F465101

General Info

Members Datasets Scaffolds Average Seq Length
572 303 1144 136

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0087135|Ga0466972_0087135_838_1335
Length 155
Sequence MDRYCNFRGTTPDPRPNSLGADRHDIVRQSNVTEIRRGTLQEQTFYEQVGGEETFRRLVHRLRAMYPEEDLGPAEERLRLFLMQYWGGPTTYSDQRGHPRLRMRHAPFRVDRAAHDAWLRHMRVAVEELGLSQEHEQTLWNYLTYAAASMVNTPD

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
35 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
41 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
45 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
51 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
52 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
73 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
74 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
77 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
84 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
85 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
89 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
90 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
91 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
92 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
93 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
94 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
95 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
98 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
189 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
190 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
191 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
223 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
233 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
237 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
238 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
239 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
240 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
241 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
242 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
243 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
244 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
245 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
251 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
254 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
257 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
261 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
262 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
263 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
264 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
265 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
266 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
267 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
268 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
269 2643221647 Streptomyces sp. Root369 Isolate Unclassified
270 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
271 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
272 2643221714 Streptomyces sp. Root264 Isolate Unclassified
273 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
274 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
275 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
276 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
277 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
278 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
279 2808606448 Streptomyces sp. 193411 Isolate Unclassified
280 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
281 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
282 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
283 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
284 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
285 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
286 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
287 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
288 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
289 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
290 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
291 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
292 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
293 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
294 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
295 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
296 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
297 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
298 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
299 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
300 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
301 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
302 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
303 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.66
Metatranscriptomes 0.17
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0
Rhizoplane 1.4
Rhizosphere 78.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0087135 3300044658 Bacteria 1483
2 JGI24737J22298_10031628 3300001990 Bacteria 1651
3 JGI24735J21928_10139828 3300002067 Bacteria 698
4 JGI24738J21930_10007520 3300002075 Bacteria 2509
5 rootL2_10051507 3300003322 Bacteria 1445
6 rootL2_10328345 3300003322 Bacteria 1382
7 JGI25160J50197_1018539 3300003354 Bacteria 2164
8 JGI25160J50197_1022754 3300003354 Bacteria 1829
9 Ga0006562J51391_1211630 3300003578 Bacteria 1970
10 Ga0070685_10019508 3300005466 Bacteria 3659
11 Ga0070707_101499757 3300005468 Bacteria 641
12 Ga0068853_100032787 3300005539 Bacteria 4403
13 Ga0070665_100124744 3300005548 Bacteria 2577
14 Ga0070665_100669691 3300005548 Bacteria 1051
