_1000050818 315
242 3300005334 Ga0068869_100001859 Ga0068869_10000185917 315
243 3300005336 Ga0070680_100092263 Ga0070680_1000922632 315
244 3300005337 Ga0070682_100034514 Ga0070682_1000345141 315
245 3300005338 Ga0068868_100012111 Ga0068868_1000121112 315
246 3300005340 Ga0070689_100000939 Ga0070689_1000009392 315
247 3300005343 Ga0070687_100000199 Ga0070687_1000001992 315
248 3300005353 Ga0070669_100306416 Ga0070669_1003064161 315
249 3300005440 Ga0070705_100003046 Ga0070705_1000030467 315
250 3300005441 Ga0070700_100021308 Ga0070700_1000213082 315
251 3300005458 Ga0070681_10167301 Ga0070681_101673012 315
252 3300005459 Ga0068867_100000824 Ga0068867_1000008242 315
253 3300005530 Ga0070679_100009445 Ga0070679_10000944513 315
254 3300005544 Ga0070686_100011913 Ga0070686_1000119132 315
255 3300005545 Ga0070695_100000728 Ga0070695_1000007283 315
256 3300005546 Ga0070696_100006658 Ga0070696_1000066584 315
257 3300005547 Ga0070693_100000072 Ga0070693_10000007223 315
258 3300005549 Ga0070704_100003550 Ga0070704_1000035504 315
259 3300005563 Ga0068855_100011949 Ga0068855_10001194913 315
260 3300005578 Ga0068854_100032767 Ga0068854_1000327673 315
261 3300005614 Ga0068856_100059045 Ga0068856_1000590453 315
262 3300005615 Ga0070702_100000084 Ga0070702_10000008417 315
263 3300005616 Ga0068852_100034748 Ga0068852_1000347484 315
264 3300005617 Ga0068859_100005387 Ga0068859_1000053874 315
265 3300005718 Ga0068866_10002137 Ga0068866_100021377 315
266 3300005842 Ga0068858_100105678 Ga0068858_1001056781 315
267 3300005843 Ga0068860_100017811 Ga0068860_1000178118 315
268 3300005844 Ga0068862_100009057 Ga0068862_1000090577 315
269 3300006237 Ga0097621_100000794 Ga0097621_10000079414 315
270 3300006358 Ga0068871_100040416 Ga0068871_1000404163 315
271 3300006844 Ga0075428_100015214 Ga0075428_1000152146 315
272 3300006881 Ga0068865_100008183 Ga0068865_1000081831 315
273 3300006931 Ga0097620_100005387 Ga0097620_1000053874 315
274 3300009092 Ga0105250_10045733 Ga0105250_100457332 315
275 3300009098 Ga0105245_10001603 Ga0105245_100016032 315
276 3300009148 Ga0105243_10001817 Ga0105243_1000181723 315
277 3300009176 Ga0105242_10003543 Ga0105242_100035436 315
278 3300010375 Ga0105239_10028862 Ga0105239_100288627 315
279 3300014326 Ga0157380_10055946 Ga0157380_100559463 315
280 3300025893 Ga0207682_10069293 Ga0207682_100692932 315
281 3300025899 Ga0207642_10000462 Ga0207642_1000046213 315
282 3300025904 Ga0207647_10139997 Ga0207647_101399971 315
283 3300025912 Ga0207707_10157789 Ga0207707_101577892 315
284 3300025917 Ga0207660_10002278 Ga0207660_1000227813 315
285 3300025918 Ga0207662_10015491 Ga0207662_100154912 315
286 3300025921 Ga0207652_10031211 Ga0207652_100312114 315
287 3300025923 Ga0207681_10184165 Ga0207681_101841652 315
288 3300025934 Ga0207686_10005522 Ga0207686_100055222 315
289 3300025936 Ga0207670_10011269 Ga0207670_100112693 315
290 3300025938 Ga0207704_10001219 Ga0207704_100012192 315
291 3300025942 Ga0207689_10002203 Ga0207689_100022031 315
292 3300025961 Ga0207712_10047904 Ga0207712_100479043 315
