F464769
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 312 | 568 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0061211|Ga0501072_0061211_1092_2084 |
| Length | 330 |
| Sequence | VCAFRAWRPALIVTFPAHRYDNKLQPLRVSRVSRQIPTCRAPDPDTRKPRYRPPPLACDAHCHIFGPAARFPYAEDRSYTPPDAPLERFRELQAILGFERAVLVNASCHGTDNRVILDAIAQSGGQYRGVANADDSFTTQDFEKLHEGGCRGVRFNFVRHLGGMPDPGEFDRVIERIRPLGWHVVLHFDAADVVEFGGLLRRLPVPFVIDHMGRVPAAAGLQQEPFRQLLELARRDNCWVKICGAERISSAGPPFTDAVPFAQALIDVAPDRILWGTDWPHPNITKHMPNDGDLVDLIPLMAPDAAMQTRILVDNPHRLYGFETPRHRNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2852103415 | Edaphovirga cremea DSM 105170 | Isolate | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 184 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 211 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 212 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 264 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 292 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 295 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 298 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 299 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 301 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 302 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 303 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 304 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 305 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 306 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 309 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.47 |
| Metatranscriptomes | 0.35 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.5 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 91.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10003008 | 3300002075 | Bacteria | 4309 |
| 2 | JGI25406J46586_10016100 | 3300003203 | Bacteria | 3128 |
| 3 | JGI25407J50210_10011898 | 3300003373 | Bacteria | 2228 |
| 4 | Ga0065714_10115941 | 3300005288 | Bacteria | 1409 |
| 5 | Ga0065712_10068613 | 3300005290 | Bacteria | 9657 |
| 6 | Ga0070690_100000209 | 3300005330 | Bacteria | 30439 |
| 7 | Ga0070690_100006618 | 3300005330 | Bacteria | 6582 |
| 8 | Ga0070670_100036463 | 3300005331 | Bacteria | 4231 |
| 9 | Ga0068869_100003175 | 3300005334 | Bacteria | 10031 |
| 10 | Ga0070666_10024585 | 3300005335 | Bacteria | 3925 |
| 11 | Ga0070666_10106531 | 3300005335 | Bacteria | 1936 |
| 12 | Ga0070680_100002272 | 3300005336 | Bacteria | 14211 |
| 13 | Ga0070680_100009242 | 3300005336 | Bacteria | 7561 |
| 14 | Ga0070680_100448697 | 3300005336 | Bacteria | 1101 |
| 15 | Ga0070682_100001825 | 3300005337 | Bacteria | 11864 |
| 16 | Ga0070682_100314484 | 3300005337 | Bacteria | 1154 |
| 17 | Ga0068868_100000337 | 3300005338 | Bacteria | 31658 |
| 18 | Ga0068868_100006826 | 3300005338 | Bacteria | 8103 |
| 19 | Ga0070689_100003242 | 3300005340 | Bacteria | 10793 |
| 20 | Ga0070687_100000022 | 3300005343 | Bacteria | 52094 |
| 21 | Ga0070687_100340981 | 3300005343 | Bacteria | 964 |
| 22 | Ga0070661_100089370 | 3300005344 | Bacteria | 2281 |
| 23 | Ga0070692_10001244 | 3300005345 | Bacteria | 9092 |
| 24 | Ga0070692_10035296 | 3300005345 | Bacteria | 2531 |
| 25 | Ga0070692_10073413 | 3300005345 | Bacteria | 1828 |
| 26 | Ga0070671_100001900 | 3300005355 | Bacteria | 15980 |
| 27 | Ga0070671_100006717 | 3300005355 | Bacteria | 9205 |
| 28 | Ga0070671_100034603 | 3300005355 | Bacteria | 4182 |
| 29 | Ga0070674_100410170 | 3300005356 | Bacteria | 1109 |
| 30 | Ga0070673_100015726 | 3300005364 | Bacteria | 5325 |
| 31 | Ga0070659_100065413 | 3300005366 | Bacteria | 2880 |
| 32 | Ga0070667_100000762 | 3300005367 | Bacteria | 30627 |
| 33 | Ga0070667_100023615 | 3300005367 | Bacteria | 5103 |
| 34 | Ga0070667_100043035 | 3300005367 | Bacteria | 3789 |
| 35 | Ga0070709_10058531 | 3300005434 | Bacteria | 2444 |
| 36 | Ga0070713_100209515 | 3300005436 | Bacteria | 1764 |
| 37 | Ga0070701_10000098 | 3300005438 | Bacteria | 24485 |
| 38 | Ga0070701_10033049 | 3300005438 | Bacteria | 2582 |
| 39 | Ga0070705_100000199 | 3300005440 | Bacteria | 35224 |
| 40 | Ga0070705_100144062 | 3300005440 | Bacteria | 1572 |
| 41 | Ga0070700_100000502 | 3300005441 | Bacteria | 19488 |
| 42 | Ga0070700_100045225 | 3300005441 | Bacteria | 2715 |
| 43 | Ga0070694_100009600 | 3300005444 | Bacteria | 5936 |
| 44 | Ga0070694_100126085 | 3300005444 | Bacteria | 1843 |
| 45 | Ga0070694_100227565 | 3300005444 | Bacteria | 1402 |
| 46 | Ga0070708_100194917 | 3300005445 | Bacteria | 1895 |
| 47 | Ga0070662_100365252 | 3300005457 | Bacteria | 1185 |
| 48 | Ga0070681_10001127 | 3300005458 | Bacteria | 22938 |
| 49 | Ga0070681_10010799 | 3300005458 | Bacteria | 9026 |
| 50 | Ga0070681_10018326 | 3300005458 | Bacteria | 6997 |
| 51 | Ga0070681_10070649 | 3300005458 | Bacteria | 3456 |
| 52 | Ga0068867_100000231 | 3300005459 | Bacteria | 36523 |
| 53 | Ga0070706_100012692 | 3300005467 | Bacteria | 7794 |
| 54 | Ga0070706_100017917 | 3300005467 | Bacteria | 6533 |
| 55 | Ga0070706_100091186 | 3300005467 | Bacteria | 2826 |
| 56 | Ga0070707_100008500 | 3300005468 | Bacteria | 9536 |
| 57 | Ga0070707_100019315 | 3300005468 | Bacteria | 6418 |
| 58 | Ga0070707_100051739 | 3300005468 | Bacteria | 3937 |
| 59 | Ga0070707_100102262 | 3300005468 | Bacteria | 2776 |
| 60 | Ga0070698_100084672 | 3300005471 | Bacteria | 3158 |
| 61 | Ga0070699_100007601 | 3300005518 | Bacteria | 9422 |
| 62 | Ga0070699_100058982 | 3300005518 | Bacteria | 3325 |
| 63 | Ga0070679_100003898 | 3300005530 | Bacteria | 13718 |
| 64 | Ga0070679_100010795 | 3300005530 | Bacteria | 8673 |
| 65 | Ga0070679_100029290 | 3300005530 | Bacteria | 5433 |
| 66 | Ga0070679_100073215 | 3300005530 | Bacteria | 3418 |
| 67 | Ga0070679_100315605 | 3300005530 | Bacteria | 1512 |
| 68 | Ga0070684_100701186 | 3300005535 | Bacteria | 944 |
| 69 | Ga0070697_100136230 | 3300005536 | Bacteria | 2062 |
| 70 | Ga0068853_100148576 | 3300005539 | Bacteria | 2108 |
| 71 | Ga0070686_100000124 | 3300005544 | Bacteria | 54388 |
| 72 | Ga0070686_100043036 | 3300005544 | Bacteria | 2831 |
| 73 | Ga0070686_100065750 | 3300005544 | Bacteria | 2357 |
| 74 | Ga0070695_100000276 | 3300005545 | Bacteria | 25838 |
| 75 | Ga0070696_100000275 | 3300005546 | Bacteria | 30800 |
| 76 | Ga0070696_100047489 | 3300005546 | Bacteria | 2979 |
| 77 | Ga0070693_100000130 | 3300005547 | Bacteria | 33644 |
| 78 | Ga0070665_100003310 | 3300005548 | Bacteria | 17255 |
| 79 | Ga0070665_100061093 | 3300005548 | Bacteria | 3777 |
| 80 | Ga0070665_100158076 | 3300005548 | Bacteria | 2268 |
| 81 | Ga0070704_100001666 | 3300005549 | Bacteria | 12048 |
| 82 | Ga0070704_100004741 | 3300005549 | Bacteria | 7868 |
| 83 | Ga0068855_100000977 | 3300005563 | Bacteria | 35582 |
| 84 | Ga0068855_100034599 | 3300005563 | Bacteria | 6022 |
| 85 | Ga0070664_100000788 | 3300005564 | Bacteria | 24413 |
| 86 | Ga0068857_100105348 | 3300005577 | Bacteria | 2532 |
| 87 | Ga0068857_100341291 | 3300005577 | Bacteria | 1386 |
| 88 | Ga0068854_100000985 | 3300005578 | Bacteria | 17141 |
| 89 | Ga0068854_100014686 | 3300005578 | Bacteria | 5167 |
| 90 | Ga0068856_100005115 | 3300005614 | Bacteria | 12961 |
| 91 | Ga0068856_100045097 | 3300005614 | Bacteria | 4340 |
| 92 | Ga0068856_100081299 | 3300005614 | Bacteria | 3214 |
| 93 | Ga0070702_100000042 | 3300005615 | Bacteria | 34567 |
| 94 | Ga0070702_100161146 | 3300005615 | Bacteria | 1450 |
| 95 | Ga0068852_100000919 | 3300005616 | Bacteria | 19508 |
| 96 | Ga0068852_100389335 | 3300005616 | Bacteria | 1369 |
| 97 | Ga0068859_100001667 | 3300005617 | Bacteria | 22614 |
| 98 | Ga0068859_100001713 | 3300005617 | Bacteria | 22369 |
| 99 | Ga0068859_100070620 | 3300005617 | Bacteria | 3528 |
| 100 | Ga0068859_100133799 | 3300005617 | Bacteria | 2551 |
| 101 | Ga0068859_100245840 | 3300005617 | Bacteria | 1879 |
| 102 | Ga0068864_100005452 | 3300005618 | Bacteria | 10428 |
| 103 | Ga0068866_10002281 | 3300005718 | Bacteria | 7943 |
| 104 | Ga0068866_10117078 | 3300005718 | Bacteria | 1496 |
| 105 | Ga0068861_100001131 | 3300005719 | Bacteria | 16573 |
| 106 | Ga0068851_10027023 | 3300005834 | Bacteria | 2826 |
| 107 | Ga0068870_10024963 | 3300005840 | Bacteria | 2963 |
| 108 | Ga0068863_100002053 | 3300005841 | Bacteria | 19946 |
| 109 | Ga0068863_100037128 | 3300005841 | Bacteria | 4639 |
| 110 | Ga0068858_100000238 | 3300005842 | Bacteria | 59573 |
| 111 | Ga0068858_100009148 | 3300005842 | Bacteria | 9473 |
| 112 | Ga0068858_100013228 | 3300005842 | Bacteria | 7776 |
| 113 | Ga0068858_100124906 | 3300005842 | Bacteria | 2408 |
| 114 | Ga0068860_100000873 | 3300005843 | Bacteria | 33457 |
| 115 | Ga0068860_100009657 | 3300005843 | Bacteria | 9584 |
| 116 | Ga0068860_100023675 | 3300005843 | Bacteria | 5936 |
| 117 | Ga0068860_100509477 | 3300005843 | Bacteria | 1202 |
| 118 | Ga0068862_100046333 | 3300005844 | Bacteria | 3710 |
| 119 | Ga0068862_100131207 | 3300005844 | Bacteria | 2216 |
| 120 | Ga0081539_10000123 | 3300005985 | Bacteria | 181245 |
| 121 | Ga0075365_10011690 | 3300006038 | Bacteria | 5174 |
| 122 | Ga0075368_10029483 | 3300006042 | Bacteria | 2121 |
| 123 | Ga0075368_10035288 | 3300006042 | Bacteria | 1951 |
| 124 | Ga0075368_10036639 | 3300006042 | Bacteria | 1916 |
| 125 | Ga0075368_10094912 | 3300006042 | Bacteria | 1222 |
| 126 | Ga0075363_100015115 | 3300006048 | Bacteria | 3787 |
| 127 | Ga0075363_100018743 | 3300006048 | Bacteria | 3452 |
| 128 | Ga0075363_100062413 | 3300006048 | Bacteria | 2009 |
| 129 | Ga0075364_10001926 | 3300006051 | Bacteria | 11551 |
| 130 | Ga0075364_10120451 | 3300006051 | Bacteria | 1756 |
| 131 | Ga0070712_100015939 | 3300006175 | Bacteria | 4847 |
| 132 | Ga0070712_100212332 | 3300006175 | Bacteria | 1527 |
| 133 | Ga0097621_100007905 | 3300006237 | Bacteria | 7628 |
| 134 | Ga0097621_100029117 | 3300006237 | Bacteria | 4359 |
| 135 | Ga0097621_100052527 | 3300006237 | Bacteria | 3320 |