15 Ga0068855_100296104 3300005563 Bacteria 1793
16 Ga0068856_100112965 3300005614 Bacteria 2714
17 Ga0081539_10001651 3300005985 Bacteria 36188
18 Ga0081539_10004409 3300005985 Bacteria 15586
19 Ga0081539_10047933 3300005985 Bacteria 2435
20 Ga0075365_10423656 3300006038 Bacteria 940
21 Ga0075368_10017586 3300006042 Bacteria 2678
22 Ga0075363_100103146 3300006048 Bacteria 1580
23 Ga0075363_100243268 3300006048 Bacteria 1035
24 Ga0075367_10027975 3300006178 Bacteria 3212
25 Ga0105251_10377380 3300009011 Bacteria 649
26 Ga0105250_10212350 3300009092 Bacteria 818
27 Ga0105245_10732445 3300009098 Bacteria 1024
28 Ga0105245_12750188 3300009098 Bacteria 545
29 Ga0105243_12907011 3300009148 Bacteria 519
30 Ga0105248_10511358 3300009177 Bacteria 1354
31 Ga0105239_12773017 3300010375 Bacteria 572
32 Ga0105246_10016296 3300011119 Bacteria 4704
33 Ga0105246_10927782 3300011119 Bacteria 783
34 Ga0105246_11175003 3300011119 Bacteria 705
35 Ga0157369_11177482 3300013105 Bacteria 783
36 Ga0157372_10022209 3300013307 Bacteria 6864
37 Ga0157375_11795519 3300013308 Bacteria 727
38 Ga0182008_10030327 3300014497 Bacteria 2726
39 Ga0182005_1049655 3300015265 Bacteria 1141
40 Ga0183367_1006 3300015688 Bacteria 648044
41 Ga0213875_10090587 3300021388 Bacteria 1426
42 Ga0209758_1029968 3300025297 Bacteria 2262
43 Ga0207426_1004635 3300025302 Bacteria 6612
44 Ga0207426_1009919 3300025302 Bacteria 3732
45 Ga0207426_1013702 3300025302 Bacteria 2992
46 Ga0207426_1027102 3300025302 Bacteria 1913
47 Ga0207647_10057238 3300025904 Bacteria 2390
48 Ga0207709_10061884 3300025935 Bacteria 2340
49 Ga0207661_10187573 3300025944 Bacteria 1811
50 Ga0207667_10108355 3300025949 Bacteria 2866
51 Ga0207667_10780190 3300025949 Bacteria 953
52 Ga0207702_10302308 3300026078 Bacteria 1519
53 Ga0207702_10388829 3300026078 Bacteria 1343
54 Ga0209813_10009936 3300027866 Bacteria 2449
55 Ga0268266_10106087 3300028379 Bacteria 2483
56 Ga0268266_10316347 3300028379 Bacteria 1460
57 Ga0268266_10523431 3300028379 Bacteria 1134
58 Ga0307517_10137262 3300028786 Bacteria 1733
59 Ga0307515_10000217 3300028794 Bacteria 142129
60 Ga0307515_10036823 3300028794 Bacteria 7898
61 Ga0307515_10055762 3300028794 Bacteria 5764
62 Ga0307515_10114696 3300028794 Bacteria 3111
63 Ga0268256_1100618 3300030500 Bacteria 514
64 Ga0307511_10001726 3300030521 Bacteria 23009
65 Ga0307511_10086107 3300030521 Bacteria 2167
66 Ga0307512_10019566 3300030522 Bacteria 6157
67 Ga0307512_10053966 3300030522 Bacteria 3188
68 Ga0307513_10002913 3300031456 Bacteria 23397
69 Ga0307513_10750553 3300031456 Bacteria 681
70 Ga0307509_10082770 3300031507 Bacteria 3310
71 Ga0307509_10106088 3300031507 Bacteria 2829
72 Ga0307509_10149396 3300031507 Bacteria 2256
73 Ga0307509_10162738 3300031507 Bacteria 2126
74 Ga0307408_100326109 3300031548 Bacteria 1295
75 Ga0307508_10012505 3300031616 Bacteria 7760
76 Ga0307508_10028856 3300031616 Bacteria 5015
77 Ga0307508_10096352 3300031616 Bacteria 2550
78 Ga0307508_10258751 3300031616 Bacteria 1335
79 Ga0307514_10008172 3300031649 Bacteria 8937
80 Ga0307514_10048248 3300031649 Bacteria 3318
81 Ga0307514_10130756 3300031649 Bacteria 1729
82 Ga0307516_10014622 3300031730 Bacteria 8294
83 Ga0307516_10065401 3300031730 Bacteria 3512
84 Ga0307516_10200573 3300031730 Bacteria 1715
85 Ga0307516_10271865 3300031730 Bacteria 1380
86 Ga0307405_10132241 3300031731 Bacteria 1726
87 Ga0307518_10045256 3300031838 Bacteria 3200
88 Ga0307518_10111578 3300031838 Bacteria 1948
89 Ga0307518_10294041 3300031838 Bacteria 993
90 Ga0307410_10069361 3300031852 Bacteria 2438
91 Ga0307410_10793213 3300031852 Bacteria 805
92 Ga0307410_10947124 3300031852 Bacteria 740
93 Ga0307406_10224591 3300031901 Bacteria 1398
94 Ga0307406_11265698 3300031901 Bacteria 643
95 Ga0307407_10036590 3300031903 Bacteria 2706
96 Ga0307407_10324159 3300031903 Bacteria 1082
97 Ga0307412_10200541 3300031911 Bacteria 1515
98 Ga0307412_11307409 3300031911 Bacteria 653
99 Ga0307409_100033053 3300031995 Bacteria 3759
100 Ga0307409_100047609 3300031995 Bacteria 3256
101 Ga0307409_102026170 3300031995 Bacteria 605
102 Ga0307416_100244889 3300032002 Bacteria 1740
103 Ga0307414_10151903 3300032004 Bacteria 1828
104 Ga0307415_100116052 3300032126 Bacteria 1997
105 Ga0307415_100155078 3300032126 Bacteria 1767
106 Ga0307415_101003794 3300032126 Bacteria 776
107 Ga0307507_10000024 3300033179 Bacteria 212340
108 Ga0307507_10011377 3300033179 Bacteria 11234
109 Ga0307507_10166372 3300033179 Bacteria 1615
110 Ga0307507_10251740 3300033179 Bacteria 1140
111 Ga0307510_10010279 3300033180 Bacteria 11119
112 Ga0307510_10030450 3300033180 Bacteria 6117
113 Ga0307510_10152503 3300033180 Bacteria 1926
114 Ga0307510_10350310 3300033180 Bacteria 927
115 Ga0373951_0002010 3300035091 Bacteria 5210
116 Ga0395899_0305306 3300037312 Bacteria 1076
117 Ga0395900_0021078 3300037418 Bacteria 6660
118 Ga0395900_0139513 3300037418 Bacteria 2483
119 Ga0395900_0954175 3300037418 Bacteria 779
120 Ga0395898_0291948 3300037466 Bacteria 1555
121 Ga0395905_1266188 3300037471 Bacteria 641
122 Ga0436364_1145881 3300037853 Bacteria 9003
123 Ga0395901_0275011 3300038443 Bacteria 1751
124 Ga0439436_0029781 3300041404 Bacteria 1588
125 Ga0439436_0085960 3300041404 Bacteria 875
126 Ga0439439_0125035 3300041406 Bacteria 719
127 Ga0451791_0017613 3300041451 Bacteria 605
128 Ga0451791_1270819 3300041451 Bacteria 661
129 Ga0451837_1271608 3300041494 Bacteria 1032
130 Ga0451841_0472792 3300041498 Bacteria 987
131 Ga0451851_0839653 3300041507 Bacteria 1135
132 Ga0451843_0730873 3300041509 Bacteria 818
133 Ga0451853_0740061 3300041512 Bacteria 3191
134 Ga0451853_1732933 3300041512 Bacteria 774
135 Ga0439433_0002410 3300041999 Bacteria 3964
136 Ga0439442_117897 3300042002 Bacteria 580