293 3300026041 Ga0207639_10029204 Ga0207639_100292042 315
294 3300026075 Ga0207708_10000164 Ga0207708_1000016434 315
295 3300026089 Ga0207648_10002874 Ga0207648_1000287423 315
296 3300026118 Ga0207675_100001661 Ga0207675_1000016614 315
297 3300026142 Ga0207698_10018613 Ga0207698_100186134 315
298 3300027907 Ga0207428_10001183 Ga0207428_100011833 315
299 3300028380 Ga0268265_10002260 Ga0268265_100022602 315
300 3300028381 Ga0268264_10001897 Ga0268264_1000189723 315
301 3300034816 Ga0373930_0002261 Ga0373930_0002261_1919_2884 315
302 3300035691 Ga0373931_0059134 Ga0373931_0059134_598_1563 315
303 3300005617 Ga0068859_100119947 Ga0068859_1001199473 316
304 3300005842 Ga0068858_100064072 Ga0068858_1000640722 316
305 3300006237 Ga0097621_100037041 Ga0097621_1000370413 316
306 3300006358 Ga0068871_100037263 Ga0068871_1000372632 316
307 3300006931 Ga0097620_100119945 Ga0097620_1001199452 316
308 3300009148 Ga0105243_10345805 Ga0105243_103458052 316
309 3300009177 Ga0105248_10442281 Ga0105248_104422812 316
310 3300013296 Ga0157374_10064400 Ga0157374_100644004 316
311 3300025905 Ga0207685_10038767 Ga0207685_100387671 316
312 3300025927 Ga0207687_10022407 Ga0207687_100224073 316
313 3300025934 Ga0207686_10081165 Ga0207686_100811652 316
314 3300006186 Ga0075369_10049988 Ga0075369_100499881 317
315 3300013306 Ga0163162_10155654 Ga0163162_101556542 317
316 3300014969 Ga0157376_10181537 Ga0157376_101815372 317
317 3300026118 Ga0207675_100440755 Ga0207675_1004407552 317
318 3300028794 Ga0307515_10190055 Ga0307515_101900552 317
319 3300050516 nmdc:mga0sz30_78107_c1 nmdc:mga0sz30_78107_c1_311_1273 317
320 3300053108 Ga0500562_020518 Ga0500562_020518_723_1688 317
321 iso_pu_bacteria 2841911363 2841914553 317
322 iso_pu_bacteria 2841917233 2841920282 317
323 3300005843 Ga0068860_100049428 Ga0068860_1000494282 318
324 3300006846 Ga0075430_100031263 Ga0075430_1000312633 318
325 3300006847 Ga0075431_100004522 Ga0075431_1000045222 318
326 3300006914 Ga0075436_100232184 Ga0075436_1002321842 318
327 3300044735 Ga0466968_0121105 Ga0466968_0121105_89_1066 318
328 3300047318 Ga0495636_0017371 Ga0495636_0017371_142_1119 318
329 3300025933 Ga0207706_10160664 Ga0207706_101606642 319
330 3300025944 Ga0207661_10114188 Ga0207661_101141885 319
331 3300035111 Ga0373923_0032981 Ga0373923_0032981_518_1492 319
332 3300035692 Ga0373935_0099756 Ga0373935_0099756_189_1163 319
333 3300035695 Ga0373927_0015370 Ga0373927_0015370_3631_4605 319
334 3300036401 Ga0373937_0333981 Ga0373937_0333981_125_1099 319
335 3300037068 Ga0373925_0096138 Ga0373925_0096138_1094_2059 319
336 3300037068 Ga0373925_0115963 Ga0373925_0115963_123_1097 319
337 3300037471 Ga0395905_0002866 Ga0395905_0002866_17767_18732 319
338 3300046683 Ga0495658_0069550 Ga0495658_0069550_525_1490 319
339 3300048907 Ga0496104_0009568 Ga0496104_0009568_2428_3393 319
340 3300048908 Ga0496105_0024505 Ga0496105_0024505_1759_2724 319
341 3300053148 Ga0500590_001662 Ga0500590_001662_2441_3409 319
342 3300053154 Ga0500619_000096 Ga0500619_000096_1780_2748 319