| 136 | Ga0097621_100109888 | 3300006237 | Bacteria | 2329 |
| 137 | Ga0075370_10173701 | 3300006353 | Bacteria | 1267 |
| 138 | Ga0068871_100024321 | 3300006358 | Bacteria | 4696 |
| 139 | Ga0068871_100026980 | 3300006358 | Bacteria | 4488 |
| 140 | Ga0075428_100003594 | 3300006844 | Bacteria | 16993 |
| 141 | Ga0075428_100030576 | 3300006844 | Bacteria | 5955 |
| 142 | Ga0075428_100039971 | 3300006844 | Bacteria | 5162 |
| 143 | Ga0075430_100004707 | 3300006846 | Bacteria | 11476 |
| 144 | Ga0075430_100548036 | 3300006846 | Bacteria | 954 |
| 145 | Ga0075431_100295564 | 3300006847 | Bacteria | 1637 |
| 146 | Ga0075433_10001734 | 3300006852 | Bacteria | 16274 |
| 147 | Ga0075433_10073215 | 3300006852 | Bacteria | 3013 |
| 148 | Ga0075429_100259710 | 3300006880 | Bacteria | 1521 |
| 149 | Ga0068865_100000673 | 3300006881 | Bacteria | 19281 |
| 150 | Ga0068865_100364810 | 3300006881 | Bacteria | 1174 |
| 151 | Ga0075436_100000476 | 3300006914 | Bacteria | 26049 |
| 152 | Ga0097620_100001667 | 3300006931 | Bacteria | 22614 |
| 153 | Ga0097620_100001713 | 3300006931 | Bacteria | 22369 |
| 154 | Ga0097620_100070621 | 3300006931 | Bacteria | 3528 |
| 155 | Ga0097620_100133812 | 3300006931 | Bacteria | 2551 |
| 156 | Ga0097620_100245846 | 3300006931 | Bacteria | 1879 |
| 157 | Ga0075435_100001047 | 3300007076 | Bacteria | 17522 |
| 158 | Ga0075435_100065017 | 3300007076 | Bacteria | 2965 |
| 159 | Ga0075435_100128948 | 3300007076 | Bacteria | 2116 |
| 160 | Ga0075435_100173668 | 3300007076 | Bacteria | 1819 |
| 161 | Ga0105250_10135451 | 3300009092 | Bacteria | 1018 |
| 162 | Ga0105240_10001667 | 3300009093 | Bacteria | 37697 |
| 163 | Ga0105240_10011070 | 3300009093 | Bacteria | 12612 |
| 164 | Ga0105240_10022406 | 3300009093 | Bacteria | 8374 |
| 165 | Ga0105240_10031951 | 3300009093 | Bacteria | 6819 |
| 166 | Ga0105240_10090783 | 3300009093 | Bacteria | 3733 |
| 167 | Ga0105240_10153053 | 3300009093 | Bacteria | 2745 |
| 168 | Ga0105245_10000216 | 3300009098 | Bacteria | 55016 |
| 169 | Ga0105245_10006136 | 3300009098 | Bacteria | 10575 |
| 170 | Ga0105247_10000162 | 3300009101 | Bacteria | 65804 |
| 171 | Ga0105247_10107898 | 3300009101 | Bacteria | 1788 |
| 172 | Ga0114129_10029481 | 3300009147 | Bacteria | 7773 |
| 173 | Ga0114129_10075941 | 3300009147 | Bacteria | 4678 |
| 174 | Ga0114129_10206354 | 3300009147 | Bacteria | 2658 |
| 175 | Ga0105243_10000351 | 3300009148 | Bacteria | 49081 |
| 176 | Ga0105242_10000213 | 3300009176 | Bacteria | 45343 |
| 177 | Ga0105248_10000732 | 3300009177 | Bacteria | 36950 |
| 178 | Ga0105248_10023489 | 3300009177 | Bacteria | 6849 |
| 179 | Ga0105248_10066798 | 3300009177 | Bacteria | 4037 |
| 180 | Ga0105248_10322238 | 3300009177 | Bacteria | 1741 |
| 181 | Ga0105238_10005467 | 3300009551 | Bacteria | 12560 |
| 182 | Ga0105238_10043549 | 3300009551 | Bacteria | 4541 |
| 183 | Ga0105238_10067312 | 3300009551 | Bacteria | 3583 |
| 184 | Ga0105238_10474463 | 3300009551 | Bacteria | 1250 |
| 185 | Ga0105249_10000741 | 3300009553 | Bacteria | 29423 |
| 186 | Ga0105249_10017725 | 3300009553 | Bacteria | 6325 |
| 187 | Ga0105239_10043360 | 3300010375 | Bacteria | 4931 |
| 188 | Ga0157370_10002946 | 3300013104 | Bacteria | 20263 |
| 189 | Ga0157370_10013826 | 3300013104 | Bacteria | 8291 |
| 190 | Ga0157370_10140238 | 3300013104 | Bacteria | 2252 |
| 191 | Ga0157369_10002769 | 3300013105 | Bacteria | 20942 |
| 192 | Ga0157369_10010329 | 3300013105 | Bacteria | 10647 |
| 193 | Ga0157369_10176136 | 3300013105 | Bacteria | 2252 |
| 194 | Ga0157374_10018681 | 3300013296 | Bacteria | 6123 |
| 195 | Ga0157378_10000354 | 3300013297 | Bacteria | 45097 |
| 196 | Ga0163162_10026604 | 3300013306 | Bacteria | 5719 |
| 197 | Ga0163162_10129523 | 3300013306 | Bacteria | 2631 |
| 198 | Ga0157372_10109273 | 3300013307 | Bacteria | 3166 |
| 199 | Ga0157375_10184874 | 3300013308 | Bacteria | 2237 |
| 200 | Ga0163163_10275592 | 3300014325 | Bacteria | 1733 |
| 201 | Ga0157380_10246705 | 3300014326 | Bacteria | 1614 |
| 202 | Ga0157380_10346442 | 3300014326 | Bacteria | 1388 |
| 203 | Ga0157377_10145125 | 3300014745 | Bacteria | 1462 |
| 204 | Ga0157379_10003779 | 3300014968 | Bacteria | 12888 |
| 205 | Ga0157379_10011481 | 3300014968 | Bacteria | 7731 |
| 206 | Ga0157379_10137258 | 3300014968 | Bacteria | 2204 |
| 207 | Ga0157376_10012315 | 3300014969 | Bacteria | 6345 |
| 208 | Ga0157376_10103519 | 3300014969 | Bacteria | 2493 |
| 209 | Ga0206353_10573776 | 3300020082 | Bacteria | 2013 |
| 210 | Ga0213871_10001009 | 3300021441 | Bacteria | 4411 |
| 211 | Ga0207656_10068118 | 3300025321 | Bacteria | 1576 |
| 212 | Ga0207696_1066868 | 3300025711 | Bacteria | 1003 |
| 213 | Ga0207653_10056740 | 3300025885 | Bacteria | 1314 |
| 214 | Ga0207642_10001235 | 3300025899 | Bacteria | 7910 |
| 215 | Ga0207642_10085337 | 3300025899 | Bacteria | 1545 |
| 216 | Ga0207680_10013226 | 3300025903 | Bacteria | 4232 |
| 217 | Ga0207680_10031331 | 3300025903 | Bacteria | 3011 |
| 218 | Ga0207680_10036047 | 3300025903 | Bacteria | 2846 |
| 219 | Ga0207647_10007751 | 3300025904 | Bacteria | 7728 |
| 220 | Ga0207647_10164104 | 3300025904 | Bacteria | 1295 |
| 221 | Ga0207643_10018680 | 3300025908 | Bacteria | 3797 |
| 222 | Ga0207684_10013597 | 3300025910 | Bacteria | 7035 |
| 223 | Ga0207684_10120246 | 3300025910 | Bacteria | 2252 |
| 224 | Ga0207707_10000035 | 3300025912 | Bacteria | 147299 |
| 225 | Ga0207707_10000591 | 3300025912 | Bacteria | 36552 |
| 226 | Ga0207707_10006531 | 3300025912 | Bacteria | 10178 |
| 227 | Ga0207707_10016998 | 3300025912 | Bacteria | 6337 |
| 228 | Ga0207707_10052167 | 3300025912 | Bacteria | 3562 |
| 229 | Ga0207707_10073754 | 3300025912 | Bacteria | 2976 |
| 230 | Ga0207695_10003010 | 3300025913 | Bacteria | 24221 |
| 231 | Ga0207695_10008455 | 3300025913 | Bacteria | 12888 |
| 232 | Ga0207695_10018181 | 3300025913 | Bacteria | 8134 |
| 233 | Ga0207695_10034578 | 3300025913 | Bacteria | 5493 |
| 234 | Ga0207695_10048033 | 3300025913 | Bacteria | 4510 |
| 235 | Ga0207695_10135433 | 3300025913 | Unclassified | 2417 |
| 236 | Ga0207671_10250392 | 3300025914 | Bacteria | 1393 |
| 237 | Ga0207693_10012278 | 3300025915 | Bacteria | 6922 |
| 238 | Ga0207660_10000599 | 3300025917 | Bacteria | 24309 |
| 239 | Ga0207660_10021662 | 3300025917 | Bacteria | 4325 |
| 240 | Ga0207660_10098037 | 3300025917 | Bacteria | 2185 |
| 241 | Ga0207662_10000021 | 3300025918 | Bacteria | 72688 |
| 242 | Ga0207649_10069913 | 3300025920 | Bacteria | 2237 |
| 243 | Ga0207652_10001126 | 3300025921 | Bacteria | 24078 |
| 244 | Ga0207652_10007317 | 3300025921 | Bacteria | 8895 |
| 245 | Ga0207652_10051036 | 3300025921 | Bacteria | 3545 |
| 246 | Ga0207652_10270102 | 3300025921 | Bacteria | 1534 |
| 247 | Ga0207646_10005579 | 3300025922 | Bacteria | 13213 |
| 248 | Ga0207646_10016170 | 3300025922 | Bacteria | 7012 |
| 249 | Ga0207646_10286414 | 3300025922 | Bacteria | 1489 |
| 250 | Ga0207650_10207764 | 3300025925 | Bacteria | 1571 |
| 251 | Ga0207659_10000107 | 3300025926 | Bacteria | 49113 |
| 252 | Ga0207687_10000136 | 3300025927 | Bacteria | 48993 |
| 253 | Ga0207687_10035395 | 3300025927 | Bacteria | 3395 |
| 254 | Ga0207644_10001361 | 3300025931 | Bacteria | 15730 |
| 255 | Ga0207644_10017983 | 3300025931 | Bacteria | 4780 |
| 256 | Ga0207644_10018233 | 3300025931 | Bacteria | 4746 |
| 257 | Ga0207644_10146280 | 3300025931 | Bacteria | 1825 |
| 258 | Ga0207644_10258273 | 3300025931 | Bacteria | 1392 |
| 259 | Ga0207686_10000345 | 3300025934 | Bacteria | 33420 |
| 260 | Ga0207709_10000272 | 3300025935 | Bacteria | 60885 |
| 261 | Ga0207670_10000515 | 3300025936 | Bacteria | 21318 |
| 262 | Ga0207670_10026864 | 3300025936 | Bacteria | 3633 |
| 263 | Ga0207704_10000208 | 3300025938 | Bacteria | 29760 |
| 264 | Ga0207704_10315996 | 3300025938 | Bacteria | 1203 |
| 265 | Ga0207691_10016680 | 3300025940 | Bacteria | 6974 |
| 266 | Ga0207711_10016315 | 3300025941 | Bacteria | 6170 |
| 267 | Ga0207711_10032731 | 3300025941 | Bacteria | 4397 |
| 268 | Ga0207711_10225848 | 3300025941 | Bacteria | 1714 |
| 269 | Ga0207689_10000170 | 3300025942 | Bacteria | 57072 |
| 270 | Ga0207661_10067559 | 3300025944 | Bacteria | 2908 |
| 271 | Ga0207661_10307150 | 3300025944 | Bacteria | 1423 |
| 272 | Ga0207661_10386486 | 3300025944 | Bacteria | 1267 |
| 273 | Ga0207679_10263788 | 3300025945 | Bacteria | 1470 |
| 274 | Ga0207667_10001513 | 3300025949 | Bacteria | 29191 |
| 275 | Ga0207667_10008858 | 3300025949 | Bacteria | 11909 |
| 276 | Ga0207667_10029840 | 3300025949 | Bacteria | 5908 |
| 277 | Ga0207651_10010884 | 3300025960 | Bacteria | 5063 |
| 278 | Ga0207712_10005705 | 3300025961 | Bacteria | 7846 |
| 279 | Ga0207712_10065089 | 3300025961 | Bacteria | 2601 |
| 280 | Ga0207712_10087398 | 3300025961 | Bacteria | 2286 |
| 281 | Ga0207640_10001341 | 3300025981 | Bacteria | 13336 |
| 282 | Ga0207640_10004757 | 3300025981 | Bacteria | 7369 |
| 283 | Ga0207640_10198793 | 3300025981 | Bacteria | 1517 |
| 284 | Ga0207640_10342488 | 3300025981 | Bacteria | 1198 |
| 285 | Ga0207658_10063011 | 3300025986 | Bacteria | 2777 |
| 286 | Ga0207658_10109291 | 3300025986 | Bacteria | 2182 |
| 287 | Ga0207677_10001117 | 3300026023 | Bacteria | 14634 |
| 288 | Ga0207703_10002163 | 3300026035 | Bacteria | 17264 |
| 289 | Ga0207703_10021905 | 3300026035 | Bacteria | 5004 |
| 290 | Ga0207703_10022681 | 3300026035 | Bacteria | 4929 |
| 291 | Ga0207703_10031123 | 3300026035 | Bacteria | 4217 |
| 292 | Ga0207639_10084273 | 3300026041 | Bacteria | 2525 |
| 293 | Ga0207639_10118330 | 3300026041 | Bacteria | 2172 |
| 294 | Ga0207708_10000222 | 3300026075 | Bacteria | 45117 |
| 295 | Ga0207708_10003419 | 3300026075 | Bacteria | 11692 |
| 296 | Ga0207702_10004976 | 3300026078 | Bacteria | 11672 |
| 297 | Ga0207702_10162288 | 3300026078 | Bacteria | 2042 |
| 298 | Ga0207702_10179529 | 3300026078 | Bacteria | 1948 |