137 Ga0439448_0022839 3300042005 Bacteria 1947
138 Ga0439448_0091741 3300042005 Bacteria 1027
139 Ga0439449_0008342 3300042007 Bacteria 3940
140 Ga0439449_0019768 3300042007 Bacteria 2524
141 Ga0439449_0133547 3300042007 Bacteria 923
142 Ga0439450_008948 3300042008 Bacteria 1885
143 Ga0439455_0004022 3300042012 Bacteria 2874
144 Ga0439457_000176 3300042014 Bacteria 16680
145 Ga0439457_009052 3300042014 Bacteria 2327
146 Ga0439462_0016866 3300042015 Bacteria 1890
147 Ga0439462_0026463 3300042015 Bacteria 1529
148 Ga0450920_034811 3300042122 Bacteria 997
149 Ga0450894_000702 3300042131 Bacteria 5542
150 Ga0450896_009739 3300042133 Bacteria 1342
151 Ga0450898_003091 3300042134 Bacteria 2365
152 Ga0450899_000150 3300042135 Bacteria 6647
153 Ga0450902_015305 3300042137 Bacteria 1244
154 Ga0450903_000386 3300042138 Bacteria 9543
155 Ga0450906_009107 3300042145 Bacteria 1901
156 Ga0450907_035902 3300042146 Bacteria 846
157 Ga0439458_0000278 3300042157 Bacteria 12665
158 Ga0450908_043038 3300042184 Bacteria 783
159 Ga0466969_0027397 3300044656 Bacteria 2918
160 Ga0466969_0086665 3300044656 Bacteria 1487
161 Ga0466969_0095011 3300044656 Bacteria 1409
162 Ga0466972_0000644 3300044658 Bacteria 16848
163 Ga0466972_0003515 3300044658 Bacteria 7779
164 Ga0466972_0080500 3300044658 Bacteria 1551
165 Ga0466972_0108052 3300044658 Bacteria 1315
166 Ga0466965_0014495 3300044683 Bacteria 3732
167 Ga0466965_0201328 3300044683 Bacteria 1056
168 Ga0466965_0790987 3300044683 Bacteria 548
169 Ga0466966_0009342 3300044684 Bacteria 6493
170 Ga0466966_0091647 3300044684 Bacteria 1886
171 Ga0466961_0002294 3300044693 Bacteria 11889
172 Ga0466961_0013311 3300044693 Bacteria 5266
173 Ga0466961_0074402 3300044693 Bacteria 2154
174 Ga0466961_0178163 3300044693 Bacteria 1320
175 Ga0466963_0001968 3300044694 Bacteria 11279
176 Ga0466963_0201198 3300044694 Bacteria 1393
177 Ga0466963_0648667 3300044694 Bacteria 745
178 Ga0466964_0022897 3300044706 Bacteria 2427
179 Ga0466964_0320398 3300044706 Bacteria 787
180 Ga0466971_0003897 3300044719 Bacteria 6395
181 Ga0466971_0015670 3300044719 Bacteria 3339
182 Ga0466971_0080399 3300044719 Bacteria 1486
183 Ga0466971_0113680 3300044719 Bacteria 1250
184 Ga0466968_0018283 3300044735 Bacteria 2811
185 Ga0466968_0336914 3300044735 Bacteria 731
186 Ga0466970_0026053 3300044765 Bacteria 3064
187 Ga0466970_0032886 3300044765 Bacteria 2740
188 Ga0466957_0000804 3300044842 Bacteria 15986
189 Ga0466957_0289521 3300044842 Bacteria 1098
190 Ga0466960_0009125 3300044901 Bacteria 4080
191 Ga0466959_0029330 3300045049 Bacteria 4076
192 Ga0466959_0256590 3300045049 Bacteria 1204
193 Ga0466958_0022417 3300045836 Bacteria 3699
194 Ga0466958_0074627 3300045836 Bacteria 2079
195 Ga0466958_0116685 3300045836 Bacteria 1669
196 Ga0466967_0001072 3300045976 Bacteria 15109
197 Ga0466967_0238385 3300045976 Bacteria 1734
198 Ga0466967_0254826 3300045976 Bacteria 1677
199 Ga0466967_0421093 3300045976 Bacteria 1302
200 Ga0495617_007903 3300046452 Bacteria 3679
201 Ga0495627_118841 3300046453 Bacteria 747
202 Ga0495627_165632 3300046453 Bacteria 614
203 Ga0495592_0005625 3300046454 Bacteria 9266
204 Ga0495592_0033579 3300046454 Bacteria 3869
205 Ga0495592_0298283 3300046454 Bacteria 1048
206 Ga0495603_0000398 3300046455 Bacteria 23881
207 Ga0495603_0005217 3300046455 Bacteria 7757
208 Ga0495603_0009751 3300046455 Bacteria 5811
209 Ga0495603_0015423 3300046455 Bacteria 4622
210 Ga0495603_0361699 3300046455 Bacteria 832
211 Ga0495590_0143792 3300046457 Bacteria 862
212 Ga0495629_0008562 3300046459 Bacteria 7534
213 Ga0495629_0022562 3300046459 Bacteria 4487
214 Ga0495629_0083408 3300046459 Bacteria 2230
215 Ga0495629_0128349 3300046459 Bacteria 1767
216 Ga0495629_0193189 3300046459 Bacteria 1408
217 Ga0495629_0254192 3300046459 Bacteria 1208
218 Ga0495629_0314760 3300046459 Bacteria 1070
219 Ga0495629_0320012 3300046459 Bacteria 1060
220 Ga0495638_0063807 3300046460 Bacteria 2270
221 Ga0495638_0094013 3300046460 Bacteria 1802
222 Ga0495638_0094117 3300046460 Bacteria 1801
223 Ga0495638_0106070 3300046460 Bacteria 1674
224 Ga0495641_0325411 3300046461 Bacteria 694
225 Ga0495641_0535947 3300046461 Bacteria 534
226 Ga0495651_0018198 3300046462 Bacteria 5439
227 Ga0495651_0094855 3300046462 Bacteria 2232
228 Ga0495651_0165654 3300046462 Bacteria 1579
229 Ga0495580_0927007 3300046472 Bacteria 558
230 Ga0495582_0038952 3300046473 Bacteria 2617
231 Ga0495582_0808108 3300046473 Bacteria 542
232 Ga0495605_0005439 3300046474 Bacteria 7416
233 Ga0495605_0182111 3300046474 Bacteria 923
234 Ga0495639_0004485 3300046475 Bacteria 5985
235 Ga0495662_0001937 3300046476 Bacteria 10393
236 Ga0495662_0673814 3300046476 Bacteria 504
237 Ga0495664_0002549 3300046477 Bacteria 9797
238 Ga0495664_0043088 3300046477 Bacteria 2674
239 Ga0495664_0530043 3300046477 Bacteria 702
240 Ga0495585_0150628 3300046492 Bacteria 1213
241 Ga0495585_0192560 3300046492 Bacteria 1042
242 Ga0495585_0330676 3300046492 Bacteria 743
243 Ga0495594_0008305 3300046499 Bacteria 5345
244 Ga0495594_0023474 3300046499 Bacteria 3306
245 Ga0495594_0031514 3300046499 Bacteria 2874
246 Ga0495594_0033923 3300046499 Bacteria 2776
247 Ga0495594_0062063 3300046499 Bacteria 2069
248 Ga0495594_0194115 3300046499 Bacteria 1157
249 Ga0495594_0873979 3300046499 Bacteria 505
250 Ga0495607_0033029 3300046501 Bacteria 3151
251 Ga0495607_0062976 3300046501 Bacteria 2100
252 Ga0495583_0048777 3300046506 Bacteria 1941
253 Ga0495583_0075464 3300046506 Bacteria 1474
254 Ga0495583_0140644 3300046506 Bacteria 1005
255 Ga0495606_0107437 3300046507 Bacteria 1688
256 Ga0495608_0047796 3300046511 Bacteria 2844
257 Ga0495610_0196531 3300046512 Bacteria 829
258 Ga0495618_0029331 3300046514 Bacteria 3433