343 3300005328 Ga0070676_10036355 Ga0070676_100363551 320
344 3300005328 Ga0070676_10185380 Ga0070676_101853802 320
345 3300005329 Ga0070683_100000347 Ga0070683_10000034726 320
346 3300005331 Ga0070670_100000309 Ga0070670_10000030916 320
347 3300005331 Ga0070670_100199003 Ga0070670_1001990032 320
348 3300005333 Ga0070677_10004019 Ga0070677_100040192 320
349 3300005333 Ga0070677_10054342 Ga0070677_100543421 320
350 3300005334 Ga0068869_100045994 Ga0068869_1000459942 320
351 3300005335 Ga0070666_10002081 Ga0070666_1000208112 320
352 3300005338 Ga0068868_100000930 Ga0068868_1000009305 320
353 3300005338 Ga0068868_100005400 Ga0068868_1000054002 320
354 3300005344 Ga0070661_100001422 Ga0070661_1000014224 320
355 3300005347 Ga0070668_100063383 Ga0070668_1000633833 320
356 3300005354 Ga0070675_100000049 Ga0070675_10000004956 320
357 3300005354 Ga0070675_100000926 Ga0070675_10000092616 320
358 3300005355 Ga0070671_100000137 Ga0070671_10000013726 320
359 3300005364 Ga0070673_100000394 Ga0070673_1000003949 320
360 3300005366 Ga0070659_100062258 Ga0070659_1000622583 320
361 3300005367 Ga0070667_100013715 Ga0070667_1000137156 320
362 3300005367 Ga0070667_100175560 Ga0070667_1001755602 320
363 3300005444 Ga0070694_100095420 Ga0070694_1000954202 320
364 3300005456 Ga0070678_100000771 Ga0070678_10000077114 320
365 3300005457 Ga0070662_100056003 Ga0070662_1000560033 320
366 3300005457 Ga0070662_100131172 Ga0070662_1001311722 320
367 3300005459 Ga0068867_100004978 Ga0068867_1000049784 320
368 3300005466 Ga0070685_10026991 Ga0070685_100269913 320
369 3300005535 Ga0070684_100089855 Ga0070684_1000898553 320
370 3300005547 Ga0070693_100108500 Ga0070693_1001085002 320
371 3300005548 Ga0070665_100069685 Ga0070665_1000696852 320
372 3300005548 Ga0070665_100308262 Ga0070665_1003082622 320
373 3300005564 Ga0070664_100000054 Ga0070664_10000005424 320
374 3300005578 Ga0068854_100000714 Ga0068854_10000071414 320
375 3300005616 Ga0068852_100000065 Ga0068852_10000006526 320
376 3300005618 Ga0068864_100001420 Ga0068864_10000142016 320
377 3300005618 Ga0068864_100003720 Ga0068864_1000037204 320
378 3300005719 Ga0068861_100050276 Ga0068861_1000502763 320
379 3300005834 Ga0068851_10001105 Ga0068851_100011055 320
380 3300005841 Ga0068863_100024030 Ga0068863_1000240306 320
381 3300005841 Ga0068863_100087722 Ga0068863_1000877223 320
382 3300005842 Ga0068858_100001292 Ga0068858_10000129216 320
383 3300005843 Ga0068860_100133462 Ga0068860_1001334623 320
384 3300005844 Ga0068862_100149038 Ga0068862_1001490382 320
385 3300006051 Ga0075364_10017505 Ga0075364_100175055 320
386 3300006237 Ga0097621_100000051 Ga0097621_10000005156 320
387 3300006237 Ga0097621_100072303 Ga0097621_1000723033 320
388 3300006358 Ga0068871_100001133 Ga0068871_1000011334 320
389 3300006881 Ga0068865_100054894 Ga0068865_1000548944 320
390 3300009177 Ga0105248_10142497 Ga0105248_101424973 320
391 3300009177 Ga0105248_10170421 Ga0105248_101704213 320
392 3300013296 Ga0157374_10343763 Ga0157374_103437633 320
393 3300014325 Ga0163163_10002538 Ga0163163_1000253812 320
