F465024

General Info

Members Datasets Scaffolds Average Seq Length
572 259 846 62

Family's Representative Sequence

Representative Sequence 3300003163|Ga0006759J45824_1105779|Ga0006759J45824_11057792
Length 72
Sequence LNEPAPEDKNMKLISFLLDFLREEEGQDLIEYALLVALIALXCVGALITAGSQVNAIFTNISARLTTAAGNQ

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
98 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
183 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
184 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
205 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
206 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
237 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
238 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
239 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
245 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
246 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
247 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.17
Metatranscriptomes 17.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.52
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 63.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1105779 3300003163 Unclassified 501
2 JGI24746J21847_1011306 3300001977 Unclassified 1314
3 JGI24750J21931_1028828 3300002070 Unclassified 807
4 JGI24748J21848_1022295 3300002074 Unclassified 766
5 JGI24749J21850_1030268 3300002076 Unclassified 777
6 JGI24035J26624_1029266 3300002126 Bacteria 597
7 JGI24034J26672_10043990 3300002239 Unclassified 755
8 Ga0007417J51691_1014343 3300003544 Unclassified 557
9 Ga0007410J51695_1009088 3300003574 Bacteria 973
10 Ga0007410J51695_1014977 3300003574 Unclassified 567
11 Ga0007410J51695_1034790 3300003574 Unclassified 542
12 Ga0007410J51695_1039654 3300003574 Bacteria 559
13 Ga0007410J51695_1052206 3300003574 Bacteria 549
14 Ga0007409J51694_1008118 3300003575 Unclassified 506
15 Ga0007409J51694_1012793 3300003575 Bacteria 536
16 Ga0007409J51694_1029731 3300003575 Bacteria 957
17 Ga0007409J51694_1033510 3300003575 Unclassified 538
18 Ga0007416J51690_1027180 3300003577 Unclassified 501
19 Ga0032354_1063024 3300003693 Unclassified 564
20 Ga0058859_11251435 3300004798 Unclassified 714
21 Ga0058859_11474450 3300004798 Unclassified 590
22 Ga0058859_11814193 3300004798 Unclassified 872
23 Ga0058860_11242357 3300004801 Bacteria 528
24 Ga0058860_11921943 3300004801 Unclassified 579
25 Ga0058860_12040478 3300004801 Unclassified 681
26 Ga0058862_12062171 3300004803 Bacteria 568
27 Ga0065704_10164901 3300005289 Unclassified 1329
28 Ga0065704_10318571 3300005289 Unclassified 856
29 Ga0065712_10137898 3300005290 Unclassified 1479
30 Ga0065712_10259094 3300005290 Unclassified 941
31 Ga0065715_10002301 3300005293 Bacteria 5308
32 Ga0065715_10396831 3300005293 Unclassified 858
33 Ga0065715_10492988 3300005293 Bacteria 786
34 Ga0065715_10911146 3300005293 Unclassified 571
35 Ga0065707_10087953 3300005295 Bacteria 4831
36 Ga0065707_10244424 3300005295 Unclassified 1145
37 Ga0070658_11508025 3300005327 Unclassified 583
38 Ga0070676_10197651 3300005328 Unclassified 1316
39 Ga0070676_10201415 3300005328 Unclassified 1305
40 Ga0070690_100054702 3300005330 Bacteria 2555
41 Ga0070690_100323086 3300005330 Unclassified 1112
42 Ga0070690_100570013 3300005330 Unclassified 856
43 Ga0070670_100102699 3300005331 Unclassified 2462
44 Ga0070670_100607922 3300005331 Unclassified 979
45 Ga0070677_10014750 3300005333 Unclassified 2756
46 Ga0070677_10613908 3300005333 Unclassified 604
47 Ga0068869_100122503 3300005334 Unclassified 1990
48 Ga0070666_10038305 3300005335 Unclassified 3189
49 Ga0070680_100670422 3300005336 Bacteria 892
50 Ga0070680_101117615 3300005336 Bacteria 681
51 Ga0070682_100114465 3300005337 Bacteria 1803
52 Ga0070682_100804278 3300005337 Unclassified 764
53 Ga0068868_100286692 3300005338 Unclassified 1395
54 Ga0068868_100479704 3300005338 Unclassified 1086
55 Ga0068868_100875171 3300005338 Unclassified 815
56 Ga0070660_100435583 3300005339 Unclassified 1086
57 Ga0070689_100020410 3300005340 Unclassified 4915