259 Ga0495618_0161733 3300046514 Bacteria 1427
260 Ga0495618_0219202 3300046514 Bacteria 1200
261 Ga0495620_0013712 3300046515 Bacteria 4143
262 Ga0495628_0018410 3300046516 Bacteria 5786
263 Ga0495628_0084522 3300046516 Bacteria 2462
264 Ga0495628_0961392 3300046516 Bacteria 590
265 Ga0495630_0038888 3300046517 Bacteria 3558
266 Ga0495630_0188315 3300046517 Bacteria 1574
267 Ga0495632_0052518 3300046519 Bacteria 2004
268 Ga0495637_0023570 3300046520 Bacteria 2795
269 Ga0495643_0013911 3300046522 Bacteria 4798
270 Ga0495643_0018116 3300046522 Bacteria 4100
271 Ga0495644_0190730 3300046523 Bacteria 789
272 Ga0495648_0030767 3300046524 Bacteria 3544
273 Ga0495648_0199323 3300046524 Bacteria 1003
274 Ga0495648_0447238 3300046524 Bacteria 566
275 Ga0495666_0038452 3300046526 Bacteria 2326
276 Ga0495666_0158476 3300046526 Bacteria 1050
277 Ga0495666_0174723 3300046526 Bacteria 993
278 Ga0495642_0123217 3300046528 Bacteria 1113
279 Ga0495642_0450234 3300046528 Bacteria 569
280 Ga0495652_0004580 3300046529 Bacteria 13180
281 Ga0495652_0077196 3300046529 Bacteria 2762
282 Ga0495652_0171181 3300046529 Bacteria 1676
283 Ga0495654_0122557 3300046530 Bacteria 1175
284 Ga0495665_0636895 3300046531 Bacteria 531
285 Ga0495640_0071196 3300046533 Bacteria 2333
286 Ga0495640_0088579 3300046533 Bacteria 2045
287 Ga0495586_0749075 3300046535 Bacteria 564
288 Ga0495587_0027168 3300046536 Bacteria 3485
289 Ga0495609_0074848 3300046538 Bacteria 1484
290 Ga0495597_0168671 3300046542 Bacteria 890
291 Ga0495645_0075005 3300046543 Bacteria 2434
292 Ga0495645_0859916 3300046543 Bacteria 541
293 Ga0495622_0029084 3300046557 Bacteria 2581
294 Ga0495622_0060273 3300046557 Bacteria 1757
295 Ga0495622_0076675 3300046557 Bacteria 1540
296 Ga0495622_0208709 3300046557 Bacteria 868
297 Ga0495622_0328807 3300046557 Bacteria 663
298 Ga0495633_0064569 3300046558 Bacteria 1711
299 Ga0495633_0152963 3300046558 Bacteria 1065
300 Ga0495667_0169674 3300046559 Bacteria 1402
301 Ga0495668_0106957 3300046616 Bacteria 1530
302 Ga0495668_0308916 3300046616 Bacteria 867
303 Ga0495634_0008055 3300046642 Bacteria 7861
304 Ga0495634_0048328 3300046642 Bacteria 2864
305 Ga0495634_0261541 3300046642 Bacteria 1055
306 Ga0495634_0373112 3300046642 Bacteria 851
307 Ga0495611_0012959 3300046648 Bacteria 3545
308 Ga0495611_0029451 3300046648 Bacteria 2408
309 Ga0495611_0165427 3300046648 Bacteria 1034
310 Ga0495625_0243909 3300046660 Bacteria 1168
311 Ga0495635_0000663 3300046663 Bacteria 22092
312 Ga0495659_0068712 3300046664 Bacteria 1324
313 Ga0495661_0012138 3300046665 Bacteria 5821
314 Ga0495661_0573143 3300046665 Bacteria 532
315 Ga0495588_0027335 3300046674 Bacteria 2852
316 Ga0495588_0036505 3300046674 Bacteria 2494
317 Ga0495588_0058081 3300046674 Bacteria 1999
318 Ga0495588_0121023 3300046674 Bacteria 1379
319 Ga0495588_0168007 3300046674 Bacteria 1160
320 Ga0495657_0008429 3300046675 Bacteria 7882
321 Ga0495657_0013037 3300046675 Bacteria 6147
322 Ga0495657_0134415 3300046675 Bacteria 1546
323 Ga0495657_0197445 3300046675 Bacteria 1227
324 Ga0495599_0099097 3300046678 Bacteria 1816
325 Ga0495599_0450834 3300046678 Bacteria 762
326 Ga0495623_0132478 3300046679 Bacteria 1491
327 Ga0495623_0154244 3300046679 Bacteria 1355
328 Ga0495646_0001370 3300046680 Bacteria 14432
329 Ga0495646_0079440 3300046680 Bacteria 1915
330 Ga0495658_0024821 3300046683 Bacteria 3198
331 Ga0495658_0137592 3300046683 Bacteria 1491
332 Ga0495613_0010213 3300046689 Bacteria 6975
333 Ga0495613_0017770 3300046689 Bacteria 5299
334 Ga0495613_0051879 3300046689 Bacteria 3022
335 Ga0495613_0068123 3300046689 Bacteria 2596
336 Ga0495613_0095861 3300046689 Bacteria 2145
337 Ga0495624_0204346 3300046690 Bacteria 1199
338 Ga0495624_0377021 3300046690 Bacteria 852
339 Ga0495670_0003651 3300046691 Bacteria 7564
340 Ga0495670_0080902 3300046691 Bacteria 1655
341 Ga0495671_0042312 3300046692 Bacteria 2290
342 Ga0495671_0218488 3300046692 Bacteria 923
343 Ga0495649_0034943 3300046694 Bacteria 2764
344 Ga0495649_0041163 3300046694 Bacteria 2527
345 Ga0495649_0058589 3300046694 Bacteria 2075
346 Ga0495649_0117491 3300046694 Bacteria 1408
347 Ga0495589_0003392 3300046794 Bacteria 8638
348 Ga0495589_0027682 3300046794 Bacteria 2865
349 Ga0495589_0055525 3300046794 Bacteria 1951
350 Ga0495589_0066533 3300046794 Bacteria 1765
351 Ga0495589_0160672 3300046794 Bacteria 1070
352 Ga0495589_0296878 3300046794 Bacteria 749
353 Ga0495600_0026118 3300046809 Bacteria 3767
354 Ga0495600_0028391 3300046809 Bacteria 3619
355 Ga0495600_0061805 3300046809 Bacteria 2447
356 Ga0495600_0645172 3300046809 Bacteria 640
357 Ga0495660_0026647 3300046810 Bacteria 3275
358 Ga0495660_0078781 3300046810 Bacteria 1731
359 Ga0495660_0201291 3300046810 Bacteria 950
360 Ga0495581_0003465 3300047315 Bacteria 9055
361 Ga0495581_0152593 3300047315 Bacteria 1349
362 Ga0495581_0437255 3300047315 Bacteria 762
363 Ga0495581_0521151 3300047315 Bacteria 691
364 Ga0495604_0001796 3300047317 Bacteria 17472
365 Ga0495604_0004370 3300047317 Bacteria 11197
366 Ga0495604_0123014 3300047317 Bacteria 1875
367 Ga0495636_0000423 3300047318 Bacteria 15652
368 Ga0495636_0070194 3300047318 Bacteria 1494
369 Ga0495636_0204987 3300047318 Bacteria 901
370 Ga0495636_0302538 3300047318 Bacteria 748
371 Ga0495674_0256926 3300047319 Bacteria 1436
372 Ga0495674_0425639 3300047319 Bacteria 1069
373 Ga0495676_0001432 3300047321 Bacteria 20571
374 Ga0495676_0010104 3300047321 Bacteria 8570
375 Ga0495676_0036917 3300047321 Bacteria 4074
376 Ga0495676_0049573 3300047321 Bacteria 3374
377 Ga0495676_0070093 3300047321 Bacteria 2702
378 Ga0495676_0224892 3300047321 Bacteria 1291
379 Ga0495676_0448271 3300047321 Bacteria 851
380 Ga0495680_0078221 3300047322 Bacteria 2503
381 Ga0495680_0916721 3300047322 Bacteria 565