394 3300014968 Ga0157379_10078851 Ga0157379_100788513 320
395 3300014969 Ga0157376_10021252 Ga0157376_100212522 320
396 3300017792 Ga0163161_10130729 Ga0163161_101307292 320
397 3300025321 Ga0207656_10002656 Ga0207656_100026565 320
398 3300025903 Ga0207680_10022089 Ga0207680_100220894 320
399 3300025920 Ga0207649_10002872 Ga0207649_100028724 320
400 3300025923 Ga0207681_10027388 Ga0207681_100273882 320
401 3300025925 Ga0207650_10000339 Ga0207650_1000033921 320
402 3300025926 Ga0207659_10001257 Ga0207659_100012572 320
403 3300025931 Ga0207644_10001499 Ga0207644_100014996 320
404 3300025933 Ga0207706_10268642 Ga0207706_102686421 320
405 3300025936 Ga0207670_10012105 Ga0207670_100121053 320
406 3300025938 Ga0207704_10037862 Ga0207704_100378622 320
407 3300025940 Ga0207691_10000147 Ga0207691_1000014733 320
408 3300025940 Ga0207691_10084386 Ga0207691_100843862 320
409 3300025940 Ga0207691_10167488 Ga0207691_101674882 320
410 3300025941 Ga0207711_10089291 Ga0207711_100892912 320
411 3300025941 Ga0207711_10351868 Ga0207711_103518681 320
412 3300025942 Ga0207689_10102265 Ga0207689_101022653 320
413 3300025944 Ga0207661_10001065 Ga0207661_1000106517 320
414 3300025945 Ga0207679_10000307 Ga0207679_1000030724 320
415 3300025960 Ga0207651_10000364 Ga0207651_100003643 320
416 3300025960 Ga0207651_10002644 Ga0207651_100026445 320
417 3300025960 Ga0207651_10390920 Ga0207651_103909202 320
418 3300025972 Ga0207668_10012084 Ga0207668_100120844 320
419 3300025981 Ga0207640_10000771 Ga0207640_1000077110 320
420 3300025986 Ga0207658_10002924 Ga0207658_1000292410 320
421 3300025986 Ga0207658_10009514 Ga0207658_100095146 320
422 3300026023 Ga0207677_10000130 Ga0207677_1000013024 320
423 3300026023 Ga0207677_10011733 Ga0207677_100117331 320
424 3300026035 Ga0207703_10001647 Ga0207703_1000164716 320
425 3300026088 Ga0207641_10002593 Ga0207641_1000259314 320
426 3300026088 Ga0207641_10091210 Ga0207641_100912103 320
427 3300026095 Ga0207676_10001498 Ga0207676_100014984 320
428 3300026095 Ga0207676_10014132 Ga0207676_100141324 320
429 3300026118 Ga0207675_100100994 Ga0207675_1001009943 320
430 3300026121 Ga0207683_10001384 Ga0207683_1000138415 320
431 3300026142 Ga0207698_10000135 Ga0207698_1000013525 320
432 3300028379 Ga0268266_10053080 Ga0268266_100530804 320
433 3300028379 Ga0268266_10303491 Ga0268266_103034912 320
434 3300028380 Ga0268265_10139537 Ga0268265_101395373 320
435 3300037312 Ga0395899_0008464 Ga0395899_0008464_5939_6919 320
436 3300037418 Ga0395900_0060255 Ga0395900_0060255_2324_3304 320
437 3300037418 Ga0395900_0072373 Ga0395900_0072373_2195_3175 320
438 3300037466 Ga0395898_0016461 Ga0395898_0016461_1066_2046 320
439 3300037471 Ga0395905_0062752 Ga0395905_0062752_2359_3339 320
440 3300037471 Ga0395905_0228468 Ga0395905_0228468_644_1624 320
441 3300038443 Ga0395901_0067500 Ga0395901_0067500_1792_2772 320
442 3300042008 Ga0439450_021813 Ga0439450_021813_76_1044 320
443 3300042461 Ga0439460_0006330 Ga0439460_0006330_1155_2123 320
444 3300048911 Ga0496108_0031269 Ga0496108_0031269_1051_2019 320