58 Ga0070689_100615346 3300005340 Unclassified 942
59 Ga0070687_100001708 3300005343 Bacteria 7884
60 Ga0070687_100544645 3300005343 Unclassified 788
61 Ga0070661_100013186 3300005344 Bacteria 5802
62 Ga0070661_100140186 3300005344 Bacteria 1822
63 Ga0070661_100184243 3300005344 Unclassified 1590
64 Ga0070692_10604818 3300005345 Unclassified 726
65 Ga0070668_100248761 3300005347 Unclassified 1475
66 Ga0070668_101009501 3300005347 Unclassified 748
67 Ga0070669_100396404 3300005353 Unclassified 1128
68 Ga0070669_100761976 3300005353 Bacteria 821
69 Ga0070675_100077876 3300005354 Unclassified 2760
70 Ga0070675_100150346 3300005354 Unclassified 1996
71 Ga0070675_100306370 3300005354 Unclassified 1400
72 Ga0070671_100260065 3300005355 Unclassified 1475
73 Ga0070671_100321698 3300005355 Unclassified 1318
74 Ga0070674_100382918 3300005356 Bacteria 1145
75 Ga0070673_100367293 3300005364 Unclassified 1280
76 Ga0070673_100945222 3300005364 Unclassified 801
77 Ga0070688_100346464 3300005365 Unclassified 1086
78 Ga0070659_100023324 3300005366 Unclassified 4735
79 Ga0070659_100593509 3300005366 Unclassified 951
80 Ga0070667_100145347 3300005367 Unclassified 2079
81 Ga0070703_10301300 3300005406 Unclassified 668
82 Ga0070701_10019656 3300005438 Unclassified 3193
83 Ga0070701_10352902 3300005438 Unclassified 919
84 Ga0070705_100327057 3300005440 Unclassified 1109
85 Ga0070700_100266064 3300005441 Unclassified 1236
86 Ga0070700_100613720 3300005441 Unclassified 854
87 Ga0070700_100944887 3300005441 Unclassified 705
88 Ga0070700_101746962 3300005441 Unclassified 535
89 Ga0070694_100818153 3300005444 Unclassified 765
90 Ga0070663_100573631 3300005455 Bacteria 946
91 Ga0070678_100101931 3300005456 Unclassified 2226
92 Ga0070678_100571160 3300005456 Bacteria 1006
93 Ga0070678_100730879 3300005456 Bacteria 894
94 Ga0070678_101892625 3300005456 Unclassified 563
95 Ga0070662_100357522 3300005457 Bacteria 1198
96 Ga0070662_100995398 3300005457 Unclassified 718
97 Ga0068867_100189147 3300005459 Unclassified 1642
98 Ga0068867_100827627 3300005459 Bacteria 828
99 Ga0070685_10032082 3300005466 Unclassified 2940
100 Ga0070699_100691058 3300005518 Unclassified 932
101 Ga0070684_100341190 3300005535 Bacteria 1377
102 Ga0068853_100813006 3300005539 Bacteria 895
103 Ga0070672_100296228 3300005543 Unclassified 1370
104 Ga0070672_101247791 3300005543 Unclassified 663
105 Ga0070686_100057791 3300005544 Unclassified 2493
106 Ga0070686_100093265 3300005544 Bacteria 2018
107 Ga0070695_100663848 3300005545 Unclassified 824
108 Ga0070695_101313385 3300005545 Unclassified 598
109 Ga0070693_100608268 3300005547 Unclassified 790
110 Ga0070665_100027782 3300005548 Bacteria 5696
111 Ga0070704_100213729 3300005549 Bacteria 1564
112 Ga0070664_100007886 3300005564 Bacteria 8602
113 Ga0070664_100263057 3300005564 Unclassified 1552
114 Ga0070664_101804297 3300005564 Unclassified 580
115 Ga0068857_101336638 3300005577 Unclassified 696
116 Ga0068854_101311146 3300005578 Unclassified 652
117 Ga0070702_100081304 3300005615 Unclassified 1941
118 Ga0068852_100648340 3300005616 Unclassified 1063
119 Ga0068852_102071434 3300005616 Unclassified 591
120 Ga0068859_100055877 3300005617 Unclassified 3972
121 Ga0068864_100017945 3300005618 Bacteria 5904
122 Ga0068861_100021274 3300005719 Unclassified 4662
123 Ga0068861_100076551 3300005719 Bacteria 2607
124 Ga0068870_10007539 3300005840 Unclassified 4856
125 Ga0068863_100099625 3300005841 Unclassified 2761
126 Ga0068863_100972107 3300005841 Unclassified 851
127 Ga0068858_100209329 3300005842 Unclassified 1845
128 Ga0068860_100045886 3300005843 Unclassified 4167
129 Ga0068862_100414560 3300005844 Unclassified 1262
130 Ga0068862_100983535 3300005844 Unclassified 834
131 Ga0075432_10184847 3300006058 Unclassified 817
132 Ga0097621_100027883 3300006237 Unclassified 4447
133 Ga0097621_100449162 3300006237 Bacteria 1161
134 Ga0068871_100020538 3300006358 Bacteria 5061
135 Ga0068871_100322305 3300006358 Bacteria 1361
136 Ga0068871_100645581 3300006358 Unclassified 966