382 Ga0495683_0075788 3300047323 Bacteria 1647
383 Ga0495683_0163911 3300047323 Bacteria 1026
384 Ga0495683_0221793 3300047323 Bacteria 842
385 Ga0495687_003167 3300047443 Bacteria 12243
386 Ga0495687_003879 3300047443 Bacteria 10493
387 Ga0495687_014316 3300047443 Bacteria 4088
388 Ga0495687_038633 3300047443 Bacteria 2117
389 Ga0495687_110464 3300047443 Bacteria 1011
390 Ga0495675_0010867 3300047444 Bacteria 5704
391 Ga0495675_0019677 3300047444 Bacteria 4289
392 Ga0495675_0021467 3300047444 Bacteria 4112
393 Ga0495675_0255064 3300047444 Bacteria 1052
394 Ga0495675_0440234 3300047444 Bacteria 755
395 Ga0495677_0224465 3300047445 Bacteria 732
396 Ga0495677_0422168 3300047445 Bacteria 528
397 Ga0495679_124155 3300047446 Bacteria 704
398 Ga0495685_000202 3300047447 Bacteria 20068
399 Ga0495685_002443 3300047447 Bacteria 5820
400 Ga0495685_005413 3300047447 Bacteria 4167
401 Ga0495685_006771 3300047447 Bacteria 3764
402 Ga0495685_021427 3300047447 Bacteria 2223
403 Ga0495685_040627 3300047447 Bacteria 1590
404 Ga0495685_128895 3300047447 Bacteria 828
405 Ga0495681_0067933 3300047470 Bacteria 1623
406 Ga0495684_0904418 3300047471 Bacteria 568
407 Ga0495684_1046128 3300047471 Bacteria 516
408 Ga0495686_0029182 3300047472 Bacteria 3590
409 Ga0495686_0053382 3300047472 Bacteria 2533
410 Ga0495686_0200564 3300047472 Bacteria 1145
411 Ga0495593_0001327 3300047673 Bacteria 14482
412 Ga0495593_0012210 3300047673 Bacteria 4910
413 Ga0495593_0101191 3300047673 Bacteria 1478
414 Ga0495602_0025613 3300048088 Bacteria 5705
415 Ga0495614_0000845 3300048089 Bacteria 12953
416 Ga0495614_0001248 3300048089 Bacteria 10935
417 Ga0495614_0048405 3300048089 Bacteria 1822
418 Ga0495614_0108924 3300048089 Bacteria 1215
419 Ga0496100_1003440 3300048903 Bacteria 657
420 Ga0496108_0250113 3300048911 Bacteria 1542
421 Ga0496110_0737571 3300048913 Bacteria 888
422 Ga0496112_0810495 3300048915 Bacteria 861
423 Ga0496113_1464778 3300048916 Bacteria 528
424 Ga0496114_0327546 3300048917 Bacteria 1354
425 Ga0496125_0174559 3300048928 Bacteria 1440
426 Ga0501031_0012593 3300049568 Bacteria 5524
427 Ga0501031_0190017 3300049568 Bacteria 1341
428 Ga0501031_0242209 3300049568 Bacteria 1172
429 Ga0501031_0527054 3300049568 Bacteria 761
430 Ga0501032_0200235 3300049569 Bacteria 1303
431 Ga0501032_0844560 3300049569 Bacteria 577
432 Ga0501033_0001718 3300049570 Bacteria 19163
433 Ga0501033_0008612 3300049570 Bacteria 7895
434 Ga0501033_0070946 3300049570 Bacteria 2559
435 Ga0501034_0024668 3300049571 Bacteria 6115
436 Ga0501034_0040299 3300049571 Bacteria 4727
437 Ga0501034_0057689 3300049571 Bacteria 3903
438 Ga0501034_0302859 3300049571 Bacteria 1535
439 Ga0501036_0014265 3300049572 Bacteria 6610
440 Ga0501036_0042974 3300049572 Bacteria 3826
441 Ga0501036_0064870 3300049572 Bacteria 3090
442 Ga0501036_0072488 3300049572 Bacteria 2911
443 Ga0501036_0277347 3300049572 Bacteria 1403
444 Ga0501037_0012198 3300049573 Bacteria 6325
445 Ga0501037_0037320 3300049573 Bacteria 3582
446 Ga0501037_0113393 3300049573 Bacteria 1952
447 Ga0501037_0178635 3300049573 Bacteria 1507
448 Ga0501038_0008487 3300049574 Bacteria 9445
449 Ga0501038_0052172 3300049574 Bacteria 3527
450 Ga0501039_0002172 3300049575 Bacteria 14491
451 Ga0501039_0022011 3300049575 Bacteria 4892
452 Ga0501042_0077941 3300049578 Bacteria 2373
453 Ga0501043_0018783 3300049579 Bacteria 5425
454 Ga0501043_0050823 3300049579 Bacteria 3258
455 Ga0501043_0083738 3300049579 Bacteria 2507
456 Ga0501043_0107968 3300049579 Bacteria 2186
457 Ga0501043_1310386 3300049579 Bacteria 505
458 Ga0501046_0010171 3300049580 Bacteria 8094
459 Ga0501047_0000025 3300049581 Bacteria 225560
460 Ga0501047_0006111 3300049581 Bacteria 11315
461 Ga0501047_0103488 3300049581 Bacteria 2727
462 Ga0501047_0111554 3300049581 Bacteria 2617
463 Ga0501047_0538560 3300049581 Bacteria 992
464 Ga0501048_0079978 3300049582 Bacteria 2306
465 Ga0501068_0079257 3300049584 Bacteria 2014
466 Ga0501069_0621220 3300049585 Bacteria 649
467 Ga0501070_0029580 3300049586 Bacteria 4591
468 Ga0501070_0137778 3300049586 Bacteria 2015
469 Ga0501070_0254901 3300049586 Bacteria 1435
470 Ga0501070_0543381 3300049586 Bacteria 931
471 Ga0501073_0118627 3300049589 Bacteria 1834
472 Ga0501074_1173261 3300049590 Bacteria 539
473 Ga0501223_049858 3300049663 Bacteria 813
474 Ga0501235_066932 3300049669 Bacteria 846
475 Ga0501080_0231972 3300049742 Bacteria 1687
476 Ga0501083_0994746 3300049744 Bacteria 546
477 Ga0501282_013173 3300049778 Bacteria 895
478 Ga0501035_0002135 3300049822 Bacteria 19677
479 Ga0501035_0024363 3300049822 Bacteria 5550
480 Ga0501035_0026852 3300049822 Bacteria 5265
481 Ga0501035_0077074 3300049822 Bacteria 2946
482 Ga0501035_0116523 3300049822 Bacteria 2338
483 Ga0501035_1381782 3300049822 Bacteria 540
484 Ga0501044_0000330 3300049823 Bacteria 59751
485 Ga0501044_0014074 3300049823 Bacteria 8639
486 Ga0501044_0122623 3300049823 Bacteria 2598
487 Ga0501044_0854133 3300049823 Bacteria 787
488 Ga0501044_1639874 3300049823 Bacteria 508
489 Ga0501045_0399253 3300049824 Bacteria 1023
490 nmdc:mga03n38_76274_c1 3300050490 Bacteria 1564
491 nmdc:mga0yw44_88444_c1 3300050492 Bacteria 1953
492 nmdc:mga06z11_55294_c1 3300050494 Bacteria 2049
493 nmdc:mga04h51_11633_c1 3300050495 Bacteria 2448
494 nmdc:mga07m45_243680_c1 3300050496 Bacteria 1046
495 nmdc:mga07m45_277956_c1 3300050496 Bacteria 974
496 Ga0495619_0207935 3300053085 Bacteria 1355
497 Ga0500578_0003672 3300053086 Bacteria 11356
498 Ga0500644_0024271 3300053088 Bacteria 1851
499 Ga0500583_0429180 3300053092 Bacteria 630
500 Ga0500566_0035483 3300053094 Bacteria 2898
501 Ga0500640_002129 3300053095 Bacteria 6415
502 Ga0500660_021574 3300053100 Bacteria 3425
503 Ga0500569_004867 3300053109 Bacteria 2855