| 299 | Ga0207702_10443839 | 3300026078 | Bacteria | 1258 |
| 300 | Ga0207641_10001356 | 3300026088 | Bacteria | 24281 |
| 301 | Ga0207641_10005349 | 3300026088 | Bacteria | 10961 |
| 302 | Ga0207641_10137396 | 3300026088 | Bacteria | 2201 |
| 303 | Ga0207648_10000152 | 3300026089 | Bacteria | 69770 |
| 304 | Ga0207648_10077413 | 3300026089 | Bacteria | 2899 |
| 305 | Ga0207676_10033646 | 3300026095 | Bacteria | 3874 |
| 306 | Ga0207676_10255772 | 3300026095 | Bacteria | 1579 |
| 307 | Ga0207674_10008204 | 3300026116 | Bacteria | 12102 |
| 308 | Ga0207674_10119488 | 3300026116 | Bacteria | 2604 |
| 309 | Ga0207674_10371176 | 3300026116 | Unclassified | 1383 |
| 310 | Ga0207675_100000086 | 3300026118 | Bacteria | 72707 |
| 311 | Ga0207675_100006894 | 3300026118 | Bacteria | 10761 |
| 312 | Ga0207675_100098870 | 3300026118 | Bacteria | 2748 |
| 313 | Ga0207675_100470211 | 3300026118 | Bacteria | 1248 |
| 314 | Ga0207698_10000019 | 3300026142 | Bacteria | 145910 |
| 315 | Ga0207428_10137560 | 3300027907 | Bacteria | 1867 |
| 316 | Ga0268266_10004464 | 3300028379 | Bacteria | 13380 |
| 317 | Ga0268266_10024820 | 3300028379 | Bacteria | 5101 |
| 318 | Ga0268266_10175956 | 3300028379 | Bacteria | 1945 |
| 319 | Ga0268266_10372364 | 3300028379 | Bacteria | 1345 |
| 320 | Ga0268265_10002783 | 3300028380 | Bacteria | 12884 |
| 321 | Ga0268264_10000774 | 3300028381 | Bacteria | 35274 |
| 322 | Ga0268264_10001005 | 3300028381 | Bacteria | 28618 |
| 323 | Ga0265319_1009432 | 3300028563 | Bacteria | 4156 |
| 324 | Ga0265334_10019300 | 3300028573 | Bacteria | 2806 |
| 325 | Ga0265318_10000024 | 3300028577 | Bacteria | 159801 |
| 326 | Ga0265318_10047125 | 3300028577 | Bacteria | 1626 |
| 327 | Ga0265336_10004397 | 3300028666 | Bacteria | 5339 |
| 328 | Ga0265338_10007488 | 3300028800 | Bacteria | 13527 |
| 329 | Ga0265338_10052060 | 3300028800 | Bacteria | 3679 |
| 330 | Ga0265338_10053797 | 3300028800 | Bacteria | 3597 |
| 331 | Ga0265338_10085922 | 3300028800 | Bacteria | 2620 |
| 332 | Ga0265330_10012913 | 3300031235 | Bacteria | 3899 |
| 333 | Ga0265332_10002113 | 3300031238 | Bacteria | 10276 |
| 334 | Ga0265332_10076060 | 3300031238 | Bacteria | 1427 |
| 335 | Ga0265328_10007361 | 3300031239 | Bacteria | 4591 |
| 336 | Ga0265320_10000217 | 3300031240 | Bacteria | 46656 |
| 337 | Ga0265320_10015499 | 3300031240 | Bacteria | 4307 |
| 338 | Ga0265325_10011042 | 3300031241 | Bacteria | 5198 |
| 339 | Ga0265325_10015830 | 3300031241 | Bacteria | 4230 |
| 340 | Ga0265329_10020127 | 3300031242 | Bacteria | 2257 |
| 341 | Ga0265340_10003472 | 3300031247 | Bacteria | 8885 |
| 342 | Ga0265340_10051332 | 3300031247 | Bacteria | 1997 |
| 343 | Ga0265339_10045137 | 3300031249 | Bacteria | 2427 |
| 344 | Ga0265331_10011346 | 3300031250 | Bacteria | 4884 |
| 345 | Ga0265316_10018256 | 3300031344 | Bacteria | 6032 |
| 346 | Ga0307408_100065283 | 3300031548 | Bacteria | 2669 |
| 347 | Ga0265313_10017080 | 3300031595 | Bacteria | 4141 |
| 348 | Ga0265314_10090066 | 3300031711 | Bacteria | 1999 |
| 349 | Ga0265342_10009081 | 3300031712 | Bacteria | 7049 |
| 350 | Ga0307405_10160853 | 3300031731 | Bacteria | 1590 |
| 351 | Ga0307405_10190907 | 3300031731 | Bacteria | 1479 |
| 352 | Ga0307405_10466995 | 3300031731 | Bacteria | 1004 |
| 353 | Ga0307412_10004605 | 3300031911 | Bacteria | 7686 |
| 354 | Ga0307412_10006032 | 3300031911 | Bacteria | 6823 |
| 355 | Ga0307416_100030772 | 3300032002 | Bacteria | 4032 |
| 356 | Ga0307416_100071335 | 3300032002 | Bacteria | 2885 |
| 357 | Ga0307416_100363515 | 3300032002 | Bacteria | 1470 |
| 358 | Ga0307414_10000390 | 3300032004 | Bacteria | 23921 |
| 359 | Ga0307411_10145275 | 3300032005 | Bacteria | 1755 |
| 360 | Ga0373930_0025394 | 3300034816 | Bacteria | 1189 |
| 361 | Ga0373926_0044867 | 3300035083 | Bacteria | 1584 |
| 362 | Ga0373928_0004005 | 3300035084 | Bacteria | 2811 |
| 363 | Ga0373949_0028488 | 3300035090 | Bacteria | 1318 |
| 364 | Ga0373932_0020316 | 3300035112 | Bacteria | 1740 |
| 365 | Ga0373936_0011553 | 3300035113 | Bacteria | 3345 |
| 366 | Ga0373936_0061891 | 3300035113 | Bacteria | 1529 |
| 367 | Ga0373945_0034550 | 3300035116 | Bacteria | 1802 |
| 368 | Ga0373943_0061368 | 3300035170 | Bacteria | 1879 |
| 369 | Ga0373943_0184707 | 3300035170 | Bacteria | 1147 |
| 370 | Ga0373946_0028409 | 3300035171 | Bacteria | 2219 |
| 371 | Ga0373942_0052255 | 3300035207 | Bacteria | 1149 |
| 372 | Ga0316574_0191623 | 3300035398 | Bacteria | 1315 |
| 373 | Ga0373931_0001153 | 3300035691 | Bacteria | 11239 |
| 374 | Ga0373931_0015971 | 3300035691 | Bacteria | 3689 |
| 375 | Ga0373931_0025239 | 3300035691 | Bacteria | 3018 |
| 376 | Ga0373935_0033987 | 3300035692 | Bacteria | 3176 |
| 377 | Ga0373933_0004140 | 3300035724 | Bacteria | 7989 |
| 378 | Ga0373937_0008905 | 3300036401 | Bacteria | 8714 |
| 379 | Ga0373937_0108974 | 3300036401 | Bacteria | 2575 |
| 380 | Ga0372808_015607 | 3300036459 | Bacteria | 1087 |
| 381 | Ga0373925_0060563 | 3300037068 | Bacteria | 2842 |
| 382 | Ga0395900_0017250 | 3300037418 | Bacteria | 7369 |
| 383 | Ga0395898_0055931 | 3300037466 | Bacteria | 3848 |
| 384 | Ga0395898_0084176 | 3300037466 | Bacteria | 3066 |
| 385 | Ga0395905_0012722 | 3300037471 | Bacteria | 8093 |
| 386 | Ga0395905_0034067 | 3300037471 | Bacteria | 4782 |
| 387 | Ga0395905_0216948 | 3300037471 | Bacteria | 1791 |
| 388 | Ga0395905_0245308 | 3300037471 | Bacteria | 1673 |
| 389 | Ga0436364_0310337 | 3300037853 | Bacteria | 5020 |
| 390 | Ga0436364_0376956 | 3300037853 | Bacteria | 951 |
| 391 | Ga0436364_0498727 | 3300037853 | Bacteria | 1274 |
| 392 | Ga0436362_1180834 | 3300039453 | Bacteria | 2560 |
| 393 | Ga0439460_0060487 | 3300042461 | Bacteria | 1155 |
| 394 | Ga0451577_0013166 | 3300042876 | Bacteria | 7751 |
| 395 | Ga0451577_0271149 | 3300042876 | Bacteria | 1537 |
| 396 | Ga0466969_0001888 | 3300044656 | Bacteria | 11211 |
| 397 | Ga0466969_0004139 | 3300044656 | Bacteria | 7701 |
| 398 | Ga0466969_0091609 | 3300044656 | Bacteria | 1440 |
| 399 | Ga0466966_0006317 | 3300044684 | Bacteria | 7837 |
| 400 | Ga0466966_0024109 | 3300044684 | Bacteria | 3982 |
| 401 | Ga0466966_0025325 | 3300044684 | Bacteria | 3876 |
| 402 | Ga0466961_0008054 | 3300044693 | Bacteria | 6715 |
| 403 | Ga0466964_0001512 | 3300044706 | Bacteria | 7984 |
| 404 | Ga0453684_0187413 | 3300044712 | Bacteria | 2423 |
| 405 | Ga0466971_0001325 | 3300044719 | Bacteria | 10346 |
| 406 | Ga0466957_0013671 | 3300044842 | Bacteria | 4713 |
| 407 | Ga0466959_0006379 | 3300045049 | Bacteria | 8166 |
| 408 | Ga0466959_0024043 | 3300045049 | Bacteria | 4512 |
| 409 | Ga0451576_0004839 | 3300045051 | Bacteria | 17244 |
| 410 | Ga0451576_0020965 | 3300045051 | Bacteria | 7111 |
| 411 | Ga0451576_0328971 | 3300045051 | Bacteria | 1599 |
| 412 | Ga0466967_0531602 | 3300045976 | Bacteria | 1156 |
| 413 | Ga0495603_0175977 | 3300046455 | Bacteria | 1239 |
| 414 | Ga0495638_0000209 | 3300046460 | Bacteria | 82799 |
| 415 | Ga0495650_0068414 | 3300046471 | Bacteria | 1401 |
| 416 | Ga0495580_0029410 | 3300046472 | Bacteria | 3987 |
| 417 | Ga0495582_0063147 | 3300046473 | Bacteria | 2046 |
| 418 | Ga0495583_0163042 | 3300046506 | Unclassified | 919 |
| 419 | Ga0495628_0144522 | 3300046516 | Bacteria | 1814 |
| 420 | Ga0495666_0008777 | 3300046526 | Bacteria | 5065 |
| 421 | Ga0495665_0112473 | 3300046531 | Bacteria | 1428 |
| 422 | Ga0495586_0129868 | 3300046535 | Bacteria | 1410 |
| 423 | Ga0495656_0082675 | 3300046615 | Bacteria | 1452 |
| 424 | Ga0495635_0041609 | 3300046663 | Bacteria | 3174 |
| 425 | Ga0495635_0091079 | 3300046663 | Bacteria | 2086 |
| 426 | Ga0495659_0082851 | 3300046664 | Bacteria | 1220 |
| 427 | Ga0495647_0007402 | 3300046681 | Bacteria | 3676 |
| 428 | Ga0495658_0089711 | 3300046683 | Bacteria | 1818 |
| 429 | Ga0495658_0118422 | 3300046683 | Bacteria | 1599 |
| 430 | Ga0495600_0085337 | 3300046809 | Bacteria | 2060 |
| 431 | Ga0495674_0125499 | 3300047319 | Bacteria | 2166 |
| 432 | Ga0495676_0089442 | 3300047321 | Bacteria | 2307 |
| 433 | Ga0495680_0158401 | 3300047322 | Bacteria | 1646 |
| 434 | Ga0495684_0179252 | 3300047471 | Bacteria | 1571 |
| 435 | Ga0495686_0038541 | 3300047472 | Bacteria | 3056 |
| 436 | Ga0496107_0110724 | 3300048910 | Bacteria | 2018 |
| 437 | Ga0496108_0401191 | 3300048911 | Bacteria | 1198 |
| 438 | Ga0496112_0014951 | 3300048915 | Bacteria | 7223 |
| 439 | Ga0496112_0167092 | 3300048915 | Bacteria | 2166 |
| 440 | Ga0496114_0414516 | 3300048917 | Bacteria | 1193 |
| 441 | Ga0496118_0004788 | 3300048921 | Bacteria | 15804 |
| 442 | Ga0501031_0012961 | 3300049568 | Bacteria | 5442 |
| 443 | Ga0501032_0150090 | 3300049569 | Bacteria | 1533 |
| 444 | Ga0501032_0183893 | 3300049569 | Bacteria | 1368 |
| 445 | Ga0501033_0006089 | 3300049570 | Bacteria | 9460 |
| 446 | Ga0501034_0006776 | 3300049571 | Bacteria | 12251 |
| 447 | Ga0501034_0318566 | 3300049571 | Bacteria | 1488 |
| 448 | Ga0501034_0493796 | 3300049571 | Bacteria | 1138 |
| 449 | Ga0501036_0000813 | 3300049572 | Bacteria | 23193 |
| 450 | Ga0501036_0151633 | 3300049572 | Bacteria | 1955 |
| 451 | Ga0501037_0260410 | 3300049573 | Bacteria | 1212 |
| 452 | Ga0501037_0330198 | 3300049573 | Bacteria | 1055 |
| 453 | Ga0501038_0003073 | 3300049574 | Bacteria | 15555 |
| 454 | Ga0501038_0040317 | 3300049574 | Bacteria | 4080 |
| 455 | Ga0501039_0009779 | 3300049575 | Bacteria | 7306 |
| 456 | Ga0501039_0070861 | 3300049575 | Bacteria | 2708 |
| 457 | Ga0501040_0001615 | 3300049576 | Bacteria | 14363 |
| 458 | Ga0501040_0039177 | 3300049576 | Bacteria | 3223 |
| 459 | Ga0501040_0083076 | 3300049576 | Bacteria | 2221 |
| 460 | Ga0501040_0145752 | 3300049576 | Bacteria | 1669 |
| 461 | Ga0501041_0001139 | 3300049577 | Bacteria | 14553 |
| 462 | Ga0501041_0024105 | 3300049577 | Bacteria | 3651 |
| 463 | Ga0501042_0002291 | 3300049578 | Bacteria | 11694 |
| 464 | Ga0501042_0068524 | 3300049578 | Bacteria | 2537 |