445 3300053088 Ga0500644_0000485 Ga0500644_0000485_5071_6057 320
446 3300053093 Ga0500651_0030627 Ga0500651_0030627_1981_2967 320
447 3300053096 Ga0500641_0070089 Ga0500641_0070089_142_1113 320
448 3300053119 Ga0500595_000003 Ga0500595_000003_91828_92823 320
449 3300053153 Ga0500616_0000002 Ga0500616_0000002_1272084_1273073 320
450 3300005347 Ga0070668_100033964 Ga0070668_1000339644 321
451 3300005547 Ga0070693_100171358 Ga0070693_1001713581 321
452 3300005618 Ga0068864_100166232 Ga0068864_1001662322 321
453 3300005841 Ga0068863_100465044 Ga0068863_1004650442 321
454 3300005843 Ga0068860_100020854 Ga0068860_1000208544 321
455 3300005844 Ga0068862_100123210 Ga0068862_1001232102 321
456 3300005983 Ga0081540_1024715 Ga0081540_10247153 321
457 3300026035 Ga0207703_10107768 Ga0207703_101077682 321
458 3300026088 Ga0207641_10029675 Ga0207641_100296753 321
459 3300026095 Ga0207676_10023435 Ga0207676_100234352 321
460 3300028380 Ga0268265_10072023 Ga0268265_100720232 321
461 3300028381 Ga0268264_10016306 Ga0268264_100163064 321
462 3300048912 Ga0496109_0297687 Ga0496109_0297687_359_1330 321
463 3300048914 Ga0496111_0100667 Ga0496111_0100667_833_1804 321
464 3300048915 Ga0496112_0000240 Ga0496112_0000240_2369_3340 321
465 3300005295 Ga0065707_10103539 Ga0065707_101035393 322
466 3300005329 Ga0070683_100004990 Ga0070683_1000049908 322
467 3300005367 Ga0070667_100132100 Ga0070667_1001321002 322
468 3300005530 Ga0070679_100285377 Ga0070679_1002853772 322
469 3300005844 Ga0068862_100033323 Ga0068862_1000333233 322
470 3300028379 Ga0268266_10116379 Ga0268266_101163792 322
471 3300049572 Ga0501036_0096587 Ga0501036_0096587_775_1761 322
472 3300049573 Ga0501037_0010018 Ga0501037_0010018_2189_3175 322
473 3300049574 Ga0501038_0199990 Ga0501038_0199990_144_1130 322
474 3300049575 Ga0501039_0052069 Ga0501039_0052069_1695_2681 322
475 3300049576 Ga0501040_0021383 Ga0501040_0021383_1825_2811 322
476 3300049577 Ga0501041_0218703 Ga0501041_0218703_52_1038 322
477 3300049579 Ga0501043_0064707 Ga0501043_0064707_1637_2623 322
478 3300049580 Ga0501046_0362199 Ga0501046_0362199_36_1022 322
479 3300049591 Ga0501075_0331119 Ga0501075_0331119_20_1006 322
480 3300049592 Ga0501076_0000731 Ga0501076_0000731_6990_7976 322
481 3300049741 Ga0501079_0007561 Ga0501079_0007561_6829_7815 322
482 3300049743 Ga0501081_0000115 Ga0501081_0000115_26620_27606 322
483 3300054114 Ga0501084_0167016 Ga0501084_0167016_251_1237 322
484 3300060353 Ga0501082_0008698 Ga0501082_0008698_6837_7823 322
485 3300005841 Ga0068863_100369378 Ga0068863_1003693782 323
486 3300005843 Ga0068860_100269120 Ga0068860_1002691202 323
487 3300005844 Ga0068862_100044081 Ga0068862_1000440813 323
488 3300005844 Ga0068862_100128818 Ga0068862_1001288182 323
489 3300009093 Ga0105240_10007799 Ga0105240_100077992 323
490 3300009177 Ga0105248_10064605 Ga0105248_100646053 323
491 3300013296 Ga0157374_10000144 Ga0157374_1000014424 323
492 3300013297 Ga0157378_10004938 Ga0157378_100049387 323
493 3300013306 Ga0163162_10043379 Ga0163162_100433793 323