504 Ga0500572_004958 3300053111 Bacteria 3012
505 Ga0500614_031756 3300053123 Bacteria 1296
506 Ga0500628_000910 3300053129 Bacteria 5215
507 Ga0500652_016501 3300053131 Bacteria 2688
508 Ga0500658_0029331 3300053134 Bacteria 2139
509 Ga0500561_0004818 3300053137 Bacteria 2462
510 Ga0500573_0024638 3300053140 Bacteria 3459
511 Ga0500573_0031269 3300053140 Bacteria 3072
512 Ga0500579_121740 3300053143 Bacteria 1262
513 Ga0500586_040802 3300053145 Bacteria 1574
514 Ga0500588_0350117 3300053146 Bacteria 561
515 Ga0500600_0019003 3300053149 Bacteria 4137
516 Ga0500600_0110766 3300053149 Bacteria 1432
517 Ga0500600_0191025 3300053149 Bacteria 975
518 Ga0500600_0245559 3300053149 Bacteria 806
519 Ga0500606_243243 3300053152 Bacteria 527
520 Ga0500616_0081061 3300053153 Bacteria 1630
521 Ga0500624_003306 3300053157 Bacteria 2119
522 Ga0500633_0144325 3300053160 Bacteria 891
523 Ga0500634_0035634 3300053161 Bacteria 2710
524 Ga0500634_0170382 3300053161 Bacteria 993
525 Ga0500636_0253805 3300053177 Bacteria 895
526 Ga0500636_0392383 3300053177 Bacteria 647
527 Ga0500656_001986 3300053732 Bacteria 1817
528 Ga0500587_001038 3300053739 Bacteria 3775
529 Ga0466962_0003682 3300061719 Bacteria 7303
530 Ga0466962_0041978 3300061719 Bacteria 2189
531 Ga0466962_0364571 3300061719 Bacteria 720
532 2515720883 2515154129 Bacteria 5584369
533 2516082629 2515154202 Bacteria 5471270
534 2516091791 2515154203 Bacteria 5458536
535 2547406900 2547132111 Bacteria 8013147
536 2585309151 2582581313 Bacteria 10042643
537 2585319352 2582581314 Bacteria 11452267
538 2644263143 2643221647 Bacteria 10741251
539 2644382538 2643221669 Bacteria 3611286
540 2644436465 2643221678 Bacteria 9540101
541 2644625694 2643221714 Bacteria 9015452
542 2784587935 2784132148 Bacteria 8627943
543 2785344200 2784746763 Bacteria 9783172
544 2785368674 2784746768 Bacteria 10036182
545 2786669787 2786546132 Bacteria 10419719
546 2808841354 2808606359 Bacteria 9866990
547 2808919886 2808606375 Bacteria 9466072
548 2809231531 2808606448 Bacteria 8656184
549 2812358898 2811994879 Bacteria 9313447
550 2812481167 2811994917 Bacteria 7761064
551 2862184824 2862178590 Bacteria 8583590
552 2877681828 2877676314 Bacteria 9512378
553 2946066986 2946064051 Bacteria 8957905
554 2946075291 2946072368 Bacteria 8999607
555 2947230248 2947224130 Bacteria 9938529
556 2954386973 2954380949 Bacteria 10050426
557 2954676213 2954673503 Bacteria 9685905
558 2954687956 2954682443 Bacteria 9862841
559 2954697801 2954691527 Bacteria 10720516
560 2954704415 2954701450 Bacteria 10834262
561 2954716922 2954711539 Bacteria 10867210
562 2954726872 2954721474 Bacteria 10456478
563 2954734925 2954731030 Bacteria 10243860
564 2954745792 2954740390 Bacteria 10229294
565 2954753796 2954749733 Bacteria 10366972
566 2954764767 2954759201 Bacteria 9358192
567 3006321775 3006321560 Bacteria 8247479
568 3006501841 3006493962 Bacteria 8825450
569 8003875632 8003870546 Bacteria 7396674
570 8023625949 8023623736 Bacteria 8593882
571 8033686698 8033684223 Bacteria 6906479
572 8056451599 8056447290 Bacteria 7680491
573 Ga0466972_0087135
574 JGI24737J22298_10031628
575 JGI24735J21928_10139828
576 JGI24738J21930_10007520
577 rootL2_10051507
578 rootL2_10328345
579 JGI25160J50197_1018539
580 JGI25160J50197_1022754
581 Ga0006562J51391_1211630
582 Ga0070685_10019508
583 Ga0070707_101499757
584 Ga0068853_100032787
585 Ga0070665_100124744
586 Ga0070665_100669691
587 Ga0068855_100296104
588 Ga0068856_100112965
589 Ga0081539_10001651
590 Ga0081539_10004409
591 Ga0081539_10047933
592 Ga0075365_10423656
593 Ga0075368_10017586
594 Ga0075363_100103146
595 Ga0075363_100243268
596 Ga0075367_10027975
597 Ga0105251_10377380
598 Ga0105250_10212350
599 Ga0105245_10732445
600 Ga0105245_12750188
601 Ga0105243_12907011
602 Ga0105248_10511358
603 Ga0105239_12773017
604 Ga0105246_10016296
605 Ga0105246_10927782
606 Ga0105246_11175003
607 Ga0157369_11177482
608 Ga0157372_10022209
609 Ga0157375_11795519
610 Ga0182008_10030327
611 Ga0182005_1049655
612 Ga0183367_1006
613 Ga0213875_10090587
614 Ga0209758_1029968
615 Ga0207426_1004635
616 Ga0207426_1009919
617 Ga0207426_1013702
618 Ga0207426_1027102
619 Ga0207647_10057238
620 Ga0207709_10061884
621 Ga0207661_10187573
622 Ga0207667_10108355
623 Ga0207667_10780190
624 Ga0207702_10302308
625 Ga0207702_10388829
626 Ga0209813_10009936
627 Ga0268266_10106087
628 Ga0268266_10316347
629 Ga0268266_10523431
630 Ga0307517_10137262
631 Ga0307515_10000217
632 Ga0307515_10036823
633 Ga0307515_10055762
634 Ga0307515_10114696
635 Ga0268256_1100618
636 Ga0307511_10001726
637 Ga0307511_10086107
638 Ga0307512_10019566
639 Ga0307512_10053966
640 Ga0307513_10002913
641 Ga0307513_10750553
642 Ga0307509_10082770
643 Ga0307509_10106088
644 Ga0307509_10149396
645 Ga0307509_10162738
646 Ga0307408_100326109
647 Ga0307508_10012505
648 Ga0307508_10028856
649 Ga0307508_10096352
650 Ga0307508_10258751
651 Ga0307514_10008172
652 Ga0307514_10048248
653 Ga0307514_10130756
654 Ga0307516_10014622
655 Ga0307516_10065401
656 Ga0307516_10200573
657 Ga0307516_10271865
658 Ga0307405_10132241
659 Ga0307518_10045256
660 Ga0307518_10111578
661 Ga0307518_10294041
662 Ga0307410_10069361
663 Ga0307410_10793213
664 Ga0307410_10947124
665 Ga0307406_10224591
666 Ga0307406_11265698
667 Ga0307407_10036590
668 Ga0307407_10324159
669 Ga0307412_10200541
670 Ga0307412_11307409
671 Ga0307409_100033053
672 Ga0307409_100047609
673 Ga0307409_102026170
674 Ga0307416_100244889
675 Ga0307414_10151903
676 Ga0307415_100116052
677 Ga0307415_100155078
678 Ga0307415_101003794
679 Ga0307507_10000024
680 Ga0307507_10011377
681 Ga0307507_10166372
682 Ga0307507_10251740
683 Ga0307510_10010279
684 Ga0307510_10030450
685 Ga0307510_10152503
686 Ga0307510_10350310
687 Ga0373951_0002010
688 Ga0395899_0305306
689 Ga0395900_0021078
690 Ga0395900_0139513
691 Ga0395900_0954175
692 Ga0395898_0291948
693 Ga0395905_1266188
694 Ga0436364_1145881
695 Ga0395901_0275011
696 Ga0439436_0029781
697 Ga0439436_0085960
698 Ga0439439_0125035
699 Ga0451791_0017613
700 Ga0451791_1270819
701 Ga0451837_1271608
702 Ga0451841_0472792
703 Ga0451851_0839653
704 Ga0451843_0730873
705 Ga0451853_0740061
706 Ga0451853_1732933
707 Ga0439433_0002410
708 Ga0439442_117897
709 Ga0439448_0022839
710 Ga0439448_0091741
711 Ga0439449_0008342
712 Ga0439449_0019768
713 Ga0439449_0133547
714 Ga0439450_008948
715 Ga0439455_0004022
716 Ga0439457_000176
717 Ga0439457_009052
718 Ga0439462_0016866
719 Ga0439462_0026463
720 Ga0450920_034811
721 Ga0450894_000702
722 Ga0450896_009739
723 Ga0450898_003091
724 Ga0450899_000150
725 Ga0450902_015305
726 Ga0450903_000386
727 Ga0450906_009107
728 Ga0450907_035902
729 Ga0439458_0000278
730 Ga0450908_043038
731 Ga0466969_0027397
732 Ga0466969_0086665
733 Ga0466969_0095011
734 Ga0466972_0000644
735 Ga0466972_0003515
736 Ga0466972_0080500
737 Ga0466972_0108052
738 Ga0466965_0014495
739 Ga0466965_0201328
740 Ga0466965_0790987
741 Ga0466966_0009342
742 Ga0466966_0091647
743 Ga0466961_0002294
744 Ga0466961_0013311
745 Ga0466961_0074402
746 Ga0466961_0178163
747 Ga0466963_0001968
748 Ga0466963_0201198
749 Ga0466963_0648667
750 Ga0466964_0022897
751 Ga0466964_0320398
752 Ga0466971_0003897
753 Ga0466971_0015670
754 Ga0466971_0080399
755 Ga0466971_0113680
756 Ga0466968_0018283
757 Ga0466968_0336914
758 Ga0466970_0026053
759 Ga0466970_0032886
760 Ga0466957_0000804
761 Ga0466957_0289521
762 Ga0466960_0009125
763 Ga0466959_0029330
764 Ga0466959_0256590
765 Ga0466958_0022417
766 Ga0466958_0074627
767 Ga0466958_0116685
768 Ga0466967_0001072
769 Ga0466967_0238385
770 Ga0466967_0254826
771 Ga0466967_0421093
772 Ga0495617_007903
773 Ga0495627_118841
774 Ga0495627_165632
775 Ga0495592_0005625
776 Ga0495592_0033579
777 Ga0495592_0298283
778 Ga0495603_0000398
779 Ga0495603_0005217
780 Ga0495603_0009751
781 Ga0495603_0015423
782 Ga0495603_0361699
783 Ga0495590_0143792
784 Ga0495629_0008562
785 Ga0495629_0022562
786 Ga0495629_0083408
787 Ga0495629_0128349
788 Ga0495629_0193189
789 Ga0495629_0254192
790 Ga0495629_0314760
791 Ga0495629_0320012
792 Ga0495638_0063807
793 Ga0495638_0094013
794 Ga0495638_0094117
795 Ga0495638_0106070
796 Ga0495641_0325411
797 Ga0495641_0535947
798 Ga0495651_0018198
799 Ga0495651_0094855
800 Ga0495651_0165654
801 Ga0495580_0927007
802 Ga0495582_0038952
803 Ga0495582_0808108
804 Ga0495605_0005439
805 Ga0495605_0182111
806 Ga0495639_0004485
807 Ga0495662_0001937
808 Ga0495662_0673814
809 Ga0495664_0002549
810 Ga0495664_0043088
811 Ga0495664_0530043
812 Ga0495585_0150628
813 Ga0495585_0192560
814 Ga0495585_0330676
815 Ga0495594_0008305
816 Ga0495594_0023474
817 Ga0495594_0031514
818 Ga0495594_0033923
819 Ga0495594_0062063
820 Ga0495594_0194115
821 Ga0495594_0873979
822 Ga0495607_0033029
823 Ga0495607_0062976
824 Ga0495583_0048777
825 Ga0495583_0075464
826 Ga0495583_0140644
827 Ga0495606_0107437
828 Ga0495608_0047796
829 Ga0495610_0196531
830 Ga0495618_0029331
831 Ga0495618_0161733
832 Ga0495618_0219202
833 Ga0495620_0013712
834 Ga0495628_0018410
835 Ga0495628_0084522
836 Ga0495628_0961392
837 Ga0495630_0038888
838 Ga0495630_0188315
839 Ga0495632_0052518
840 Ga0495637_0023570
841 Ga0495643_0013911
842 Ga0495643_0018116
843 Ga0495644_0190730
844 Ga0495648_0030767
845 Ga0495648_0199323
846 Ga0495648_0447238
847 Ga0495666_0038452
848 Ga0495666_0158476
849 Ga0495666_0174723
850 Ga0495642_0123217
851 Ga0495642_0450234
852 Ga0495652_0004580
853 Ga0495652_0077196
854 Ga0495652_0171181
855 Ga0495654_0122557
856 Ga0495665_0636895
857 Ga0495640_0071196
858 Ga0495640_0088579
859 Ga0495586_0749075
860 Ga0495587_0027168
861 Ga0495609_0074848
862 Ga0495597_0168671
863 Ga0495645_0075005
864 Ga0495645_0859916
865 Ga0495622_0029084
866 Ga0495622_0060273
867 Ga0495622_0076675
868 Ga0495622_0208709
869 Ga0495622_0328807
870 Ga0495633_0064569
871 Ga0495633_0152963
872 Ga0495667_0169674
873 Ga0495668_0106957
874 Ga0495668_0308916
875 Ga0495634_0008055
876 Ga0495634_0048328
877 Ga0495634_0261541
878 Ga0495634_0373112
879 Ga0495611_0012959
880 Ga0495611_0029451
881 Ga0495611_0165427
882 Ga0495625_0243909
883 Ga0495635_0000663
884 Ga0495659_0068712
885 Ga0495661_0012138
886 Ga0495661_0573143
887 Ga0495588_0027335
888 Ga0495588_0036505
889 Ga0495588_0058081
890 Ga0495588_0121023
891 Ga0495588_0168007
892 Ga0495657_0008429
893 Ga0495657_0013037
894 Ga0495657_0134415
895 Ga0495657_0197445
896 Ga0495599_0099097
897 Ga0495599_0450834
898 Ga0495623_0132478
899 Ga0495623_0154244
900 Ga0495646_0001370
901 Ga0495646_0079440
902 Ga0495658_0024821
903 Ga0495658_0137592
904 Ga0495613_0010213
905 Ga0495613_0017770
906 Ga0495613_0051879
907 Ga0495613_0068123
908 Ga0495613_0095861
909 Ga0495624_0204346
910 Ga0495624_0377021
911 Ga0495670_0003651
912 Ga0495670_0080902
913 Ga0495671_0042312
914 Ga0495671_0218488
915 Ga0495649_0034943
916 Ga0495649_0041163
917 Ga0495649_0058589
918 Ga0495649_0117491
919 Ga0495589_0003392
920 Ga0495589_0027682
921 Ga0495589_0055525
922 Ga0495589_0066533
923 Ga0495589_0160672
924 Ga0495589_0296878
925 Ga0495600_0026118
926 Ga0495600_0028391
927 Ga0495600_0061805
928 Ga0495600_0645172
929 Ga0495660_0026647
930 Ga0495660_0078781
931 Ga0495660_0201291
932 Ga0495581_0003465
933 Ga0495581_0152593
934 Ga0495581_0437255
935 Ga0495581_0521151
936 Ga0495604_0001796
937 Ga0495604_0004370
938 Ga0495604_0123014
939 Ga0495636_0000423
940 Ga0495636_0070194
941 Ga0495636_0204987
942 Ga0495636_0302538
943 Ga0495674_0256926
944 Ga0495674_0425639
945 Ga0495676_0001432
946 Ga0495676_0010104
947 Ga0495676_0036917
948 Ga0495676_0049573
949 Ga0495676_0070093
950 Ga0495676_0224892
951 Ga0495676_0448271
952 Ga0495680_0078221
953 Ga0495680_0916721
954 Ga0495683_0075788
955 Ga0495683_0163911
956 Ga0495683_0221793
957 Ga0495687_003167
958 Ga0495687_003879
959 Ga0495687_014316
960 Ga0495687_038633
961 Ga0495687_110464
962 Ga0495675_0010867
963 Ga0495675_0019677
964 Ga0495675_0021467
965 Ga0495675_0255064
966 Ga0495675_0440234
967 Ga0495677_0224465
968 Ga0495677_0422168
969 Ga0495679_124155
970 Ga0495685_000202
971 Ga0495685_002443
972 Ga0495685_005413
973 Ga0495685_006771
974 Ga0495685_021427
975 Ga0495685_040627
976 Ga0495685_128895
977 Ga0495681_0067933
978 Ga0495684_0904418
979 Ga0495684_1046128
980 Ga0495686_0029182
981 Ga0495686_0053382
982 Ga0495686_0200564
983 Ga0495593_0001327
984 Ga0495593_0012210
985 Ga0495593_0101191
986 Ga0495602_0025613
987 Ga0495614_0000845
988 Ga0495614_0001248
989 Ga0495614_0048405
990 Ga0495614_0108924
991 Ga0496100_1003440
992 Ga0496108_0250113
993 Ga0496110_0737571
994 Ga0496112_0810495
995 Ga0496113_1464778
996 Ga0496114_0327546
997 Ga0496125_0174559
998 Ga0501031_0012593
999 Ga0501031_0190017
1000 Ga0501031_0242209
1001 Ga0501031_0527054
1002 Ga0501032_0200235
1003 Ga0501032_0844560
1004 Ga0501033_0001718
1005 Ga0501033_0008612
1006 Ga0501033_0070946
1007 Ga0501034_0024668
1008 Ga0501034_0040299
1009 Ga0501034_0057689
1010 Ga0501034_0302859
1011 Ga0501036_0014265
1012 Ga0501036_0042974
1013 Ga0501036_0064870
1014 Ga0501036_0072488
1015 Ga0501036_0277347
1016 Ga0501037_0012198
1017 Ga0501037_0037320
1018 Ga0501037_0113393
1019 Ga0501037_0178635
1020 Ga0501038_0008487
1021 Ga0501038_0052172
1022 Ga0501039_0002172
1023 Ga0501039_0022011
1024 Ga0501042_0077941
1025 Ga0501043_0018783
1026 Ga0501043_0050823
1027 Ga0501043_0083738
1028 Ga0501043_0107968
1029 Ga0501043_1310386
1030 Ga0501046_0010171
1031 Ga0501047_0000025
1032 Ga0501047_0006111
1033 Ga0501047_0103488
1034 Ga0501047_0111554
1035 Ga0501047_0538560
1036 Ga0501048_0079978
1037 Ga0501068_0079257
1038 Ga0501069_0621220
1039 Ga0501070_0029580
1040 Ga0501070_0137778
1041 Ga0501070_0254901
1042 Ga0501070_0543381
1043 Ga0501073_0118627
1044 Ga0501074_1173261
1045 Ga0501223_049858
1046 Ga0501235_066932
1047 Ga0501080_0231972
1048 Ga0501083_0994746
1049 Ga0501282_013173
1050 Ga0501035_0002135
1051 Ga0501035_0024363
1052 Ga0501035_0026852
1053 Ga0501035_0077074
1054 Ga0501035_0116523
1055 Ga0501035_1381782
1056 Ga0501044_0000330
1057 Ga0501044_0014074
1058 Ga0501044_0122623
1059 Ga0501044_0854133
1060 Ga0501044_1639874
1061 Ga0501045_0399253
1062 nmdc:mga03n38_76274_c1
1063 nmdc:mga0yw44_88444_c1
1064 nmdc:mga06z11_55294_c1
1065 nmdc:mga04h51_11633_c1
1066 nmdc:mga07m45_243680_c1
1067 nmdc:mga07m45_277956_c1
1068 Ga0495619_0207935
1069 Ga0500578_0003672
1070 Ga0500644_0024271
1071 Ga0500583_0429180
1072 Ga0500566_0035483
1073 Ga0500640_002129
1074 Ga0500660_021574
1075 Ga0500569_004867
1076 Ga0500572_004958
1077 Ga0500614_031756
1078 Ga0500628_000910
1079 Ga0500652_016501
1080 Ga0500658_0029331
1081 Ga0500561_0004818
1082 Ga0500573_0024638
1083 Ga0500573_0031269
1084 Ga0500579_121740
1085 Ga0500586_040802
1086 Ga0500588_0350117
1087 Ga0500600_0019003
1088 Ga0500600_0110766
1089 Ga0500600_0191025
1090 Ga0500600_0245559
1091 Ga0500606_243243
1092 Ga0500616_0081061
1093 Ga0500624_003306
1094 Ga0500633_0144325
1095 Ga0500634_0035634
1096 Ga0500634_0170382
1097 Ga0500636_0253805
1098 Ga0500636_0392383
1099 Ga0500656_001986
1100 Ga0500587_001038
1101 Ga0466962_0003682
1102 Ga0466962_0041978
1103 Ga0466962_0364571
1104 2515720883
1105 2516082629
1106 2516091791
1107 2547406900
1108 2585309151
1109 2585319352
1110 2644263143
1111 2644382538
1112 2644436465
1113 2644625694
1114 2784587935
1115 2785344200
1116 2785368674
1117 2786669787
1118 2808841354
1119 2808919886
1120 2809231531
1121 2812358898
1122 2812481167
1123 2862184824
1124 2877681828
1125 2946066986
1126 2946075291
1127 2947230248
1128 2954386973
1129 2954676213
1130 2954687956
1131 2954697801
1132 2954704415
1133 2954716922
1134 2954726872
1135 2954734925
1136 2954745792
1137 2954753796
1138 2954764767
1139 3006321775
1140 3006501841
1141 8003875632
1142 8023625949
1143 8033686698
1144 8056451599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01152

Bac_globin

Bacterial-like globin

44

152

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qrw-assembly7.cif.gz_J crystal structure of mycobacterium tuberculosis trhbo wg8f mutant 0.8462 37 159
2qrw-assembly1.cif.gz_H crystal structure of mycobacterium tuberculosis trhbo wg8f mutant 0.8455 37 159
2bmm-assembly1.cif.gz_A x-ray structure of a novel thermostable hemoglobin from the actinobacterium thermobifida fusca 0.8446 38 159
4uzv-assembly1.cif.gz_A-2 structure of a triple mutant of asv-tftrhb 0.8373 34 159
5d1v-assembly1.cif.gz_B crystal structure and thermal stability of hemoglobin from thermophilic phototrophic bacterium chloroflexus aurantiacus 0.8334 36 157
ID Description Score Start End Superfamily
2bmmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8446 38 159 1.10.490.10
4uzvA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8373 34 159 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8334 36 157 1.10.490.10
2bmmA00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8315 38 159 1.10.490.10
5d1vB00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.8269 36 157 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A838KFN7-F1-model_v4 Globin 0.8553 38 157 GO:0005344
GO:0019825
GO:0020037
AF-A0A2A9CZS0-F1-model_v4 Hemoglobin 0.8542 39 159 GO:0005344
GO:0019825
GO:0020037
AF-A0A2W1UD79-F1-model_v4 deleted 0.8526 40 159
AF-A0A0M8XSM8-F1-model_v4 deleted 0.852 38 159
AF-A0A1H9SP32-F1-model_v4 Hemoglobin 0.851 37 159 GO:0005344
GO:0019825
GO:0020037

Map