| 465 | Ga0501042_0091857 | 3300049578 | Bacteria | 2179 |
| 466 | Ga0501043_0277632 | 3300049579 | Bacteria | 1285 |
| 467 | Ga0501046_0072937 | 3300049580 | Bacteria | 2665 |
| 468 | Ga0501046_0094467 | 3300049580 | Bacteria | 2298 |
| 469 | Ga0501046_0102513 | 3300049580 | Bacteria | 2194 |
| 470 | Ga0501046_0122997 | 3300049580 | Bacteria | 1973 |
| 471 | Ga0501048_0001889 | 3300049582 | Bacteria | 15912 |
| 472 | Ga0501048_0244020 | 3300049582 | Bacteria | 1275 |
| 473 | Ga0501048_0294911 | 3300049582 | Bacteria | 1153 |
| 474 | Ga0501068_0206206 | 3300049584 | Bacteria | 1247 |
| 475 | Ga0501070_0080845 | 3300049586 | Bacteria | 2688 |
| 476 | Ga0501070_0194860 | 3300049586 | Bacteria | 1664 |
| 477 | Ga0501071_0021725 | 3300049587 | Bacteria | 4473 |
| 478 | Ga0501071_0025290 | 3300049587 | Bacteria | 4158 |
| 479 | Ga0501071_0029311 | 3300049587 | Bacteria | 3884 |
| 480 | Ga0501072_0003575 | 3300049588 | Bacteria | 11694 |
| 481 | Ga0501072_0006523 | 3300049588 | Bacteria | 8889 |
| 482 | Ga0501072_0061211 | 3300049588 | Bacteria | 2968 |
| 483 | Ga0501073_0114285 | 3300049589 | Bacteria | 1872 |
| 484 | Ga0501073_0116143 | 3300049589 | Bacteria | 1855 |
| 485 | Ga0501075_0013830 | 3300049591 | Bacteria | 5771 |
| 486 | Ga0501075_0030184 | 3300049591 | Bacteria | 4014 |
| 487 | Ga0501075_0158123 | 3300049591 | Bacteria | 1728 |
| 488 | Ga0501076_0002359 | 3300049592 | Bacteria | 12925 |
| 489 | Ga0501076_0019099 | 3300049592 | Bacteria | 5232 |
| 490 | Ga0501076_0041955 | 3300049592 | Bacteria | 3602 |
| 491 | Ga0501076_0065989 | 3300049592 | Bacteria | 2887 |
| 492 | Ga0501077_0000739 | 3300049593 | Bacteria | 19791 |
| 493 | Ga0501077_0022632 | 3300049593 | Bacteria | 3982 |
| 494 | Ga0501077_0099223 | 3300049593 | Bacteria | 1846 |
| 495 | Ga0501198_005077 | 3300049649 | Bacteria | 1843 |
| 496 | Ga0501223_000107 | 3300049663 | Bacteria | 23945 |
| 497 | Ga0501224_000031 | 3300049664 | Bacteria | 43294 |
| 498 | Ga0501233_007275 | 3300049668 | Bacteria | 2103 |
| 499 | Ga0501235_001538 | 3300049669 | Bacteria | 4941 |
| 500 | Ga0501225_0000702 | 3300049705 | Bacteria | 10488 |
| 501 | Ga0501234_000659 | 3300049707 | Bacteria | 5352 |
| 502 | Ga0501079_0003530 | 3300049741 | Bacteria | 11495 |
| 503 | Ga0501079_0014922 | 3300049741 | Bacteria | 5921 |
| 504 | Ga0501080_0009560 | 3300049742 | Bacteria | 8851 |
| 505 | Ga0501081_0003860 | 3300049743 | Bacteria | 9599 |
| 506 | Ga0501081_0029081 | 3300049743 | Bacteria | 3732 |
| 507 | Ga0501083_0308559 | 3300049744 | Bacteria | 1029 |
| 508 | Ga0501241_002928 | 3300049758 | Bacteria | 3270 |
| 509 | Ga0501035_0026246 | 3300049822 | Bacteria | 5331 |
| 510 | Ga0501035_0191530 | 3300049822 | Bacteria | 1758 |
| 511 | Ga0501035_0345146 | 3300049822 | Bacteria | 1247 |
| 512 | Ga0501044_0207392 | 3300049823 | Bacteria | 1916 |
| 513 | Ga0501044_0297449 | 3300049823 | Bacteria | 1544 |
| 514 | Ga0501045_0004583 | 3300049824 | Bacteria | 9542 |
| 515 | Ga0501045_0030226 | 3300049824 | Bacteria | 3920 |
| 516 | Ga0501045_0382581 | 3300049824 | Bacteria | 1047 |
| 517 | Ga0501045_0394528 | 3300049824 | Bacteria | 1030 |
| 518 | Ga0501226_000051 | 3300049853 | Bacteria | 49149 |
| 519 | nmdc:mga03n38_121763_c1 | 3300050490 | Bacteria | 1283 |
| 520 | nmdc:mga03n38_8024_c1 | 3300050490 | Bacteria | 3767 |
| 521 | nmdc:mga00v17_13016_c1 | 3300050491 | Bacteria | 4609 |
| 522 | nmdc:mga05p37_57167_c1 | 3300050507 | Bacteria | 4804 |
| 523 | nmdc:mga05p37_9320_c1 | 3300050507 | Bacteria | 11612 |
| 524 | nmdc:mga0qj67_2568_c1 | 3300050509 | Bacteria | 12972 |
| 525 | nmdc:mga06r32_13215_c1 | 3300050510 | Bacteria | 7477 |
| 526 | nmdc:mga08y16_53688_c1 | 3300050511 | Bacteria | 4213 |
| 527 | nmdc:mga0n895_114549_c1 | 3300050512 | Bacteria | 2714 |
| 528 | nmdc:mga0n895_61699_c1 | 3300050512 | Bacteria | 3703 |
| 529 | nmdc:mga0rr50_1703_c1 | 3300050513 | Bacteria | 12138 |
| 530 | nmdc:mga0rr50_24001_c1 | 3300050513 | Bacteria | 4217 |
| 531 | nmdc:mga08x19_202513_c1 | 3300050514 | Bacteria | 1361 |
| 532 | nmdc:mga08x19_846_c1 | 3300050514 | Bacteria | 19420 |
| 533 | nmdc:mga0a205_1761_c1 | 3300050515 | Bacteria | 18734 |
| 534 | Ga0495601_0156377 | 3300053077 | Bacteria | 1489 |
| 535 | Ga0495601_0160492 | 3300053077 | Bacteria | 1469 |
| 536 | Ga0495619_0057318 | 3300053085 | Bacteria | 2585 |
| 537 | Ga0500583_0055179 | 3300053092 | Bacteria | 1857 |
| 538 | Ga0500640_000036 | 3300053095 | Bacteria | 20472 |
| 539 | Ga0500641_0011113 | 3300053096 | Bacteria | 3264 |
| 540 | Ga0500641_0028444 | 3300053096 | Bacteria | 2183 |
| 541 | Ga0500572_002914 | 3300053111 | Bacteria | 4012 |
| 542 | Ga0500591_063635 | 3300053115 | Bacteria | 1693 |
| 543 | Ga0500595_001238 | 3300053119 | Bacteria | 14072 |
| 544 | Ga0500595_018830 | 3300053119 | Bacteria | 2517 |
| 545 | Ga0500595_053197 | 3300053119 | Bacteria | 1247 |
| 546 | Ga0500614_000846 | 3300053123 | Bacteria | 7731 |
| 547 | Ga0500652_137765 | 3300053131 | Bacteria | 1017 |
| 548 | Ga0500603_000195 | 3300053150 | Bacteria | 15888 |
| 549 | Ga0500616_0000030 | 3300053153 | Bacteria | 415224 |
| 550 | Ga0500616_0013131 | 3300053153 | Bacteria | 4821 |
| 551 | Ga0500622_0048877 | 3300053156 | Bacteria | 2181 |
| 552 | Ga0500630_001646 | 3300053159 | Bacteria | 10694 |
| 553 | Ga0500638_072606 | 3300053162 | Bacteria | 1643 |
| 554 | Ga0500639_000170 | 3300053163 | Bacteria | 31566 |
| 555 | Ga0500637_0021629 | 3300053178 | Bacteria | 3495 |
| 556 | Ga0500637_0060065 | 3300053178 | Bacteria | 2176 |
| 557 | Ga0500596_000047 | 3300053735 | Bacteria | 16297 |
| 558 | Ga0500601_001015 | 3300053737 | Bacteria | 3232 |
| 559 | Ga0500587_001606 | 3300053739 | Bacteria | 3215 |
| 560 | Ga0501084_0003144 | 3300054114 | Bacteria | 13350 |
| 561 | Ga0501084_0085989 | 3300054114 | Bacteria | 2640 |
| 562 | Ga0501082_0002898 | 3300060353 | Bacteria | 14954 |
| 563 | Ga0501082_0046675 | 3300060353 | Bacteria | 3733 |
| 564 | Ga0466962_0003099 | 3300061719 | Bacteria | 7902 |
| 565 | Ga0530510_0000675 | 3300061734 | Bacteria | 21957 |
| 566 | Ga0530510_0002365 | 3300061734 | Bacteria | 12954 |
| 567 | Ga0530510_0093780 | 3300061734 | Bacteria | 2192 |
| 568 | Ga0530510_0109437 | 3300061734 | Bacteria | 2023 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042461 | Ga0439460_0060487 | Ga0439460_0060487_14_724 | 219 |
| 2 | 3300053739 | Ga0500587_001606 | Ga0500587_001606_59_859 | 266 |
| 3 | 3300005444 | Ga0070694_100126085 | Ga0070694_1001260852 | 267 |
| 4 | 3300005548 | Ga0070665_100003310 | Ga0070665_10000331012 | 267 |
| 5 | 3300005843 | Ga0068860_100509477 | Ga0068860_1005094772 | 267 |
| 6 | 3300009177 | Ga0105248_10322238 | Ga0105248_103222381 | 267 |
| 7 | 3300014326 | Ga0157380_10246705 | Ga0157380_102467052 | 267 |
| 8 | 3300025938 | Ga0207704_10315996 | Ga0207704_103159962 | 267 |
| 9 | 3300025941 | Ga0207711_10225848 | Ga0207711_102258482 | 267 |
| 10 | 3300026118 | Ga0207675_100470211 | Ga0207675_1004702111 | 267 |
| 11 | 3300028379 | Ga0268266_10004464 | Ga0268266_100044643 | 267 |
| 12 | 3300046455 | Ga0495603_0175977 | Ga0495603_0175977_78_887 | 267 |
| 13 | 3300005288 | Ga0065714_10115941 | Ga0065714_101159411 | 270 |
| 14 | 3300005290 | Ga0065712_10068613 | Ga0065712_100686132 | 270 |
| 15 | 3300005343 | Ga0070687_100340981 | Ga0070687_1003409811 | 270 |
| 16 | 3300005440 | Ga0070705_100144062 | Ga0070705_1001440622 | 270 |
| 17 | 3300005617 | Ga0068859_100245840 | Ga0068859_1002458402 | 270 |
| 18 | 3300005842 | Ga0068858_100124906 | Ga0068858_1001249062 | 270 |
| 19 | 3300006931 | Ga0097620_100245846 | Ga0097620_1002458462 | 270 |
| 20 | 3300009098 | Ga0105245_10006136 | Ga0105245_100061366 | 270 |
| 21 | 3300009101 | Ga0105247_10107898 | Ga0105247_101078982 | 270 |
| 22 | 3300009177 | Ga0105248_10000732 | Ga0105248_1000073232 | 270 |
| 23 | 3300009177 | Ga0105248_10066798 | Ga0105248_100667981 | 270 |
| 24 | 3300013296 | Ga0157374_10018681 | Ga0157374_100186814 | 270 |
| 25 | 3300013306 | Ga0163162_10129523 | Ga0163162_101295232 | 270 |
| 26 | 3300014325 | Ga0163163_10275592 | Ga0163163_102755923 | 270 |
| 27 | 3300014968 | Ga0157379_10011481 | Ga0157379_100114813 | 270 |
| 28 | 3300014968 | Ga0157379_10137258 | Ga0157379_101372582 | 270 |
| 29 | 3300014969 | Ga0157376_10103519 | Ga0157376_101035192 | 270 |
| 30 | 3300025926 | Ga0207659_10000107 | Ga0207659_1000010738 | 270 |
| 31 | 3300025927 | Ga0207687_10035395 | Ga0207687_100353952 | 270 |
| 32 | 3300025941 | Ga0207711_10016315 | Ga0207711_100163153 | 270 |
| 33 | 3300025961 | Ga0207712_10065089 | Ga0207712_100650892 | 270 |
| 34 | 3300026035 | Ga0207703_10022681 | Ga0207703_100226812 | 270 |
| 35 | 3300035113 | Ga0373936_0061891 | Ga0373936_0061891_322_1140 | 270 |
| 36 | 3300036401 | Ga0373937_0108974 | Ga0373937_0108974_971_1801 | 270 |
| 37 | 3300046516 | Ga0495628_0144522 | Ga0495628_0144522_132_962 | 270 |
| 38 | 3300046663 | Ga0495635_0091079 | Ga0495635_0091079_796_1611 | 270 |
| 39 | 3300048911 | Ga0496108_0401191 | Ga0496108_0401191_308_1138 | 270 |
| 40 | 3300048915 | Ga0496112_0014951 | Ga0496112_0014951_3362_4192 | 270 |
| 41 | 3300053077 | Ga0495601_0160492 | Ga0495601_0160492_237_1052 | 270 |
| 42 | 3300053085 | Ga0495619_0057318 | Ga0495619_0057318_1267_2082 | 270 |
| 43 | 3300053119 | Ga0500595_001238 | Ga0500595_001238_9955_10998 | 272 |
| 44 | 3300050490 | nmdc:mga03n38_121763_c1 | nmdc:mga03n38_121763_c1_390_1235 | 273 |
| 45 | 3300006042 | Ga0075368_10035288 | Ga0075368_100352882 | 274 |
| 46 | 3300053119 | Ga0500595_053197 | Ga0500595_053197_256_1131 | 274 |
| 47 | 3300037471 | Ga0395905_0034067 | Ga0395905_0034067_543_1385 | 278 |
| 48 | 3300005467 | Ga0070706_100091186 | Ga0070706_1000911863 | 280 |
| 49 | 3300005468 | Ga0070707_100019315 | Ga0070707_1000193151 | 280 |
| 50 | 3300005518 | Ga0070699_100058982 | Ga0070699_1000589823 | 280 |
| 51 | 3300025910 | Ga0207684_10120246 | Ga0207684_101202463 | 280 |