494 3300013308 Ga0157375_10000528 Ga0157375_1000052811 323
495 3300014745 Ga0157377_10018832 Ga0157377_100188324 323
496 3300014969 Ga0157376_10018401 Ga0157376_100184014 323
497 3300025913 Ga0207695_10116254 Ga0207695_101162542 323
498 3300025926 Ga0207659_10423723 Ga0207659_104237231 323
499 3300031730 Ga0307516_10000398 Ga0307516_1000039842 323
500 3300045836 Ga0466958_0046506 Ga0466958_0046506_1025_2020 323
501 3300046531 Ga0495665_0066777 Ga0495665_0066777_160_1155 323
502 3300046642 Ga0495634_0002152 Ga0495634_0002152_475_1470 323
503 3300047471 Ga0495684_0020663 Ga0495684_0020663_3591_4586 323
504 3300048903 Ga0496100_0199232 Ga0496100_0199232_21_1013 323
505 3300048911 Ga0496108_0014657 Ga0496108_0014657_4056_5048 323
506 3300048912 Ga0496109_0000996 Ga0496109_0000996_19746_20738 323
507 3300048913 Ga0496110_0000396 Ga0496110_0000396_3262_4254 323
508 3300048914 Ga0496111_0020711 Ga0496111_0020711_3466_4458 323
509 3300050493 nmdc:mga0k408_13046_c1 nmdc:mga0k408_13046_c1_23_1018 323
510 3300053085 Ga0495619_0074994 Ga0495619_0074994_271_1266 323
511 3300053094 Ga0500566_0019839 Ga0500566_0019839_274_1278 323
512 3300053139 Ga0500568_0005169 Ga0500568_0005169_3492_4472 323
513 3300061719 Ga0466962_0053207 Ga0466962_0053207_65_1060 323
514 3300005364 Ga0070673_100146302 Ga0070673_1001463022 324
515 3300005548 Ga0070665_100095868 Ga0070665_1000958685 324
516 3300046539 Ga0495621_0004590 Ga0495621_0004590_560_1576 324
517 3300005436 Ga0070713_100114554 Ga0070713_1001145541 325
518 3300031649 Ga0307514_10000810 Ga0307514_1000081017 326
519 3300053117 Ga0500593_000105 Ga0500593_000105_22752_23750 326
520 3300005333 Ga0070677_10105483 Ga0070677_101054831 327
521 3300005347 Ga0070668_100151436 Ga0070668_1001514362 327
522 3300017792 Ga0163161_10049347 Ga0163161_100493475 327
523 3300026142 Ga0207698_10258721 Ga0207698_102587211 327
524 3300050509 nmdc:mga0qj67_27643_c1 nmdc:mga0qj67_27643_c1_859_1938 327
525 3300050510 nmdc:mga06r32_13036_c1 nmdc:mga06r32_13036_c1_3027_4106 327
526 3300028794 Ga0307515_10001078 Ga0307515_100010782 328
527 3300028794 Ga0307515_10333826 Ga0307515_103338262 328
528 3300031456 Ga0307513_10155353 Ga0307513_101553532 328
529 3300050491 nmdc:mga00v17_177919_c1 nmdc:mga00v17_177919_c1_129_1148 328
530 3300041512 Ga0451853_1556115 Ga0451853_1556115_690_1691 330
531 iso_pu_bacteria 2643221654 2644301195 330
532 iso_pu_bacteria 2885192300 2885193742 334
533 3300006353 Ga0075370_10073897 Ga0075370_100738972 336
534 3300050493 nmdc:mga0k408_21732_c1 nmdc:mga0k408_21732_c1_1889_2953 336
535 3300050496 nmdc:mga07m45_5833_c1 nmdc:mga07m45_5833_c1_4290_5354 336
536 3300042185 Ga0450909_002696 Ga0450909_002696_1219_2232 337
537 3300026121 Ga0207683_10082720 Ga0207683_100827203 338
538 3300041404 Ga0439436_0020543 Ga0439436_0020543_603_1619 338
539 3300041407 Ga0439447_012370 Ga0439447_012370_741_1757 338
540 3300041999 Ga0439433_0024380 Ga0439433_0024380_80_1096 338
541 3300042002 Ga0439442_005001 Ga0439442_005001_110_1126 338
542 3300042006 Ga0439432_004431 Ga0439432_004431_3677_4693 338