137 Ga0075428_100001764 3300006844 Bacteria 23092
138 Ga0075428_100530071 3300006844 Unclassified 1259
139 Ga0075428_100580499 3300006844 Bacteria 1198
140 Ga0075428_101044035 3300006844 Unclassified 864
141 Ga0075428_101123000 3300006844 Bacteria 830
142 Ga0075428_101339828 3300006844 Bacteria 752
143 Ga0075430_100000262 3300006846 Bacteria 36942
144 Ga0075430_100015447 3300006846 Bacteria 6500
145 Ga0075430_100129211 3300006846 Unclassified 2106
146 Ga0075431_100000517 3300006847 Bacteria 32332
147 Ga0075431_100004120 3300006847 Bacteria 14194
148 Ga0075433_10001213 3300006852 Bacteria 18802
149 Ga0075434_100147612 3300006871 Unclassified 2372
150 Ga0075429_100005064 3300006880 Bacteria 11333
151 Ga0075429_100070809 3300006880 Unclassified 3036
152 Ga0075429_101542324 3300006880 Bacteria 578
153 Ga0075429_101589702 3300006880 Unclassified 568
154 Ga0068865_100206351 3300006881 Unclassified 1528
155 Ga0068865_101713063 3300006881 Unclassified 567
156 Ga0097620_100055873 3300006931 Unclassified 3972
157 Ga0075435_100562367 3300007076 Unclassified 988
158 Ga0111539_10009412 3300009094 Bacteria 12328
159 Ga0111539_10060187 3300009094 Unclassified 4500
160 Ga0111539_12378866 3300009094 Unclassified 615
161 Ga0105245_10753410 3300009098 Unclassified 1010
162 Ga0105245_11051622 3300009098 Bacteria 859
163 Ga0105247_10317990 3300009101 Unclassified 1085
164 Ga0114129_10791126 3300009147 Bacteria 1211
165 Ga0114129_12488544 3300009147 Bacteria 619
166 Ga0105243_11629896 3300009148 Bacteria 672
167 Ga0105248_10026668 3300009177 Bacteria 6425
168 Ga0105248_12748745 3300009177 Bacteria 561
169 Ga0105249_10070182 3300009553 Unclassified 3234
170 Ga0105249_11731735 3300009553 Bacteria 697
171 Ga0105239_10982643 3300010375 Unclassified 970
172 Ga0105246_10037952 3300011119 Unclassified 3235
173 Ga0105246_12293548 3300011119 Unclassified 527
174 Ga0157317_1014603 3300012475 Bacteria 644
175 Ga0157316_1020385 3300012510 Unclassified 719
176 Ga0157371_10320833 3300013102 Unclassified 1124
177 Ga0157370_10349880 3300013104 Bacteria 1362
178 Ga0157370_11730620 3300013104 Unclassified 561
179 Ga0157374_10063703 3300013296 Unclassified 3458
180 Ga0163162_10158485 3300013306 Bacteria 2385
181 Ga0163162_10306912 3300013306 Unclassified 1719
182 Ga0157372_11186227 3300013307 Unclassified 882
183 Ga0157375_10023056 3300013308 Bacteria 5738
184 Ga0157375_12264276 3300013308 Unclassified 648
185 Ga0157375_12348352 3300013308 Unclassified 636
186 Ga0163163_12123051 3300014325 Unclassified 621
187 Ga0157380_10218523 3300014326 Unclassified 1703
188 Ga0157380_11424574 3300014326 Unclassified 744
189 Ga0157377_10012066 3300014745 Unclassified 4334
190 Ga0157377_10022601 3300014745 Bacteria 3323
191 Ga0157377_10090970 3300014745 Unclassified 1802
192 Ga0157379_10085500 3300014968 Unclassified 2827
193 Ga0157376_10118554 3300014969 Unclassified 2342
194 Ga0157376_10295167 3300014969 Bacteria 1532
195 Ga0157376_10717442 3300014969 Bacteria 1006
196 Ga0163161_10198422 3300017792 Unclassified 1545
197 Ga0207697_10000408 3300025315 Bacteria 24279
198 Ga0207697_10395578 3300025315 Unclassified 614
199 Ga0207682_10003900 3300025893 Bacteria 6366
200 Ga0207682_10301119 3300025893 Bacteria 752
201 Ga0207688_10004781 3300025901 Bacteria 7380
202 Ga0207688_10034263 3300025901 Unclassified 2811
203 Ga0207680_10161903 3300025903 Unclassified 1501
204 Ga0207647_10212299 3300025904 Unclassified 1117
205 Ga0207645_10010104 3300025907 Bacteria 6496
206 Ga0207645_10815954 3300025907 Bacteria 634
207 Ga0207645_11069606 3300025907 Unclassified 545
208 Ga0207643_10011392 3300025908 Unclassified 4801
209 Ga0207660_11269424 3300025917 Bacteria 598
210 Ga0207662_10000756 3300025918 Bacteria 14817
211 Ga0207662_10587898 3300025918 Unclassified 774
212 Ga0207657_10609879 3300025919 Unclassified 851
213 Ga0207649_10039634 3300025920 Bacteria 2858
214 Ga0207649_10965029 3300025920 Unclassified 670
215 Ga0207681_10046619 3300025923 Unclassified 2916
216 Ga0207681_10412708 3300025923 Unclassified 1092
217 Ga0207681_10723570 3300025923 Bacteria 828
218 Ga0207650_10837039 3300025925 Unclassified 780
219 Ga0207659_10010400 3300025926 Bacteria 5848
220 Ga0207659_10095159 3300025926 Unclassified 2233
221 Ga0207659_10130374 3300025926 Bacteria 1940
222 Ga0207659_10305342 3300025926 Unclassified 1308
223 Ga0207687_10435740 3300025927 Bacteria 1084
224 Ga0207644_11163425 3300025931 Bacteria 648
225 Ga0207644_11657490 3300025931 Unclassified 536
226 Ga0207690_10527472 3300025932 Bacteria 958
227 Ga0207706_10002300 3300025933 Bacteria 18629
228 Ga0207706_10111236 3300025933 Bacteria 2409
229 Ga0207670_10382603 3300025936 Unclassified 1121
230 Ga0207669_11916316 3300025937 Unclassified 506
231 Ga0207704_10128180 3300025938 Unclassified 1751
232 Ga0207691_10019048 3300025940 Bacteria 6500
233 Ga0207691_10100797 3300025940 Unclassified 2577
234 Ga0207691_10555994 3300025940 Bacteria 973
235 Ga0207691_10931744 3300025940 Unclassified 726
236 Ga0207711_10153046 3300025941 Unclassified 2083
237 Ga0207689_10001150 3300025942 Bacteria 25470
238 Ga0207679_10036766 3300025945 Unclassified 3475
239 Ga0207679_10293605 3300025945 Unclassified 1398
240 Ga0207651_10007438 3300025960 Bacteria 5837
241 Ga0207651_10666775 3300025960 Unclassified 914
242 Ga0207712_10050263 3300025961 Unclassified 2910
243 Ga0207712_11192932 3300025961 Unclassified 679
244 Ga0207668_12157476 3300025972 Unclassified 501
245 Ga0207658_10032957 3300025986 Unclassified 3692
246 Ga0207658_11338649 3300025986 Unclassified 655
247 Ga0207677_10583866 3300026023 Unclassified 978
248 Ga0207677_11576959 3300026023 Unclassified 607
249 Ga0207677_12152679 3300026023 Unclassified 519
250 Ga0207703_10319152 3300026035 Unclassified 1422
251 Ga0207678_10599102 3300026067 Bacteria 966
252 Ga0207708_10002396 3300026075 Bacteria 13761
253 Ga0207708_11753163 3300026075 Unclassified 545
254 Ga0207641_10074379 3300026088 Unclassified 2930
255 Ga0207641_10820002 3300026088 Bacteria 921
256 Ga0207648_11322788 3300026089 Bacteria 677
257 Ga0207676_10051735 3300026095 Unclassified 3208
258 Ga0207674_11056796 3300026116 Unclassified 781
259 Ga0207675_100756132 3300026118 Bacteria 983
260 Ga0207683_10104475 3300026121 Unclassified 2531
261 Ga0207683_10439236 3300026121 Unclassified 1203
262 Ga0207683_11423337 3300026121 Bacteria 641
263 Ga0207698_10996407 3300026142 Unclassified 848
264 Ga0209995_1042382 3300027471 Bacteria 769
265 Ga0210002_1023899 3300027617 Bacteria 996
266 Ga0209998_10197225 3300027717 Unclassified 526
267 Ga0207428_10000864 3300027907 Bacteria 34135
268 Ga0207428_10009845 3300027907 Bacteria 8562
269 Ga0207428_10014781 3300027907 Bacteria 6762
270 Ga0207428_10056720 3300027907 Bacteria 3111
271 Ga0268266_10421722 3300028379 Unclassified 1264
272 Ga0268265_10164457 3300028380 Unclassified 1889
273 Ga0307408_100023731 3300031548 Bacteria 4181
274 Ga0307405_10013521 3300031731 Bacteria 4357
275 Ga0307413_10121881 3300031824 Archaea 1768
276 Ga0307410_10715035 3300031852 Unclassified 845
277 Ga0307406_10269204 3300031901 Bacteria 1293
278 Ga0307407_10829123 3300031903 Unclassified 705
279 Ga0307412_11259797 3300031911 Bacteria 664
280 Ga0307409_100303981 3300031995 Unclassified 1485
281 Ga0307416_100024700 3300032002 Bacteria 4392
282 Ga0307416_100411059 3300032002 Unclassified 1394
283 Ga0307414_10178110 3300032004 Bacteria 1707
284 Ga0307411_10023966 3300032005 Bacteria 3628
285 Ga0307411_12215952 3300032005 Unclassified 515
286 Ga0307415_100189350 3300032126 Bacteria 1622
287 Ga0373928_0267198 3300035084 Bacteria 514
288 Ga0373949_0082836 3300035090 Bacteria 857
289 Ga0373951_0247767 3300035091 Bacteria 534
290 Ga0373932_0015295 3300035112 Unclassified 1944
291 Ga0373941_0163967 3300035115 Unclassified 824
292 Ga0373960_0171413 3300035121 Unclassified 753
293 Ga0373931_0706947 3300035691 Unclassified 666
294 Ga0439439_0117979 3300041406 Bacteria 739
295 Ga0451800_1310209 3300041459 Bacteria 530
296 Ga0451853_1107238 3300041512 Bacteria 837
297 Ga0439433_0044774 3300041999 Bacteria 1035
298 Ga0439448_0318944 3300042005 Bacteria 553
299 Ga0439450_044490 3300042008 Unclassified 1040
300 Ga0439450_214264 3300042008 Unclassified 517
301 Ga0450917_015262 3300042120 Unclassified 648
302 Ga0450923_047135 3300042125 Unclassified 919
303 Ga0450898_020355 3300042134 Bacteria 1162
304 Ga0450908_070483 3300042184 Unclassified 620
305 Ga0439435_0340804 3300042436 Unclassified 519
306 Ga0439435_0343286 3300042436 Unclassified 518
307 Ga0439464_0028140 3300042439 Bacteria 1566
308 Ga0451576_1998965 3300045051 Unclassified 597
309 Ga0495594_0147024 3300046499 Bacteria 1338
310 Ga0495640_0661900 3300046533 Bacteria 628
311 Ga0495598_0023856 3300046537 Bacteria 1652
312 Ga0495659_0066335 3300046664 Unclassified 1344
313 Ga0495659_0547388 3300046664 Unclassified 510
314 Ga0495647_0452388 3300046681 Unclassified 594
315 Ga0495670_0478897 3300046691 Bacteria 675
316 Ga0496108_0298150 3300048911 Unclassified 1404
317 Ga0496109_0079707 3300048912 Unclassified 3017
318 Ga0501306_038506 3300049127 Unclassified 734
319 Ga0501306_038648 3300049127 Unclassified 733
320 Ga0501308_012567 3300049128 Unclassified 969
321 Ga0501308_055262 3300049128 Unclassified 589
322 Ga0501308_086159 3300049128 Unclassified 506
323 Ga0501309_038113 3300049129 Unclassified 728
324 Ga0501309_098103 3300049129 Unclassified 506
325 Ga0501310_005117 3300049130 Unclassified 1339
326 Ga0501310_059876 3300049130 Unclassified 566
327 Ga0501310_070209 3300049130 Unclassified 535
328 Ga0501310_077872 3300049130 Unclassified 517
329 Ga0501341_13641 3300049131 Unclassified 560
330 Ga0501305_024102 3300049161 Unclassified 915
331 Ga0501305_059161 3300049161 Bacteria 657
332 Ga0501305_090212 3300049161 Unclassified 560
333 Ga0501305_114027 3300049161 Unclassified 514
334 Ga0501307_032294 3300049162 Unclassified 731
335 Ga0501307_072249 3300049162 Unclassified 551
336 Ga0501298_121098 3300049521 Unclassified 616
337 Ga0501298_136624 3300049521 Bacteria 590
338 Ga0501299_078079 3300049522 Bacteria 731
339 Ga0501311_027729 3300049527 Unclassified 805
340 Ga0501311_092428 3300049527 Bacteria 527
341 Ga0501312_044618 3300049528 Unclassified 733
342 Ga0501312_078610 3300049528 Bacteria 594
343 Ga0501312_081376 3300049528 Unclassified 586
344 Ga0501312_090181 3300049528 Bacteria 565
345 Ga0501312_122302 3300049528 Unclassified 504
346 Ga0501313_032617 3300049529 Unclassified 680
347 Ga0501315_036797 3300049531 Unclassified 727
348 Ga0501316_029676 3300049532 Unclassified 727
349 Ga0501316_077505 3300049532 Unclassified 510
350 Ga0501317_037658 3300049533 Unclassified 727
351 Ga0501318_030996 3300049534 Unclassified 727
352 Ga0501320_023703 3300049536 Unclassified 727
353 Ga0501320_039914 3300049536 Unclassified 612
354 Ga0501320_059219 3300049536 Bacteria 536
355 Ga0501321_031426 3300049537 Unclassified 711
356 Ga0501321_070737 3300049537 Bacteria 542
357 Ga0501322_009136 3300049538 Unclassified 746
358 Ga0501323_032833 3300049539 Unclassified 735
359 Ga0501323_079417 3300049539 Unclassified 534
360 Ga0501324_016405 3300049540 Unclassified 726
361 Ga0501324_022108 3300049540 Bacteria 656
362 Ga0501325_017584 3300049541 Bacteria 725
363 Ga0501331_10695 3300049547 Unclassified 574
364 Ga0501332_16132 3300049548 Unclassified 535
365 Ga0501333_012303 3300049549 Unclassified 625
366 Ga0501335_036145 3300049551 Unclassified 572
367 Ga0501336_017474 3300049552 Unclassified 630
368 Ga0501340_008413 3300049556 Unclassified 727
369 Ga0501033_0705299 3300049570 Unclassified 686
370 Ga0501036_0227102 3300049572 Bacteria 1567
371 Ga0501039_0210790 3300049575 Bacteria 1528
372 Ga0501041_0019051 3300049577 Unclassified 4092
373 Ga0501042_0039610 3300049578 Unclassified 3349
374 Ga0501042_1250380 3300049578 Bacteria 541
375 Ga0501046_0021345 3300049580 Bacteria 5344
376 Ga0501048_0213789 3300049582 Bacteria 1367
377 Ga0501072_0708395 3300049588 Bacteria 791
378 Ga0501072_1312963 3300049588 Bacteria 561
379 Ga0501074_0146476 3300049590 Bacteria 1689
380 Ga0501076_0099779 3300049592 Bacteria 2339
381 Ga0501077_0458762 3300049593 Bacteria 816
382 Ga0501217_232119 3300049661 Unclassified 587
383 Ga0501227_025751 3300049665 Bacteria 1382
384 Ga0501249_020865 3300049679 Bacteria 1427
385 Ga0501221_156388 3300049704 Unclassified 608
386 Ga0501245_033204 3300049708 Bacteria 861
387 Ga0501079_0053167 3300049741 Unclassified 3125
388 Ga0501080_0522649 3300049742 Bacteria 1059
389 Ga0501081_0136036 3300049743 Unclassified 1759
390 Ga0501268_011817 3300049765 Bacteria 1385
391 Ga0501274_047943 3300049771 Bacteria 529
392 Ga0501282_014645 3300049778 Unclassified 852
393 Ga0501283_003236 3300049779 Bacteria 2145
394 Ga0501045_0095524 3300049824 Unclassified 2199
395 Ga0501045_1200386 3300049824 Bacteria 554
396 nmdc:mga05p37_1012262_c1 3300050507 Bacteria 881
397 nmdc:mga05p37_1507075_c1 3300050507 Bacteria 669
398 nmdc:mga05p37_339781_c1 3300050507 Bacteria 1771
399 nmdc:mga05p37_47974_c1 3300050507 Bacteria 5252
400 nmdc:mga05p37_56175_c1 3300050507 Bacteria 4088
401 nmdc:mga05p37_65407_c1 3300050507 Unclassified 4474
402 nmdc:mga09592_1330228_c1 3300050508 Unclassified 590
403 nmdc:mga09592_1488113_c1 3300050508 Unclassified 551
404 nmdc:mga09592_1618_c1 3300050508 Bacteria 18121
405 nmdc:mga09592_278908_c1 3300050508 Unclassified 1450
406 nmdc:mga09592_412377_c1 3300050508 Archaea 1167
407 nmdc:mga0qj67_258_c1 3300050509 Bacteria 36243
408 nmdc:mga0qj67_44856_c1 3300050509 Unclassified 3487
409 nmdc:mga0qj67_55087_c1 3300050509 Unclassified 3150
410 nmdc:mga06r32_146377_c1 3300050510 Bacteria 2340
411 nmdc:mga06r32_1786_c1 3300050510 Bacteria 19309
412 nmdc:mga06r32_8881_c1 3300050510 Bacteria 9056
413 nmdc:mga08y16_1293088_c1 3300050511 Bacteria 696
414 nmdc:mga08y16_1784_c1 3300050511 Bacteria 21805
415 nmdc:mga08y16_192089_c1 3300050511 Unclassified 2118
416 nmdc:mga08y16_61229_c1 3300050511 Unclassified 3931
417 nmdc:mga0n895_4553_c1 3300050512 Bacteria 11414
418 nmdc:mga0rr50_724916_c1 3300050513 Unclassified 849
419 nmdc:mga0a205_1204_c1 3300050515 Bacteria 9014
420 nmdc:mga0a205_377755_c1 3300050515 Bacteria 1282
421 Ga0501084_0015111 3300054114 Bacteria 6403
422 Ga0501082_0099065 3300060353 Unclassified 2520
423 Ga0530510_0840831 3300061734 Unclassified 701
424 Ga0006759J45824_1105779
425 JGI24746J21847_1011306
426 JGI24750J21931_1028828
427 JGI24748J21848_1022295
428 JGI24749J21850_1030268
429 JGI24035J26624_1029266
430 JGI24034J26672_10043990
431 Ga0007417J51691_1014343
432 Ga0007410J51695_1009088
433 Ga0007410J51695_1014977
434 Ga0007410J51695_1034790
435 Ga0007410J51695_1039654
436 Ga0007410J51695_1052206
437 Ga0007409J51694_1008118
438 Ga0007409J51694_1012793
439 Ga0007409J51694_1029731
440 Ga0007409J51694_1033510
441 Ga0007416J51690_1027180
442 Ga0032354_1063024
443 Ga0058859_11251435
444 Ga0058859_11474450
445 Ga0058859_11814193
446 Ga0058860_11242357
447 Ga0058860_11921943
448 Ga0058860_12040478
449 Ga0058862_12062171
450 Ga0065704_10164901
451 Ga0065704_10318571
452 Ga0065712_10137898
453 Ga0065712_10259094
454 Ga0065715_10002301
455 Ga0065715_10396831
456 Ga0065715_10492988
457 Ga0065715_10911146
458 Ga0065707_10087953
459 Ga0065707_10244424
460 Ga0070658_11508025
461 Ga0070676_10197651
462 Ga0070676_10201415
463 Ga0070690_100054702
464 Ga0070690_100323086
465 Ga0070690_100570013
466 Ga0070670_100102699
467 Ga0070670_100607922
468 Ga0070677_10014750
469 Ga0070677_10613908
470 Ga0068869_100122503
471 Ga0070666_10038305
472 Ga0070680_100670422
473 Ga0070680_101117615
474 Ga0070682_100114465
475 Ga0070682_100804278
476 Ga0068868_100286692
477 Ga0068868_100479704
478 Ga0068868_100875171
479 Ga0070660_100435583
480 Ga0070689_100020410
481 Ga0070689_100615346
482 Ga0070687_100001708
483 Ga0070687_100544645
484 Ga0070661_100013186
485 Ga0070661_100140186
486 Ga0070661_100184243
487 Ga0070692_10604818
488 Ga0070668_100248761
489 Ga0070668_101009501
490 Ga0070669_100396404
491 Ga0070669_100761976
492 Ga0070675_100077876
493 Ga0070675_100150346
494 Ga0070675_100306370
495 Ga0070671_100260065
496 Ga0070671_100321698
497 Ga0070674_100382918
498 Ga0070673_100367293
499 Ga0070673_100945222
500 Ga0070688_100346464
501 Ga0070659_100023324
502 Ga0070659_100593509
503 Ga0070667_100145347
504 Ga0070703_10301300
505 Ga0070701_10019656
506 Ga0070701_10352902
507 Ga0070705_100327057
508 Ga0070700_100266064
509 Ga0070700_100613720
510 Ga0070700_100944887
511 Ga0070700_101746962
512 Ga0070694_100818153
513 Ga0070663_100573631
514 Ga0070678_100101931
515 Ga0070678_100571160
516 Ga0070678_100730879
517 Ga0070678_101892625
518 Ga0070662_100357522
519 Ga0070662_100995398
520 Ga0068867_100189147
521 Ga0068867_100827627
522 Ga0070685_10032082
523 Ga0070699_100691058
524 Ga0070684_100341190
525 Ga0068853_100813006
526 Ga0070672_100296228
527 Ga0070672_101247791
528 Ga0070686_100057791
529 Ga0070686_100093265
530 Ga0070695_100663848
531 Ga0070695_101313385
532 Ga0070693_100608268
533 Ga0070665_100027782
534 Ga0070704_100213729
535 Ga0070664_100007886
536 Ga0070664_100263057
537 Ga0070664_101804297
538 Ga0068857_101336638
539 Ga0068854_101311146
540 Ga0070702_100081304
541 Ga0068852_100648340
542 Ga0068852_102071434
543 Ga0068859_100055877
544 Ga0068864_100017945
545 Ga0068861_100021274
546 Ga0068861_100076551
547 Ga0068870_10007539
548 Ga0068863_100099625
549 Ga0068863_100972107
550 Ga0068858_100209329
551 Ga0068860_100045886
552 Ga0068862_100414560
553 Ga0068862_100983535
554 Ga0075432_10184847
555 Ga0097621_100027883
556 Ga0097621_100449162
557 Ga0068871_100020538
558 Ga0068871_100322305
559 Ga0068871_100645581
560 Ga0075428_100001764
561 Ga0075428_100530071
562 Ga0075428_100580499
563 Ga0075428_101044035
564 Ga0075428_101123000
565 Ga0075428_101339828
566 Ga0075430_100000262
567 Ga0075430_100015447
568 Ga0075430_100129211
569 Ga0075431_100000517
570 Ga0075431_100004120
571 Ga0075433_10001213
572 Ga0075434_100147612
573 Ga0075429_100005064
574 Ga0075429_100070809
575 Ga0075429_101542324
576 Ga0075429_101589702
577 Ga0068865_100206351
578 Ga0068865_101713063
579 Ga0097620_100055873
580 Ga0075435_100562367
581 Ga0111539_10009412
582 Ga0111539_10060187
583 Ga0111539_12378866
584 Ga0105245_10753410
585 Ga0105245_11051622
586 Ga0105247_10317990
587 Ga0114129_10791126
588 Ga0114129_12488544
589 Ga0105243_11629896
590 Ga0105248_10026668
591 Ga0105248_12748745
592 Ga0105249_10070182
593 Ga0105249_11731735
594 Ga0105239_10982643
595 Ga0105246_10037952
596 Ga0105246_12293548
597 Ga0157317_1014603
598 Ga0157316_1020385
599 Ga0157371_10320833
600 Ga0157370_10349880
601 Ga0157370_11730620
602 Ga0157374_10063703
603 Ga0163162_10158485
604 Ga0163162_10306912
605 Ga0157372_11186227
606 Ga0157375_10023056
607 Ga0157375_12264276
608 Ga0157375_12348352
609 Ga0163163_12123051
610 Ga0157380_10218523
611 Ga0157380_11424574
612 Ga0157377_10012066
613 Ga0157377_10022601
614 Ga0157377_10090970
615 Ga0157379_10085500
616 Ga0157376_10118554
617 Ga0157376_10295167
618 Ga0157376_10717442
619 Ga0163161_10198422
620 Ga0207697_10000408
621 Ga0207697_10395578
622 Ga0207682_10003900
623 Ga0207682_10301119
624 Ga0207688_10004781
625 Ga0207688_10034263
626 Ga0207680_10161903
627 Ga0207647_10212299
628 Ga0207645_10010104
629 Ga0207645_10815954
630 Ga0207645_11069606
631 Ga0207643_10011392
632 Ga0207660_11269424
633 Ga0207662_10000756
634 Ga0207662_10587898
635 Ga0207657_10609879
636 Ga0207649_10039634
637 Ga0207649_10965029
638 Ga0207681_10046619
639 Ga0207681_10412708
640 Ga0207681_10723570
641 Ga0207650_10837039
642 Ga0207659_10010400
643 Ga0207659_10095159
644 Ga0207659_10130374
645 Ga0207659_10305342
646 Ga0207687_10435740
647 Ga0207644_11163425
648 Ga0207644_11657490
649 Ga0207690_10527472
650 Ga0207706_10002300
651 Ga0207706_10111236
652 Ga0207670_10382603
653 Ga0207669_11916316
654 Ga0207704_10128180
655 Ga0207691_10019048
656 Ga0207691_10100797
657 Ga0207691_10555994
658 Ga0207691_10931744
659 Ga0207711_10153046
660 Ga0207689_10001150
661 Ga0207679_10036766
662 Ga0207679_10293605
663 Ga0207651_10007438
664 Ga0207651_10666775
665 Ga0207712_10050263
666 Ga0207712_11192932
667 Ga0207668_12157476
668 Ga0207658_10032957
669 Ga0207658_11338649
670 Ga0207677_10583866
671 Ga0207677_11576959
672 Ga0207677_12152679