| 52 | 3300025922 | Ga0207646_10005579 | Ga0207646_100055792 | 280 |
| 53 | 3300031241 | Ga0265325_10011042 | Ga0265325_100110422 | 282 |
| 54 | 3300005468 | Ga0070707_100051739 | Ga0070707_1000517392 | 283 |
| 55 | 3300005546 | Ga0070696_100047489 | Ga0070696_1000474892 | 283 |
| 56 | 3300006042 | Ga0075368_10029483 | Ga0075368_100294832 | 283 |
| 57 | 3300049582 | Ga0501048_0244020 | Ga0501048_0244020_321_1208 | 283 |
| 58 | 3300050512 | nmdc:mga0n895_114549_c1 | nmdc:mga0n895_114549_c1_124_1008 | 283 |
| 59 | 3300025885 | Ga0207653_10056740 | Ga0207653_100567401 | 284 |
| 60 | iso_pu_bacteria | 2852103415 | 2852105308 | 284 |
| 61 | 3300003373 | JGI25407J50210_10011898 | JGI25407J50210_100118981 | 286 |
| 62 | 3300005544 | Ga0070686_100043036 | Ga0070686_1000430362 | 286 |
| 63 | 3300006048 | Ga0075363_100018743 | Ga0075363_1000187432 | 286 |
| 64 | 3300006237 | Ga0097621_100052527 | Ga0097621_1000525272 | 286 |
| 65 | 3300006846 | Ga0075430_100548036 | Ga0075430_1005480361 | 286 |
| 66 | 3300006847 | Ga0075431_100295564 | Ga0075431_1002955642 | 286 |
| 67 | 3300006852 | Ga0075433_10001734 | Ga0075433_100017343 | 286 |
| 68 | 3300006914 | Ga0075436_100000476 | Ga0075436_1000004765 | 286 |
| 69 | 3300007076 | Ga0075435_100001047 | Ga0075435_1000010474 | 286 |
| 70 | 3300007076 | Ga0075435_100065017 | Ga0075435_1000650173 | 286 |
| 71 | 3300007076 | Ga0075435_100128948 | Ga0075435_1001289482 | 286 |
| 72 | 3300025922 | Ga0207646_10286414 | Ga0207646_102864141 | 286 |
| 73 | 3300025931 | Ga0207644_10258273 | Ga0207644_102582732 | 286 |
| 74 | 3300026078 | Ga0207702_10162288 | Ga0207702_101622881 | 286 |
| 75 | 3300026095 | Ga0207676_10033646 | Ga0207676_100336466 | 286 |
| 76 | 3300032002 | Ga0307416_100363515 | Ga0307416_1003635152 | 286 |
| 77 | 3300032005 | Ga0307411_10145275 | Ga0307411_101452752 | 286 |
| 78 | 3300035691 | Ga0373931_0025239 | Ga0373931_0025239_734_1597 | 286 |
| 79 | 3300037853 | Ga0436364_0310337 | Ga0436364_0310337_27_902 | 286 |
| 80 | 3300042876 | Ga0451577_0013166 | Ga0451577_0013166_6534_7397 | 286 |
| 81 | 3300045051 | Ga0451576_0004839 | Ga0451576_0004839_1639_2502 | 286 |
| 82 | 3300048921 | Ga0496118_0004788 | Ga0496118_0004788_6643_7557 | 286 |
| 83 | 3300049568 | Ga0501031_0012961 | Ga0501031_0012961_3862_4725 | 286 |
| 84 | 3300049569 | Ga0501032_0150090 | Ga0501032_0150090_43_915 | 286 |
| 85 | 3300049570 | Ga0501033_0006089 | Ga0501033_0006089_7880_8743 | 286 |
| 86 | 3300049571 | Ga0501034_0493796 | Ga0501034_0493796_98_961 | 286 |
| 87 | 3300049572 | Ga0501036_0000813 | Ga0501036_0000813_10761_11624 | 286 |
| 88 | 3300049574 | Ga0501038_0003073 | Ga0501038_0003073_11475_12338 | 286 |
| 89 | 3300049575 | Ga0501039_0009779 | Ga0501039_0009779_3134_3997 | 286 |
| 90 | 3300049576 | Ga0501040_0001615 | Ga0501040_0001615_799_1662 | 286 |
| 91 | 3300049577 | Ga0501041_0001139 | Ga0501041_0001139_7902_8765 | 286 |
| 92 | 3300049578 | Ga0501042_0002291 | Ga0501042_0002291_347_1210 | 286 |
| 93 | 3300049580 | Ga0501046_0122997 | Ga0501046_0122997_435_1307 | 286 |
| 94 | 3300049582 | Ga0501048_0001889 | Ga0501048_0001889_927_1790 | 286 |
| 95 | 3300049586 | Ga0501070_0194860 | Ga0501070_0194860_336_1199 | 286 |
| 96 | 3300049587 | Ga0501071_0025290 | Ga0501071_0025290_221_1084 | 286 |
| 97 | 3300049588 | Ga0501072_0003575 | Ga0501072_0003575_10297_11160 | 286 |
| 98 | 3300049591 | Ga0501075_0013830 | Ga0501075_0013830_511_1374 | 286 |
| 99 | 3300049592 | Ga0501076_0002359 | Ga0501076_0002359_2921_3784 | 286 |
| 100 | 3300049593 | Ga0501077_0000739 | Ga0501077_0000739_7658_8521 | 286 |
| 101 | 3300049741 | Ga0501079_0003530 | Ga0501079_0003530_2965_3828 | 286 |
| 102 | 3300049742 | Ga0501080_0009560 | Ga0501080_0009560_2972_3835 | 286 |
| 103 | 3300049743 | Ga0501081_0003860 | Ga0501081_0003860_7881_8744 | 286 |
| 104 | 3300049822 | Ga0501035_0026246 | Ga0501035_0026246_3649_4512 | 286 |
| 105 | 3300049823 | Ga0501044_0297449 | Ga0501044_0297449_236_1099 | 286 |
| 106 | 3300049824 | Ga0501045_0004583 | Ga0501045_0004583_799_1662 | 286 |
| 107 | 3300050512 | nmdc:mga0n895_61699_c1 | nmdc:mga0n895_61699_c1_1221_2084 | 286 |
| 108 | 3300050513 | nmdc:mga0rr50_1703_c1 | nmdc:mga0rr50_1703_c1_9528_10391 | 286 |
| 109 | 3300050513 | nmdc:mga0rr50_24001_c1 | nmdc:mga0rr50_24001_c1_517_1380 | 286 |
| 110 | 3300050514 | nmdc:mga08x19_846_c1 | nmdc:mga08x19_846_c1_149_1012 | 286 |
| 111 | 3300050515 | nmdc:mga0a205_1761_c1 | nmdc:mga0a205_1761_c1_16538_17401 | 286 |
| 112 | 3300054114 | Ga0501084_0003144 | Ga0501084_0003144_811_1674 | 286 |
| 113 | 3300060353 | Ga0501082_0002898 | Ga0501082_0002898_1474_2337 | 286 |
| 114 | 3300061734 | Ga0530510_0000675 | Ga0530510_0000675_10120_10983 | 286 |
| 115 | 3300005355 | Ga0070671_100006717 | Ga0070671_1000067173 | 287 |
| 116 | 3300005367 | Ga0070667_100043035 | Ga0070667_1000430354 | 287 |
| 117 | 3300005518 | Ga0070699_100007601 | Ga0070699_1000076017 | 287 |
| 118 | 3300005615 | Ga0070702_100161146 | Ga0070702_1001611462 | 287 |
| 119 | 3300006038 | Ga0075365_10011690 | Ga0075365_100116902 | 287 |
| 120 | 3300006042 | Ga0075368_10036639 | Ga0075368_100366392 | 287 |
| 121 | 3300006048 | Ga0075363_100062413 | Ga0075363_1000624132 | 287 |
| 122 | 3300006051 | Ga0075364_10001926 | Ga0075364_100019265 | 287 |
| 123 | 3300006051 | Ga0075364_10120451 | Ga0075364_101204512 | 287 |
| 124 | 3300006353 | Ga0075370_10173701 | Ga0075370_101737012 | 287 |
| 125 | 3300006844 | Ga0075428_100030576 | Ga0075428_1000305762 | 287 |
| 126 | 3300006844 | Ga0075428_100039971 | Ga0075428_1000399714 | 287 |
| 127 | 3300006846 | Ga0075430_100004707 | Ga0075430_1000047073 | 287 |
| 128 | 3300006880 | Ga0075429_100259710 | Ga0075429_1002597102 | 287 |
| 129 | 3300009147 | Ga0114129_10029481 | Ga0114129_100294812 | 287 |
| 130 | 3300009147 | Ga0114129_10206354 | Ga0114129_102063542 | 287 |
| 131 | 3300025903 | Ga0207680_10013226 | Ga0207680_100132262 | 287 |
| 132 | 3300025931 | Ga0207644_10017983 | Ga0207644_100179835 | 287 |
| 133 | 3300025940 | Ga0207691_10016680 | Ga0207691_100166803 | 287 |
| 134 | 3300025986 | Ga0207658_10063011 | Ga0207658_100630112 | 287 |
| 135 | 3300031731 | Ga0307405_10160853 | Ga0307405_101608532 | 287 |
| 136 | 3300046663 | Ga0495635_0041609 | Ga0495635_0041609_1990_2871 | 287 |
| 137 | 3300046809 | Ga0495600_0085337 | Ga0495600_0085337_379_1260 | 287 |
| 138 | 3300047319 | Ga0495674_0125499 | Ga0495674_0125499_1042_1923 | 287 |
| 139 | 3300047471 | Ga0495684_0179252 | Ga0495684_0179252_122_1003 | 287 |
| 140 | 3300049572 | Ga0501036_0151633 | Ga0501036_0151633_1002_1868 | 287 |
| 141 | 3300049576 | Ga0501040_0039177 | Ga0501040_0039177_11_877 | 287 |
| 142 | 3300049576 | Ga0501040_0145752 | Ga0501040_0145752_446_1315 | 287 |
| 143 | 3300049577 | Ga0501041_0024105 | Ga0501041_0024105_1857_2723 | 287 |
| 144 | 3300049578 | Ga0501042_0068524 | Ga0501042_0068524_1135_2001 | 287 |
| 145 | 3300049580 | Ga0501046_0102513 | Ga0501046_0102513_99_965 | 287 |
| 146 | 3300049588 | Ga0501072_0006523 | Ga0501072_0006523_3995_4861 | 287 |
| 147 | 3300049592 | Ga0501076_0019099 | Ga0501076_0019099_4021_4887 | 287 |
| 148 | 3300049593 | Ga0501077_0099223 | Ga0501077_0099223_672_1538 | 287 |
| 149 | 3300049824 | Ga0501045_0394528 | Ga0501045_0394528_57_926 | 287 |
| 150 | 3300050490 | nmdc:mga03n38_8024_c1 | nmdc:mga03n38_8024_c1_784_1659 | 287 |
| 151 | 3300050491 | nmdc:mga00v17_13016_c1 | nmdc:mga00v17_13016_c1_315_1190 | 287 |
| 152 | 3300050507 | nmdc:mga05p37_57167_c1 | nmdc:mga05p37_57167_c1_1297_2163 | 287 |
| 153 | 3300050509 | nmdc:mga0qj67_2568_c1 | nmdc:mga0qj67_2568_c1_1091_1957 | 287 |
| 154 | 3300050510 | nmdc:mga06r32_13215_c1 | nmdc:mga06r32_13215_c1_3072_3938 | 287 |
| 155 | 3300053077 | Ga0495601_0156377 | Ga0495601_0156377_323_1204 | 287 |
| 156 | 3300061734 | Ga0530510_0002365 | Ga0530510_0002365_953_1819 | 287 |
| 157 | 3300005330 | Ga0070690_100000209 | Ga0070690_10000020926 | 288 |
| 158 | 3300005334 | Ga0068869_100003175 | Ga0068869_1000031752 | 288 |
| 159 | 3300005336 | Ga0070680_100009242 | Ga0070680_1000092427 | 288 |
| 160 | 3300005337 | Ga0070682_100001825 | Ga0070682_1000018257 | 288 |
| 161 | 3300005338 | Ga0068868_100000337 | Ga0068868_10000033721 | 288 |
| 162 | 3300005340 | Ga0070689_100003242 | Ga0070689_1000032429 | 288 |
| 163 | 3300005343 | Ga0070687_100000022 | Ga0070687_10000002224 | 288 |
| 164 | 3300005345 | Ga0070692_10001244 | Ga0070692_100012448 | 288 |
| 165 | 3300005438 | Ga0070701_10000098 | Ga0070701_1000009811 | 288 |
| 166 | 3300005440 | Ga0070705_100000199 | Ga0070705_10000019912 | 288 |
| 167 | 3300005441 | Ga0070700_100000502 | Ga0070700_10000050210 | 288 |
| 168 | 3300005444 | Ga0070694_100009600 | Ga0070694_1000096008 | 288 |
| 169 | 3300005458 | Ga0070681_10018326 | Ga0070681_100183264 | 288 |
| 170 | 3300005459 | Ga0068867_100000231 | Ga0068867_10000023134 | 288 |
| 171 | 3300005530 | Ga0070679_100029290 | Ga0070679_1000292905 | 288 |
| 172 | 3300005536 | Ga0070697_100136230 | Ga0070697_1001362302 | 288 |
| 173 | 3300005539 | Ga0068853_100148576 | Ga0068853_1001485763 | 288 |
| 174 | 3300005544 | Ga0070686_100000124 | Ga0070686_10000012429 | 288 |
| 175 | 3300005545 | Ga0070695_100000276 | Ga0070695_10000027624 | 288 |
| 176 | 3300005546 | Ga0070696_100000275 | Ga0070696_1000002758 | 288 |
| 177 | 3300005547 | Ga0070693_100000130 | Ga0070693_10000013024 | 288 |
| 178 | 3300005549 | Ga0070704_100001666 | Ga0070704_10000166612 | 288 |
| 179 | 3300005563 | Ga0068855_100000977 | Ga0068855_10000097712 | 288 |
| 180 | 3300005578 | Ga0068854_100000985 | Ga0068854_10000098512 | 288 |
| 181 | 3300005614 | Ga0068856_100045097 | Ga0068856_1000450975 | 288 |
| 182 | 3300005615 | Ga0070702_100000042 | Ga0070702_10000004210 | 288 |
| 183 | 3300005617 | Ga0068859_100001713 | Ga0068859_10000171313 | 288 |
| 184 | 3300005718 | Ga0068866_10002281 | Ga0068866_100022815 | 288 |