543 3300042007 Ga0439449_0020184 Ga0439449_0020184_1307_2323 338
544 3300042010 Ga0439452_000966 Ga0439452_000966_1949_2965 338
545 3300042156 Ga0439446_0000468 Ga0439446_0000468_830_1846 338
546 3300042435 Ga0439434_0003711 Ga0439434_0003711_359_1375 338
547 3300005364 Ga0070673_100127486 Ga0070673_1001274862 339
548 3300005548 Ga0070665_100002809 Ga0070665_1000028099 339
549 3300014497 Ga0182008_10047877 Ga0182008_100478772 339
550 3300015262 Ga0182007_10000741 Ga0182007_100007419 339
551 3300015265 Ga0182005_1025689 Ga0182005_10256891 339
552 3300025923 Ga0207681_10274913 Ga0207681_102749132 339
553 3300028794 Ga0307515_10001329 Ga0307515_1000132942 339
554 3300041407 Ga0439447_021533 Ga0439447_021533_216_1235 339
555 3300042007 Ga0439449_0006207 Ga0439449_0006207_2374_3393 339
556 3300046522 Ga0495643_0064099 Ga0495643_0064099_273_1292 339
557 3300046615 Ga0495656_0151071 Ga0495656_0151071_75_1094 339
558 3300006048 Ga0075363_100035363 Ga0075363_1000353633 340
559 3300006177 Ga0075362_10009787 Ga0075362_100097874 340
560 3300041404 Ga0439436_0008426 Ga0439436_0008426_717_1739 340
561 3300041405 Ga0439438_015880 Ga0439438_015880_1035_2057 340
562 3300042128 Ga0450897_002057 Ga0450897_002057_350_1372 340
563 3300050489 nmdc:mga03683_2590_c2 nmdc:mga03683_2590_c2_1420_2442 340
564 3300050490 nmdc:mga03n38_13587_c1 nmdc:mga03n38_13587_c1_366_1388 340
565 3300003784 Ga0055534_1002254 Ga0055534_10022547 344
566 3300003792 Ga0055540_1019252 Ga0055540_10192523 344
567 3300025291 Ga0209675_1008603 Ga0209675_10086033 344
568 3300025292 Ga0209676_1008732 Ga0209676_10087323 344
569 3300025295 Ga0209564_1033405 Ga0209564_10334051 344
570 3300025298 Ga0209050_1018234 Ga0209050_10182344 344
571 3300025303 Ga0209051_1006725 Ga0209051_10067252 344
572 3300025304 Ga0209257_1009876 Ga0209257_10098763 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

82

355

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9458 44 344
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9427 44 344
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9376 43 344
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9368 47 344
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9345 43 344
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9591 143 265 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9471 143 269 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9409 144 269 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.933 43 344 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9325 143 269 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6P3Z6M4-F1-model_v4 Uncharacterized protein LOC107407903 0.97 72 344
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9693 72 344
AF-A0A1F4DIF3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9665 138 344
AF-H0BVV3-F1-model_v4 Uncharacterized protein 0.9657 40 344
AF-A0A536XGM1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9634 44 344

Feature Viewer

pLDDT pTM Quality
88.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map