673 Ga0207703_10319152
674 Ga0207678_10599102
675 Ga0207708_10002396
676 Ga0207708_11753163
677 Ga0207641_10074379
678 Ga0207641_10820002
679 Ga0207648_11322788
680 Ga0207676_10051735
681 Ga0207674_11056796
682 Ga0207675_100756132
683 Ga0207683_10104475
684 Ga0207683_10439236
685 Ga0207683_11423337
686 Ga0207698_10996407
687 Ga0209995_1042382
688 Ga0210002_1023899
689 Ga0209998_10197225
690 Ga0207428_10000864
691 Ga0207428_10009845
692 Ga0207428_10014781
693 Ga0207428_10056720
694 Ga0268266_10421722
695 Ga0268265_10164457
696 Ga0307408_100023731
697 Ga0307405_10013521
698 Ga0307413_10121881
699 Ga0307410_10715035
700 Ga0307406_10269204
701 Ga0307407_10829123
702 Ga0307412_11259797
703 Ga0307409_100303981
704 Ga0307416_100024700
705 Ga0307416_100411059
706 Ga0307414_10178110
707 Ga0307411_10023966
708 Ga0307411_12215952
709 Ga0307415_100189350
710 Ga0373928_0267198
711 Ga0373949_0082836
712 Ga0373951_0247767
713 Ga0373932_0015295
714 Ga0373941_0163967
715 Ga0373960_0171413
716 Ga0373931_0706947
717 Ga0439439_0117979
718 Ga0451800_1310209
719 Ga0451853_1107238
720 Ga0439433_0044774
721 Ga0439448_0318944
722 Ga0439450_044490
723 Ga0439450_214264
724 Ga0450917_015262
725 Ga0450923_047135
726 Ga0450898_020355
727 Ga0450908_070483
728 Ga0439435_0340804
729 Ga0439435_0343286
730 Ga0439464_0028140
731 Ga0451576_1998965
732 Ga0495594_0147024
733 Ga0495640_0661900
734 Ga0495598_0023856
735 Ga0495659_0066335
736 Ga0495659_0547388
737 Ga0495647_0452388
738 Ga0495670_0478897
739 Ga0496108_0298150
740 Ga0496109_0079707
741 Ga0501306_038506
742 Ga0501306_038648
743 Ga0501308_012567
744 Ga0501308_055262
745 Ga0501308_086159
746 Ga0501309_038113
747 Ga0501309_098103
748 Ga0501310_005117
749 Ga0501310_059876
750 Ga0501310_070209
751 Ga0501310_077872
752 Ga0501341_13641
753 Ga0501305_024102
754 Ga0501305_059161
755 Ga0501305_090212
756 Ga0501305_114027
757 Ga0501307_032294
758 Ga0501307_072249
759 Ga0501298_121098
760 Ga0501298_136624
761 Ga0501299_078079
762 Ga0501311_027729
763 Ga0501311_092428
764 Ga0501312_044618
765 Ga0501312_078610
766 Ga0501312_081376
767 Ga0501312_090181
768 Ga0501312_122302
769 Ga0501313_032617
770 Ga0501315_036797
771 Ga0501316_029676
772 Ga0501316_077505
773 Ga0501317_037658
774 Ga0501318_030996
775 Ga0501320_023703
776 Ga0501320_039914
777 Ga0501320_059219
778 Ga0501321_031426
779 Ga0501321_070737
780 Ga0501322_009136
781 Ga0501323_032833
782 Ga0501323_079417
783 Ga0501324_016405
784 Ga0501324_022108
785 Ga0501325_017584
786 Ga0501331_10695
787 Ga0501332_16132
788 Ga0501333_012303
789 Ga0501335_036145
790 Ga0501336_017474
791 Ga0501340_008413
792 Ga0501033_0705299
793 Ga0501036_0227102
794 Ga0501039_0210790
795 Ga0501041_0019051
796 Ga0501042_0039610
797 Ga0501042_1250380
798 Ga0501046_0021345
799 Ga0501048_0213789
800 Ga0501072_0708395
801 Ga0501072_1312963
802 Ga0501074_0146476
803 Ga0501076_0099779
804 Ga0501077_0458762
805 Ga0501217_232119
806 Ga0501227_025751
807 Ga0501249_020865
808 Ga0501221_156388
809 Ga0501245_033204
810 Ga0501079_0053167
811 Ga0501080_0522649
812 Ga0501081_0136036
813 Ga0501268_011817
814 Ga0501274_047943
815 Ga0501282_014645
816 Ga0501283_003236
817 Ga0501045_0095524
818 Ga0501045_1200386
819 nmdc:mga05p37_1012262_c1
820 nmdc:mga05p37_1507075_c1
821 nmdc:mga05p37_339781_c1
822 nmdc:mga05p37_47974_c1
823 nmdc:mga05p37_56175_c1
824 nmdc:mga05p37_65407_c1
825 nmdc:mga09592_1330228_c1
826 nmdc:mga09592_1488113_c1
827 nmdc:mga09592_1618_c1
828 nmdc:mga09592_278908_c1
829 nmdc:mga09592_412377_c1
830 nmdc:mga0qj67_258_c1
831 nmdc:mga0qj67_44856_c1
832 nmdc:mga0qj67_55087_c1
833 nmdc:mga06r32_146377_c1
834 nmdc:mga06r32_1786_c1
835 nmdc:mga06r32_8881_c1
836 nmdc:mga08y16_1293088_c1
837 nmdc:mga08y16_1784_c1
838 nmdc:mga08y16_192089_c1
839 nmdc:mga08y16_61229_c1
840 nmdc:mga0n895_4553_c1
841 nmdc:mga0rr50_724916_c1
842 nmdc:mga0a205_1204_c1
843 nmdc:mga0a205_377755_c1
844 Ga0501084_0015111
845 Ga0501082_0099065
846 Ga0530510_0840831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04964

Flp_Fap

Flp/Fap pilin component

20

65

0.96

Map