| 185 | 3300005719 | Ga0068861_100001131 | Ga0068861_1000011318 | 288 |
| 186 | 3300005840 | Ga0068870_10024963 | Ga0068870_100249633 | 288 |
| 187 | 3300005842 | Ga0068858_100009148 | Ga0068858_1000091488 | 288 |
| 188 | 3300005843 | Ga0068860_100023675 | Ga0068860_1000236752 | 288 |
| 189 | 3300005844 | Ga0068862_100131207 | Ga0068862_1001312072 | 288 |
| 190 | 3300006237 | Ga0097621_100007905 | Ga0097621_1000079053 | 288 |
| 191 | 3300006358 | Ga0068871_100024321 | Ga0068871_1000243213 | 288 |
| 192 | 3300006881 | Ga0068865_100000673 | Ga0068865_10000067310 | 288 |
| 193 | 3300006931 | Ga0097620_100001713 | Ga0097620_10000171313 | 288 |
| 194 | 3300009092 | Ga0105250_10135451 | Ga0105250_101354511 | 288 |
| 195 | 3300009098 | Ga0105245_10000216 | Ga0105245_1000021634 | 288 |
| 196 | 3300009147 | Ga0114129_10075941 | Ga0114129_100759415 | 288 |
| 197 | 3300009148 | Ga0105243_10000351 | Ga0105243_1000035126 | 288 |
| 198 | 3300009176 | Ga0105242_10000213 | Ga0105242_1000021320 | 288 |
| 199 | 3300009553 | Ga0105249_10000741 | Ga0105249_1000074111 | 288 |
| 200 | 3300013297 | Ga0157378_10000354 | Ga0157378_1000035426 | 288 |
| 201 | 3300013308 | Ga0157375_10184874 | Ga0157375_101848743 | 288 |
| 202 | 3300014745 | Ga0157377_10145125 | Ga0157377_101451252 | 288 |
| 203 | 3300014969 | Ga0157376_10012315 | Ga0157376_100123157 | 288 |
| 204 | 3300025711 | Ga0207696_1066868 | Ga0207696_10668681 | 288 |
| 205 | 3300025899 | Ga0207642_10001235 | Ga0207642_100012355 | 288 |
| 206 | 3300025904 | Ga0207647_10164104 | Ga0207647_101641042 | 288 |
| 207 | 3300025908 | Ga0207643_10018680 | Ga0207643_100186804 | 288 |
| 208 | 3300025912 | Ga0207707_10016998 | Ga0207707_100169987 | 288 |
| 209 | 3300025917 | Ga0207660_10000599 | Ga0207660_1000059910 | 288 |
| 210 | 3300025918 | Ga0207662_10000021 | Ga0207662_1000002119 | 288 |
| 211 | 3300025921 | Ga0207652_10007317 | Ga0207652_100073174 | 288 |
| 212 | 3300025927 | Ga0207687_10000136 | Ga0207687_1000013621 | 288 |
| 213 | 3300025934 | Ga0207686_10000345 | Ga0207686_1000034530 | 288 |
| 214 | 3300025935 | Ga0207709_10000272 | Ga0207709_1000027231 | 288 |
| 215 | 3300025936 | Ga0207670_10000515 | Ga0207670_1000051516 | 288 |
| 216 | 3300025938 | Ga0207704_10000208 | Ga0207704_1000020820 | 288 |
| 217 | 3300025942 | Ga0207689_10000170 | Ga0207689_1000017024 | 288 |
| 218 | 3300025949 | Ga0207667_10001513 | Ga0207667_100015138 | 288 |
| 219 | 3300025961 | Ga0207712_10005705 | Ga0207712_100057057 | 288 |
| 220 | 3300025981 | Ga0207640_10004757 | Ga0207640_100047573 | 288 |
| 221 | 3300026023 | Ga0207677_10001117 | Ga0207677_1000111715 | 288 |
| 222 | 3300026035 | Ga0207703_10031123 | Ga0207703_100311235 | 288 |
| 223 | 3300026041 | Ga0207639_10084273 | Ga0207639_100842734 | 288 |
| 224 | 3300026075 | Ga0207708_10000222 | Ga0207708_1000022247 | 288 |
| 225 | 3300026089 | Ga0207648_10000152 | Ga0207648_1000015246 | 288 |
| 226 | 3300026118 | Ga0207675_100000086 | Ga0207675_10000008654 | 288 |
| 227 | 3300028380 | Ga0268265_10002783 | Ga0268265_100027833 | 288 |
| 228 | 3300028381 | Ga0268264_10001005 | Ga0268264_100010056 | 288 |
| 229 | 3300028800 | Ga0265338_10053797 | Ga0265338_100537972 | 288 |
| 230 | 3300031247 | Ga0265340_10003472 | Ga0265340_100034726 | 288 |
| 231 | 3300034816 | Ga0373930_0025394 | Ga0373930_0025394_241_1119 | 288 |
| 232 | 3300035083 | Ga0373926_0044867 | Ga0373926_0044867_690_1565 | 288 |
| 233 | 3300035084 | Ga0373928_0004005 | Ga0373928_0004005_1017_1895 | 288 |
| 234 | 3300035090 | Ga0373949_0028488 | Ga0373949_0028488_71_949 | 288 |
| 235 | 3300035112 | Ga0373932_0020316 | Ga0373932_0020316_164_1042 | 288 |
| 236 | 3300035113 | Ga0373936_0011553 | Ga0373936_0011553_1819_2694 | 288 |
| 237 | 3300035116 | Ga0373945_0034550 | Ga0373945_0034550_645_1520 | 288 |
| 238 | 3300035170 | Ga0373943_0061368 | Ga0373943_0061368_20_895 | 288 |
| 239 | 3300035170 | Ga0373943_0184707 | Ga0373943_0184707_253_1128 | 288 |
| 240 | 3300035171 | Ga0373946_0028409 | Ga0373946_0028409_993_1868 | 288 |
| 241 | 3300035207 | Ga0373942_0052255 | Ga0373942_0052255_15_893 | 288 |
| 242 | 3300035691 | Ga0373931_0001153 | Ga0373931_0001153_10196_11074 | 288 |
| 243 | 3300035691 | Ga0373931_0015971 | Ga0373931_0015971_942_1820 | 288 |
| 244 | 3300035692 | Ga0373935_0033987 | Ga0373935_0033987_2207_3082 | 288 |
| 245 | 3300037068 | Ga0373925_0060563 | Ga0373925_0060563_498_1373 | 288 |
| 246 | 3300037853 | Ga0436364_0498727 | Ga0436364_0498727_203_1075 | 288 |
| 247 | 3300045051 | Ga0451576_0328971 | Ga0451576_0328971_490_1368 | 288 |
| 248 | 3300046472 | Ga0495580_0029410 | Ga0495580_0029410_476_1351 | 288 |
| 249 | 3300046473 | Ga0495582_0063147 | Ga0495582_0063147_47_922 | 288 |
| 250 | 3300046526 | Ga0495666_0008777 | Ga0495666_0008777_3340_4215 | 288 |
| 251 | 3300046531 | Ga0495665_0112473 | Ga0495665_0112473_149_1024 | 288 |
| 252 | 3300046615 | Ga0495656_0082675 | Ga0495656_0082675_211_1089 | 288 |
| 253 | 3300046681 | Ga0495647_0007402 | Ga0495647_0007402_2289_3164 | 288 |
| 254 | 3300046683 | Ga0495658_0089711 | Ga0495658_0089711_554_1426 | 288 |
| 255 | 3300046683 | Ga0495658_0118422 | Ga0495658_0118422_256_1131 | 288 |
| 256 | 3300047321 | Ga0495676_0089442 | Ga0495676_0089442_1401_2276 | 288 |
| 257 | 3300048917 | Ga0496114_0414516 | Ga0496114_0414516_144_1022 | 288 |
| 258 | 3300050507 | nmdc:mga05p37_9320_c1 | nmdc:mga05p37_9320_c1_9401_10279 | 288 |
| 259 | 3300050511 | nmdc:mga08y16_53688_c1 | nmdc:mga08y16_53688_c1_586_1464 | 288 |
| 260 | 3300003203 | JGI25406J46586_10016100 | JGI25406J46586_100161002 | 289 |
| 261 | 3300005345 | Ga0070692_10035296 | Ga0070692_100352963 | 289 |
| 262 | 3300005366 | Ga0070659_100065413 | Ga0070659_1000654133 | 289 |
| 263 | 3300005530 | Ga0070679_100315605 | Ga0070679_1003156052 | 289 |
| 264 | 3300005535 | Ga0070684_100701186 | Ga0070684_1007011861 | 289 |
| 265 | 3300005985 | Ga0081539_10000123 | Ga0081539_10000123109 | 289 |
| 266 | 3300006042 | Ga0075368_10094912 | Ga0075368_100949122 | 289 |
| 267 | 3300006048 | Ga0075363_100015115 | Ga0075363_1000151152 | 289 |
| 268 | 3300013104 | Ga0157370_10140238 | Ga0157370_101402383 | 289 |
| 269 | 3300013105 | Ga0157369_10002769 | Ga0157369_1000276916 | 289 |
| 270 | 3300021441 | Ga0213871_10001009 | Ga0213871_100010092 | 289 |
| 271 | 3300025912 | Ga0207707_10052167 | Ga0207707_100521673 | 289 |
| 272 | 3300025917 | Ga0207660_10021662 | Ga0207660_100216624 | 289 |
| 273 | 3300025921 | Ga0207652_10270102 | Ga0207652_102701022 | 289 |
| 274 | 3300026116 | Ga0207674_10119488 | Ga0207674_101194882 | 289 |
| 275 | 3300026118 | Ga0207675_100098870 | Ga0207675_1000988702 | 289 |
| 276 | 3300031247 | Ga0265340_10051332 | Ga0265340_100513322 | 289 |
| 277 | 3300031548 | Ga0307408_100065283 | Ga0307408_1000652831 | 289 |
| 278 | 3300031911 | Ga0307412_10004605 | Ga0307412_100046053 | 289 |
| 279 | 3300032002 | Ga0307416_100071335 | Ga0307416_1000713353 | 289 |
| 280 | 3300032004 | Ga0307414_10000390 | Ga0307414_1000039020 | 289 |
| 281 | 3300035724 | Ga0373933_0004140 | Ga0373933_0004140_5229_6098 | 289 |
| 282 | 3300036401 | Ga0373937_0008905 | Ga0373937_0008905_3087_3956 | 289 |
| 283 | 3300037466 | Ga0395898_0084176 | Ga0395898_0084176_588_1457 | 289 |
| 284 | 3300039453 | Ga0436362_1180834 | Ga0436362_1180834_1568_2440 | 289 |
| 285 | 3300042876 | Ga0451577_0271149 | Ga0451577_0271149_112_987 | 289 |
| 286 | 3300044712 | Ga0453684_0187413 | Ga0453684_0187413_18_893 | 289 |
| 287 | 3300045051 | Ga0451576_0020965 | Ga0451576_0020965_1421_2296 | 289 |
| 288 | 3300045976 | Ga0466967_0531602 | Ga0466967_0531602_110_979 | 289 |
| 289 | 3300046664 | Ga0495659_0082851 | Ga0495659_0082851_173_1048 | 289 |
| 290 | 3300049571 | Ga0501034_0006776 | Ga0501034_0006776_1441_2310 | 289 |
| 291 | 3300049649 | Ga0501198_005077 | Ga0501198_005077_272_1141 | 289 |
| 292 | 3300049663 | Ga0501223_000107 | Ga0501223_000107_15012_15881 | 289 |
| 293 | 3300049664 | Ga0501224_000031 | Ga0501224_000031_8038_8907 | 289 |
| 294 | 3300049668 | Ga0501233_007275 | Ga0501233_007275_378_1247 | 289 |
| 295 | 3300049669 | Ga0501235_001538 | Ga0501235_001538_82_951 | 289 |
| 296 | 3300049705 | Ga0501225_0000702 | Ga0501225_0000702_1370_2239 | 289 |
| 297 | 3300049707 | Ga0501234_000659 | Ga0501234_000659_4396_5265 | 289 |
| 298 | 3300049744 | Ga0501083_0308559 | Ga0501083_0308559_35_910 | 289 |
| 299 | 3300049823 | Ga0501044_0207392 | Ga0501044_0207392_809_1678 | 289 |
| 300 | 3300049853 | Ga0501226_000051 | Ga0501226_000051_14018_14887 | 289 |
| 301 | 3300050514 | nmdc:mga08x19_202513_c1 | nmdc:mga08x19_202513_c1_443_1348 | 289 |
| 302 | 3300053131 | Ga0500652_137765 | Ga0500652_137765_117_992 | 289 |
| 303 | 3300053156 | Ga0500622_0048877 | Ga0500622_0048877_1228_2103 | 289 |
| 304 | 3300053178 | Ga0500637_0021629 | Ga0500637_0021629_1266_2147 | 289 |
| 305 | 3300005330 | Ga0070690_100006618 | Ga0070690_1000066182 | 290 |
| 306 | 3300005331 | Ga0070670_100036463 | Ga0070670_1000364634 | 290 |
| 307 | 3300005335 | Ga0070666_10024585 | Ga0070666_100245853 | 290 |
| 308 | 3300005335 | Ga0070666_10106531 | Ga0070666_101065313 | 290 |
| 309 | 3300005336 | Ga0070680_100002272 | Ga0070680_10000227214 | 290 |
| 310 | 3300005336 | Ga0070680_100448697 | Ga0070680_1004486971 | 290 |
| 311 | 3300005337 | Ga0070682_100314484 | Ga0070682_1003144841 | 290 |
| 312 | 3300005338 | Ga0068868_100006826 | Ga0068868_10000682610 | 290 |
| 313 | 3300005344 | Ga0070661_100089370 | Ga0070661_1000893702 | 290 |
| 314 | 3300005345 | Ga0070692_10073413 | Ga0070692_100734132 | 290 |
| 315 | 3300005355 | Ga0070671_100001900 | Ga0070671_1000019009 | 290 |
| 316 | 3300005355 | Ga0070671_100034603 | Ga0070671_1000346034 | 290 |
| 317 | 3300005356 | Ga0070674_100410170 | Ga0070674_1004101702 | 290 |
| 318 | 3300005364 | Ga0070673_100015726 | Ga0070673_1000157266 | 290 |
| 319 | 3300005367 | Ga0070667_100000762 | Ga0070667_10000076225 | 290 |
| 320 | 3300005367 | Ga0070667_100023615 | Ga0070667_1000236152 | 290 |
| 321 | 3300005434 | Ga0070709_10058531 | Ga0070709_100585313 | 290 |
| 322 | 3300005436 | Ga0070713_100209515 | Ga0070713_1002095152 | 290 |
| 323 | 3300005438 | Ga0070701_10033049 | Ga0070701_100330491 | 290 |
| 324 | 3300005441 | Ga0070700_100045225 | Ga0070700_1000452252 | 290 |
| 325 | 3300005444 | Ga0070694_100227565 | Ga0070694_1002275652 | 290 |
| 326 | 3300005457 | Ga0070662_100365252 | Ga0070662_1003652521 | 290 |
| 327 | 3300005458 | Ga0070681_10010799 | Ga0070681_100107994 | 290 |
| 328 | 3300005458 | Ga0070681_10070649 | Ga0070681_100706494 | 290 |
| 329 | 3300005530 | Ga0070679_100003898 | Ga0070679_1000038989 | 290 |
| 330 | 3300005530 | Ga0070679_100010795 | Ga0070679_1000107956 | 290 |
| 331 | 3300005544 | Ga0070686_100065750 | Ga0070686_1000657502 | 290 |
| 332 | 3300005548 | Ga0070665_100061093 | Ga0070665_1000610932 | 290 |
| 333 | 3300005548 | Ga0070665_100158076 | Ga0070665_1001580762 | 290 |
| 334 | 3300005549 | Ga0070704_100004741 | Ga0070704_1000047417 | 290 |
| 335 | 3300005564 | Ga0070664_100000788 | Ga0070664_10000078814 | 290 |
| 336 | 3300005614 | Ga0068856_100081299 | Ga0068856_1000812993 | 290 |
| 337 | 3300005617 | Ga0068859_100001667 | Ga0068859_10000166713 | 290 |
| 338 | 3300005617 | Ga0068859_100070620 | Ga0068859_1000706202 | 290 |
| 339 | 3300005617 | Ga0068859_100133799 | Ga0068859_1001337993 | 290 |
| 340 | 3300005618 | Ga0068864_100005452 | Ga0068864_10000545210 | 290 |
| 341 | 3300005718 | Ga0068866_10117078 | Ga0068866_101170782 | 290 |
| 342 | 3300005834 | Ga0068851_10027023 | Ga0068851_100270232 | 290 |
| 343 | 3300005841 | Ga0068863_100002053 | Ga0068863_1000020532 | 290 |
| 344 | 3300005841 | Ga0068863_100037128 | Ga0068863_1000371282 | 290 |
| 345 | 3300005842 | Ga0068858_100000238 | Ga0068858_10000023820 | 290 |
| 346 | 3300005842 | Ga0068858_100013228 | Ga0068858_1000132286 | 290 |
| 347 | 3300005843 | Ga0068860_100000873 | Ga0068860_10000087326 | 290 |
| 348 | 3300005843 | Ga0068860_100009657 | Ga0068860_1000096573 | 290 |
| 349 | 3300005844 | Ga0068862_100046333 | Ga0068862_1000463333 | 290 |
| 350 | 3300006175 | Ga0070712_100015939 | Ga0070712_1000159393 | 290 |
| 351 | 3300006175 | Ga0070712_100212332 | Ga0070712_1002123322 | 290 |
| 352 | 3300006237 | Ga0097621_100029117 | Ga0097621_1000291176 | 290 |
| 353 | 3300006237 | Ga0097621_100109888 | Ga0097621_1001098882 | 290 |
| 354 | 3300006358 | Ga0068871_100026980 | Ga0068871_1000269804 | 290 |
| 355 | 3300006844 | Ga0075428_100003594 | Ga0075428_10000359417 | 290 |
| 356 | 3300006852 | Ga0075433_10073215 | Ga0075433_100732153 | 290 |
| 357 | 3300006881 | Ga0068865_100364810 | Ga0068865_1003648102 | 290 |
| 358 | 3300006931 | Ga0097620_100001667 | Ga0097620_1000016675 | 290 |
| 359 | 3300006931 | Ga0097620_100070621 | Ga0097620_1000706215 | 290 |
| 360 | 3300006931 | Ga0097620_100133812 | Ga0097620_1001338123 | 290 |
| 361 | 3300007076 | Ga0075435_100173668 | Ga0075435_1001736682 | 290 |
| 362 | 3300009093 | Ga0105240_10001667 | Ga0105240_100016677 | 290 |
| 363 | 3300009093 | Ga0105240_10011070 | Ga0105240_100110703 | 290 |
| 364 | 3300009093 | Ga0105240_10022406 | Ga0105240_100224067 | 290 |
| 365 | 3300009093 | Ga0105240_10031951 | Ga0105240_100319514 | 290 |
| 366 | 3300009101 | Ga0105247_10000162 | Ga0105247_1000016251 | 290 |
| 367 | 3300009177 | Ga0105248_10023489 | Ga0105248_100234895 | 290 |
| 368 | 3300009551 | Ga0105238_10005467 | Ga0105238_1000546712 | 290 |
| 369 | 3300009551 | Ga0105238_10067312 | Ga0105238_100673122 | 290 |
| 370 | 3300009551 | Ga0105238_10474463 | Ga0105238_104744631 | 290 |
| 371 | 3300009553 | Ga0105249_10017725 | Ga0105249_100177257 | 290 |
| 372 | 3300010375 | Ga0105239_10043360 | Ga0105239_100433605 | 290 |
| 373 | 3300013104 | Ga0157370_10002946 | Ga0157370_100029468 | 290 |
| 374 | 3300013105 | Ga0157369_10010329 | Ga0157369_100103293 | 290 |
| 375 | 3300013105 | Ga0157369_10176136 | Ga0157369_101761363 | 290 |
| 376 | 3300013306 | Ga0163162_10026604 | Ga0163162_100266042 | 290 |
| 377 | 3300014968 | Ga0157379_10003779 | Ga0157379_100037796 | 290 |
| 378 | 3300020082 | Ga0206353_10573776 | Ga0206353_105737763 | 290 |
| 379 | 3300025321 | Ga0207656_10068118 | Ga0207656_100681182 | 290 |
| 380 | 3300025899 | Ga0207642_10085337 | Ga0207642_100853371 | 290 |
| 381 | 3300025903 | Ga0207680_10031331 | Ga0207680_100313313 | 290 |
| 382 | 3300025903 | Ga0207680_10036047 | Ga0207680_100360472 | 290 |
| 383 | 3300025912 | Ga0207707_10000035 | Ga0207707_1000003577 | 290 |
| 384 | 3300025912 | Ga0207707_10000591 | Ga0207707_100005913 | 290 |
| 385 | 3300025912 | Ga0207707_10073754 | Ga0207707_100737542 | 290 |
| 386 | 3300025913 | Ga0207695_10003010 | Ga0207695_1000301018 | 290 |
| 387 | 3300025913 | Ga0207695_10018181 | Ga0207695_100181816 | 290 |
| 388 | 3300025913 | Ga0207695_10034578 | Ga0207695_100345782 | 290 |
| 389 | 3300025913 | Ga0207695_10048033 | Ga0207695_100480332 | 290 |
| 390 | 3300025913 | Ga0207695_10135433 | Ga0207695_101354333 | 290 |
| 391 | 3300025914 | Ga0207671_10250392 | Ga0207671_102503921 | 290 |
| 392 | 3300025915 | Ga0207693_10012278 | Ga0207693_100122785 | 290 |
| 393 | 3300025917 | Ga0207660_10098037 | Ga0207660_100980372 | 290 |
| 394 | 3300025920 | Ga0207649_10069913 | Ga0207649_100699132 | 290 |
| 395 | 3300025921 | Ga0207652_10001126 | Ga0207652_1000112614 | 290 |
| 396 | 3300025921 | Ga0207652_10051036 | Ga0207652_100510362 | 290 |
| 397 | 3300025925 | Ga0207650_10207764 | Ga0207650_102077642 | 290 |
| 398 | 3300025931 | Ga0207644_10001361 | Ga0207644_100013619 | 290 |
| 399 | 3300025931 | Ga0207644_10018233 | Ga0207644_100182334 | 290 |
| 400 | 3300025931 | Ga0207644_10146280 | Ga0207644_101462802 | 290 |
| 401 | 3300025936 | Ga0207670_10026864 | Ga0207670_100268643 | 290 |
| 402 | 3300025941 | Ga0207711_10032731 | Ga0207711_100327314 | 290 |
| 403 | 3300025944 | Ga0207661_10067559 | Ga0207661_100675592 | 290 |
| 404 | 3300025944 | Ga0207661_10307150 | Ga0207661_103071502 | 290 |
| 405 | 3300025944 | Ga0207661_10386486 | Ga0207661_103864862 | 290 |
| 406 | 3300025945 | Ga0207679_10263788 | Ga0207679_102637882 | 290 |
| 407 | 3300025949 | Ga0207667_10029840 | Ga0207667_100298406 | 290 |
| 408 | 3300025960 | Ga0207651_10010884 | Ga0207651_100108842 | 290 |
| 409 | 3300025961 | Ga0207712_10087398 | Ga0207712_100873983 | 290 |
| 410 | 3300025981 | Ga0207640_10198793 | Ga0207640_101987932 | 290 |
| 411 | 3300025986 | Ga0207658_10109291 | Ga0207658_101092912 | 290 |
| 412 | 3300026035 | Ga0207703_10002163 | Ga0207703_100021632 | 290 |
| 413 | 3300026035 | Ga0207703_10021905 | Ga0207703_100219053 | 290 |
| 414 | 3300026041 | Ga0207639_10118330 | Ga0207639_101183303 | 290 |
| 415 | 3300026075 | Ga0207708_10003419 | Ga0207708_100034193 | 290 |
| 416 | 3300026078 | Ga0207702_10179529 | Ga0207702_101795293 | 290 |
| 417 | 3300026078 | Ga0207702_10443839 | Ga0207702_104438392 | 290 |
| 418 | 3300026088 | Ga0207641_10001356 | Ga0207641_1000135620 | 290 |
| 419 | 3300026088 | Ga0207641_10005349 | Ga0207641_1000534910 | 290 |
| 420 | 3300026088 | Ga0207641_10137396 | Ga0207641_101373962 | 290 |
| 421 | 3300026089 | Ga0207648_10077413 | Ga0207648_100774133 | 290 |
| 422 | 3300026095 | Ga0207676_10255772 | Ga0207676_102557722 | 290 |
| 423 | 3300026116 | Ga0207674_10371176 | Ga0207674_103711762 | 290 |
| 424 | 3300026118 | Ga0207675_100006894 | Ga0207675_10000689411 | 290 |
| 425 | 3300027907 | Ga0207428_10137560 | Ga0207428_101375602 | 290 |
| 426 | 3300028379 | Ga0268266_10024820 | Ga0268266_100248206 | 290 |
| 427 | 3300028379 | Ga0268266_10175956 | Ga0268266_101759562 | 290 |
| 428 | 3300028381 | Ga0268264_10000774 | Ga0268264_100007744 | 290 |
| 429 | 3300028563 | Ga0265319_1009432 | Ga0265319_10094322 | 290 |
| 430 | 3300028573 | Ga0265334_10019300 | Ga0265334_100193003 | 290 |
| 431 | 3300028577 | Ga0265318_10000024 | Ga0265318_10000024131 | 290 |
| 432 | 3300028577 | Ga0265318_10047125 | Ga0265318_100471252 | 290 |
| 433 | 3300028800 | Ga0265338_10052060 | Ga0265338_100520602 | 290 |
| 434 | 3300028800 | Ga0265338_10085922 | Ga0265338_100859222 | 290 |
| 435 | 3300031235 | Ga0265330_10012913 | Ga0265330_100129134 | 290 |
| 436 | 3300031238 | Ga0265332_10002113 | Ga0265332_1000211311 | 290 |
| 437 | 3300031238 | Ga0265332_10076060 | Ga0265332_100760602 | 290 |
| 438 | 3300031239 | Ga0265328_10007361 | Ga0265328_100073612 | 290 |
| 439 | 3300031240 | Ga0265320_10000217 | Ga0265320_1000021713 | 290 |
| 440 | 3300031240 | Ga0265320_10015499 | Ga0265320_100154995 | 290 |
| 441 | 3300031241 | Ga0265325_10015830 | Ga0265325_100158305 | 290 |
| 442 | 3300031242 | Ga0265329_10020127 | Ga0265329_100201272 | 290 |
| 443 | 3300031249 | Ga0265339_10045137 | Ga0265339_100451372 | 290 |
| 444 | 3300031250 | Ga0265331_10011346 | Ga0265331_100113464 | 290 |
| 445 | 3300031344 | Ga0265316_10018256 | Ga0265316_100182563 | 290 |
| 446 | 3300031595 | Ga0265313_10017080 | Ga0265313_100170805 | 290 |
| 447 | 3300031711 | Ga0265314_10090066 | Ga0265314_100900661 | 290 |
| 448 | 3300031712 | Ga0265342_10009081 | Ga0265342_100090819 | 290 |
| 449 | 3300031731 | Ga0307405_10466995 | Ga0307405_104669951 | 290 |
| 450 | 3300032002 | Ga0307416_100030772 | Ga0307416_1000307722 | 290 |
| 451 | 3300035398 | Ga0316574_0191623 | Ga0316574_0191623_162_1037 | 290 |
| 452 | 3300036459 | Ga0372808_015607 | Ga0372808_015607_168_1046 | 290 |
| 453 | 3300037853 | Ga0436364_0376956 | Ga0436364_0376956_58_936 | 290 |
| 454 | 3300044656 | Ga0466969_0004139 | Ga0466969_0004139_5751_6632 | 290 |
| 455 | 3300044656 | Ga0466969_0091609 | Ga0466969_0091609_304_1185 | 290 |
| 456 | 3300044684 | Ga0466966_0006317 | Ga0466966_0006317_2917_3798 | 290 |
| 457 | 3300044684 | Ga0466966_0025325 | Ga0466966_0025325_2620_3501 | 290 |
| 458 | 3300045049 | Ga0466959_0024043 | Ga0466959_0024043_654_1532 | 290 |
| 459 | 3300046535 | Ga0495586_0129868 | Ga0495586_0129868_494_1375 | 290 |
| 460 | 3300047322 | Ga0495680_0158401 | Ga0495680_0158401_259_1140 | 290 |
| 461 | 3300048910 | Ga0496107_0110724 | Ga0496107_0110724_419_1351 | 290 |
| 462 | 3300048915 | Ga0496112_0167092 | Ga0496112_0167092_272_1165 | 290 |
| 463 | 3300049571 | Ga0501034_0318566 | Ga0501034_0318566_247_1131 | 290 |
| 464 | 3300049573 | Ga0501037_0330198 | Ga0501037_0330198_126_1010 | 290 |
| 465 | 3300049578 | Ga0501042_0091857 | Ga0501042_0091857_375_1277 | 290 |
| 466 | 3300049580 | Ga0501046_0072937 | Ga0501046_0072937_132_1016 | 290 |
| 467 | 3300049587 | Ga0501071_0029311 | Ga0501071_0029311_2909_3811 | 290 |
| 468 | 3300049592 | Ga0501076_0065989 | Ga0501076_0065989_1603_2505 | 290 |
| 469 | 3300049741 | Ga0501079_0014922 | Ga0501079_0014922_1080_1982 | 290 |
| 470 | 3300049743 | Ga0501081_0029081 | Ga0501081_0029081_397_1299 | 290 |
| 471 | 3300049822 | Ga0501035_0191530 | Ga0501035_0191530_690_1592 | 290 |
| 472 | 3300049824 | Ga0501045_0382581 | Ga0501045_0382581_128_1030 | 290 |
| 473 | 3300053095 | Ga0500640_000036 | Ga0500640_000036_3672_4607 | 290 |
| 474 | 3300053111 | Ga0500572_002914 | Ga0500572_002914_824_1759 | 290 |
| 475 | 3300053115 | Ga0500591_063635 | Ga0500591_063635_206_1141 | 290 |
| 476 | 3300053123 | Ga0500614_000846 | Ga0500614_000846_3667_4602 | 290 |
| 477 | 3300053150 | Ga0500603_000195 | Ga0500603_000195_6905_7840 | 290 |
| 478 | 3300053159 | Ga0500630_001646 | Ga0500630_001646_904_1839 | 290 |
| 479 | 3300053162 | Ga0500638_072606 | Ga0500638_072606_380_1315 | 290 |
| 480 | 3300053163 | Ga0500639_000170 | Ga0500639_000170_7862_8797 | 290 |
| 481 | 3300053178 | Ga0500637_0060065 | Ga0500637_0060065_630_1559 | 290 |
| 482 | 3300053735 | Ga0500596_000047 | Ga0500596_000047_13836_14771 | 290 |
| 483 | 3300053737 | Ga0500601_001015 | Ga0500601_001015_1098_2033 | 290 |
| 484 | 3300005468 | Ga0070707_100008500 | Ga0070707_1000085004 | 291 |
| 485 | 3300005577 | Ga0068857_100341291 | Ga0068857_1003412912 | 291 |
| 486 | 3300014326 | Ga0157380_10346442 | Ga0157380_103464421 | 291 |
| 487 | 3300025922 | Ga0207646_10016170 | Ga0207646_100161706 | 291 |
| 488 | 3300028379 | Ga0268266_10372364 | Ga0268266_103723641 | 291 |
| 489 | 3300046471 | Ga0495650_0068414 | Ga0495650_0068414_131_1015 | 291 |
| 490 | 3300046506 | Ga0495583_0163042 | Ga0495583_0163042_12_896 | 291 |
| 491 | 3300053092 | Ga0500583_0055179 | Ga0500583_0055179_372_1256 | 291 |
| 492 | 3300053119 | Ga0500595_018830 | Ga0500595_018830_300_1178 | 291 |
| 493 | 3300053153 | Ga0500616_0000030 | Ga0500616_0000030_277922_278806 | 291 |
| 494 | 3300053153 | Ga0500616_0013131 | Ga0500616_0013131_104_988 | 291 |
| 495 | 3300005458 | Ga0070681_10001127 | Ga0070681_1000112714 | 292 |
| 496 | 3300005530 | Ga0070679_100073215 | Ga0070679_1000732154 | 292 |
| 497 | 3300009093 | Ga0105240_10090783 | Ga0105240_100907834 | 292 |
| 498 | 3300013104 | Ga0157370_10013826 | Ga0157370_100138263 | 292 |
| 499 | 3300013307 | Ga0157372_10109273 | Ga0157372_101092732 | 292 |
| 500 | 3300025912 | Ga0207707_10006531 | Ga0207707_100065314 | 292 |
| 501 | 3300025981 | Ga0207640_10342488 | Ga0207640_103424882 | 292 |
| 502 | 3300037418 | Ga0395900_0017250 | Ga0395900_0017250_5896_6795 | 292 |
| 503 | 3300037466 | Ga0395898_0055931 | Ga0395898_0055931_1974_2873 | 292 |
| 504 | 3300037471 | Ga0395905_0012722 | Ga0395905_0012722_883_1782 | 292 |
| 505 | 3300037471 | Ga0395905_0216948 | Ga0395905_0216948_176_1075 | 292 |
| 506 | 3300037471 | Ga0395905_0245308 | Ga0395905_0245308_506_1405 | 292 |
| 507 | 3300049569 | Ga0501032_0183893 | Ga0501032_0183893_134_1123 | 292 |
| 508 | 3300049573 | Ga0501037_0260410 | Ga0501037_0260410_64_1026 | 292 |
| 509 | 3300049574 | Ga0501038_0040317 | Ga0501038_0040317_2325_3314 | 292 |
| 510 | 3300049575 | Ga0501039_0070861 | Ga0501039_0070861_177_1139 | 292 |
| 511 | 3300049576 | Ga0501040_0083076 | Ga0501040_0083076_355_1344 | 292 |
| 512 | 3300049579 | Ga0501043_0277632 | Ga0501043_0277632_13_1002 | 292 |
| 513 | 3300049580 | Ga0501046_0094467 | Ga0501046_0094467_279_1241 | 292 |
| 514 | 3300049582 | Ga0501048_0294911 | Ga0501048_0294911_98_1087 | 292 |
| 515 | 3300049584 | Ga0501068_0206206 | Ga0501068_0206206_177_1139 | 292 |
| 516 | 3300049586 | Ga0501070_0080845 | Ga0501070_0080845_1487_2365 | 292 |
| 517 | 3300049587 | Ga0501071_0021725 | Ga0501071_0021725_2426_3388 | 292 |
| 518 | 3300049588 | Ga0501072_0061211 | Ga0501072_0061211_1092_2084 | 292 |
| 519 | 3300049589 | Ga0501073_0114285 | Ga0501073_0114285_743_1705 | 292 |
| 520 | 3300049589 | Ga0501073_0116143 | Ga0501073_0116143_843_1832 | 292 |
| 521 | 3300049591 | Ga0501075_0030184 | Ga0501075_0030184_246_1235 | 292 |
| 522 | 3300049591 | Ga0501075_0158123 | Ga0501075_0158123_189_1151 | 292 |
| 523 | 3300049592 | Ga0501076_0041955 | Ga0501076_0041955_1575_2537 | 292 |
| 524 | 3300049593 | Ga0501077_0022632 | Ga0501077_0022632_892_1881 | 292 |
| 525 | 3300049822 | Ga0501035_0345146 | Ga0501035_0345146_33_995 | 292 |
| 526 | 3300049824 | Ga0501045_0030226 | Ga0501045_0030226_1608_2570 | 292 |
| 527 | 3300054114 | Ga0501084_0085989 | Ga0501084_0085989_568_1530 | 292 |
| 528 | 3300060353 | Ga0501082_0046675 | Ga0501082_0046675_2556_3545 | 292 |
| 529 | 3300061734 | Ga0530510_0093780 | Ga0530510_0093780_862_1851 | 292 |
| 530 | 3300061734 | Ga0530510_0109437 | Ga0530510_0109437_894_1856 | 292 |
| 531 | 3300044656 | Ga0466969_0001888 | Ga0466969_0001888_7321_8397 | 293 |
| 532 | 3300044684 | Ga0466966_0024109 | Ga0466966_0024109_1616_2692 | 293 |
| 533 | 3300044693 | Ga0466961_0008054 | Ga0466961_0008054_683_1759 | 293 |
| 534 | 3300044706 | Ga0466964_0001512 | Ga0466964_0001512_3803_4879 | 293 |
| 535 | 3300044719 | Ga0466971_0001325 | Ga0466971_0001325_8852_9928 | 293 |
| 536 | 3300044842 | Ga0466957_0013671 | Ga0466957_0013671_531_1607 | 293 |
| 537 | 3300045049 | Ga0466959_0006379 | Ga0466959_0006379_5383_6459 | 293 |
| 538 | 3300053096 | Ga0500641_0028444 | Ga0500641_0028444_349_1248 | 293 |
| 539 | 3300061719 | Ga0466962_0003099 | Ga0466962_0003099_4166_5242 | 293 |
| 540 | 3300005445 | Ga0070708_100194917 | Ga0070708_1001949172 | 294 |
| 541 | 3300005467 | Ga0070706_100012692 | Ga0070706_1000126923 | 294 |
| 542 | 3300005468 | Ga0070707_100102262 | Ga0070707_1001022622 | 294 |
| 543 | 3300005471 | Ga0070698_100084672 | Ga0070698_1000846722 | 294 |
| 544 | 3300005616 | Ga0068852_100389335 | Ga0068852_1003893351 | 294 |
| 545 | 3300025910 | Ga0207684_10013597 | Ga0207684_100135977 | 294 |
| 546 | 3300028666 | Ga0265336_10004397 | Ga0265336_100043975 | 294 |
| 547 | 3300028800 | Ga0265338_10007488 | Ga0265338_100074885 | 294 |
| 548 | 3300046460 | Ga0495638_0000209 | Ga0495638_0000209_65380_66267 | 294 |
| 549 | 3300047472 | Ga0495686_0038541 | Ga0495686_0038541_1126_2013 | 294 |
| 550 | 3300053096 | Ga0500641_0011113 | Ga0500641_0011113_813_1706 | 294 |
| 551 | 3300002075 | JGI24738J21930_10003008 | JGI24738J21930_100030082 | 295 |
| 552 | 3300005467 | Ga0070706_100017917 | Ga0070706_1000179173 | 295 |
| 553 | 3300005563 | Ga0068855_100034599 | Ga0068855_1000345992 | 295 |
| 554 | 3300005577 | Ga0068857_100105348 | Ga0068857_1001053483 | 295 |
| 555 | 3300005578 | Ga0068854_100014686 | Ga0068854_1000146864 | 295 |
| 556 | 3300005614 | Ga0068856_100005115 | Ga0068856_10000511513 | 295 |
| 557 | 3300005616 | Ga0068852_100000919 | Ga0068852_1000009191 | 295 |
| 558 | 3300009093 | Ga0105240_10153053 | Ga0105240_101530533 | 295 |
| 559 | 3300009551 | Ga0105238_10043549 | Ga0105238_100435494 | 295 |
| 560 | 3300025904 | Ga0207647_10007751 | Ga0207647_100077514 | 295 |
| 561 | 3300025913 | Ga0207695_10008455 | Ga0207695_100084554 | 295 |
| 562 | 3300025949 | Ga0207667_10008858 | Ga0207667_100088584 | 295 |
| 563 | 3300025981 | Ga0207640_10001341 | Ga0207640_100013414 | 295 |
| 564 | 3300026078 | Ga0207702_10004976 | Ga0207702_1000497613 | 295 |
| 565 | 3300026116 | Ga0207674_10008204 | Ga0207674_100082044 | 295 |
| 566 | 3300026142 | Ga0207698_10000019 | Ga0207698_1000001918 | 295 |
| 567 | 3300031731 | Ga0307405_10190907 | Ga0307405_101909071 | 295 |
| 568 | 3300031911 | Ga0307412_10006032 | Ga0307412_100060322 | 295 |
| 569 | 3300049758 | Ga0501241_002928 | Ga0501241_002928_2176_3087 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4di9-assembly1.cif.gz_A | crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 | 0.9861 | 4 | 292 |
| 4d8l-assembly1.cif.gz_A | crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis | 0.9801 | 6 | 292 |
| 4dia-assembly1.cif.gz_A | crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 | 0.9754 | 4 | 292 |
| 4dia-assembly1.cif.gz_A | crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 | 0.962 | 4 | 292 |
| 4d8l-assembly1.cif.gz_A | crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis | 0.957 | 6 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4d95A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9816 | 2 | 292 | 3.20.20.140 |
| 4d95A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9716 | 2 | 292 | 3.20.20.140 |
| 4mupC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.888 | 19 | 290 | 3.20.20.140 |
| 4mupC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8697 | 19 | 290 | 3.20.20.140 |
| 4i6kA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.8645 | 26 | 290 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A432JVJ7-F1-model_v4 | deleted | 0.9987 | 12 | 98 |
|
| AF-A0A358D5D1-F1-model_v4 | 2-pyrone-4,6-dicarboxylate hydrolase | 0.998 | 12 | 126 |
GO:0016787
|
| AF-A0A3C0Y2J4-F1-model_v4 | Amidohydrolase | 0.9961 | 8 | 100 |
GO:0016787
|
| AF-A0A1L6JAZ3-F1-model_v4 | 2-pyrone-4,6-dicarboxylate hydrolase | 0.9949 | 2 | 292 |
GO:0016787
|
| AF-X1G355-F1-model_v4 | Amidohydrolase-related domain-containing protein | 0.991 | 35 | 172 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar