F464769

General Info

Members Datasets Scaffolds Average Seq Length
569 312 568 294

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0061211|Ga0501072_0061211_1092_2084
Length 330
Sequence VCAFRAWRPALIVTFPAHRYDNKLQPLRVSRVSRQIPTCRAPDPDTRKPRYRPPPLACDAHCHIFGPAARFPYAEDRSYTPPDAPLERFRELQAILGFERAVLVNASCHGTDNRVILDAIAQSGGQYRGVANADDSFTTQDFEKLHEGGCRGVRFNFVRHLGGMPDPGEFDRVIERIRPLGWHVVLHFDAADVVEFGGLLRRLPVPFVIDHMGRVPAAAGLQQEPFRQLLELARRDNCWVKICGAERISSAGPPFTDAVPFAQALIDVAPDRILWGTDWPHPNITKHMPNDGDLVDLIPLMAPDAAMQTRILVDNPHRLYGFETPRHRNP

Samples

Sample ID Description Type Environment
1 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
164 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
184 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
264 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
265 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
274 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
295 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
300 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
303 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
304 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
305 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
306 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
307 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
308 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.35
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 0
Rhizoplane 0.88
Rhizosphere 91.74
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10003008 3300002075 Bacteria 4309
2 JGI25406J46586_10016100 3300003203 Bacteria 3128
3 JGI25407J50210_10011898 3300003373 Bacteria 2228
4 Ga0065714_10115941 3300005288 Bacteria 1409
5 Ga0065712_10068613 3300005290 Bacteria 9657
6 Ga0070690_100000209 3300005330 Bacteria 30439
7 Ga0070690_100006618 3300005330 Bacteria 6582
8 Ga0070670_100036463 3300005331 Bacteria 4231
9 Ga0068869_100003175 3300005334 Bacteria 10031
10 Ga0070666_10024585 3300005335 Bacteria 3925
11 Ga0070666_10106531 3300005335 Bacteria 1936
12 Ga0070680_100002272 3300005336 Bacteria 14211
13 Ga0070680_100009242 3300005336 Bacteria 7561
14 Ga0070680_100448697 3300005336 Bacteria 1101
15 Ga0070682_100001825 3300005337 Bacteria 11864
16 Ga0070682_100314484 3300005337 Bacteria 1154
17 Ga0068868_100000337 3300005338 Bacteria 31658
18 Ga0068868_100006826 3300005338 Bacteria 8103
19 Ga0070689_100003242 3300005340 Bacteria 10793
20 Ga0070687_100000022 3300005343 Bacteria 52094
21 Ga0070687_100340981 3300005343 Bacteria 964
22 Ga0070661_100089370 3300005344 Bacteria 2281
23 Ga0070692_10001244 3300005345 Bacteria 9092
24 Ga0070692_10035296 3300005345 Bacteria 2531
25 Ga0070692_10073413 3300005345 Bacteria 1828
26 Ga0070671_100001900 3300005355 Bacteria 15980
27 Ga0070671_100006717 3300005355 Bacteria 9205
28 Ga0070671_100034603 3300005355 Bacteria 4182
29 Ga0070674_100410170 3300005356 Bacteria 1109
30 Ga0070673_100015726 3300005364 Bacteria 5325
31 Ga0070659_100065413 3300005366 Bacteria 2880
32 Ga0070667_100000762 3300005367 Bacteria 30627
33 Ga0070667_100023615 3300005367 Bacteria 5103
34 Ga0070667_100043035 3300005367 Bacteria 3789
35 Ga0070709_10058531 3300005434 Bacteria 2444
36 Ga0070713_100209515 3300005436 Bacteria 1764
37 Ga0070701_10000098 3300005438 Bacteria 24485
38 Ga0070701_10033049 3300005438 Bacteria 2582
39 Ga0070705_100000199 3300005440 Bacteria 35224
40 Ga0070705_100144062 3300005440 Bacteria 1572
41 Ga0070700_100000502 3300005441 Bacteria 19488
42 Ga0070700_100045225 3300005441 Bacteria 2715
43 Ga0070694_100009600 3300005444 Bacteria 5936
44 Ga0070694_100126085 3300005444 Bacteria 1843
45 Ga0070694_100227565 3300005444 Bacteria 1402
46 Ga0070708_100194917 3300005445 Bacteria 1895
47 Ga0070662_100365252 3300005457 Bacteria 1185
48 Ga0070681_10001127 3300005458 Bacteria 22938
49 Ga0070681_10010799 3300005458 Bacteria 9026
50 Ga0070681_10018326 3300005458 Bacteria 6997
51 Ga0070681_10070649 3300005458 Bacteria 3456
52 Ga0068867_100000231 3300005459 Bacteria 36523
53 Ga0070706_100012692 3300005467 Bacteria 7794
54 Ga0070706_100017917 3300005467 Bacteria 6533
55 Ga0070706_100091186 3300005467 Bacteria 2826
56 Ga0070707_100008500 3300005468 Bacteria 9536
57 Ga0070707_100019315 3300005468 Bacteria 6418
58 Ga0070707_100051739 3300005468 Bacteria 3937
59 Ga0070707_100102262 3300005468 Bacteria 2776
60 Ga0070698_100084672 3300005471 Bacteria 3158
61 Ga0070699_100007601 3300005518 Bacteria 9422
62 Ga0070699_100058982 3300005518 Bacteria 3325
63 Ga0070679_100003898 3300005530 Bacteria 13718
64 Ga0070679_100010795 3300005530 Bacteria 8673
65 Ga0070679_100029290 3300005530 Bacteria 5433
66 Ga0070679_100073215 3300005530 Bacteria 3418
67 Ga0070679_100315605 3300005530 Bacteria 1512
68 Ga0070684_100701186 3300005535 Bacteria 944
69 Ga0070697_100136230 3300005536 Bacteria 2062
70 Ga0068853_100148576 3300005539 Bacteria 2108
71 Ga0070686_100000124 3300005544 Bacteria 54388
72 Ga0070686_100043036 3300005544 Bacteria 2831
73 Ga0070686_100065750 3300005544 Bacteria 2357
74 Ga0070695_100000276 3300005545 Bacteria 25838
75 Ga0070696_100000275 3300005546 Bacteria 30800
76 Ga0070696_100047489 3300005546 Bacteria 2979
77 Ga0070693_100000130 3300005547 Bacteria 33644
78 Ga0070665_100003310 3300005548 Bacteria 17255
79 Ga0070665_100061093 3300005548 Bacteria 3777
80 Ga0070665_100158076 3300005548 Bacteria 2268
81 Ga0070704_100001666 3300005549 Bacteria 12048
82 Ga0070704_100004741 3300005549 Bacteria 7868
83 Ga0068855_100000977 3300005563 Bacteria 35582
84 Ga0068855_100034599 3300005563 Bacteria 6022
85 Ga0070664_100000788 3300005564 Bacteria 24413
86 Ga0068857_100105348 3300005577 Bacteria 2532
87 Ga0068857_100341291 3300005577 Bacteria 1386
88 Ga0068854_100000985 3300005578 Bacteria 17141
89 Ga0068854_100014686 3300005578 Bacteria 5167
90 Ga0068856_100005115 3300005614 Bacteria 12961
91 Ga0068856_100045097 3300005614 Bacteria 4340
92 Ga0068856_100081299 3300005614 Bacteria 3214
93 Ga0070702_100000042 3300005615 Bacteria 34567
94 Ga0070702_100161146 3300005615 Bacteria 1450
95 Ga0068852_100000919 3300005616 Bacteria 19508
96 Ga0068852_100389335 3300005616 Bacteria 1369
97 Ga0068859_100001667 3300005617 Bacteria 22614
98 Ga0068859_100001713 3300005617 Bacteria 22369
99 Ga0068859_100070620 3300005617 Bacteria 3528
100 Ga0068859_100133799 3300005617 Bacteria 2551
101 Ga0068859_100245840 3300005617 Bacteria 1879
102 Ga0068864_100005452 3300005618 Bacteria 10428
103 Ga0068866_10002281 3300005718 Bacteria 7943
104 Ga0068866_10117078 3300005718 Bacteria 1496
105 Ga0068861_100001131 3300005719 Bacteria 16573
106 Ga0068851_10027023 3300005834 Bacteria 2826
107 Ga0068870_10024963 3300005840 Bacteria 2963
108 Ga0068863_100002053 3300005841 Bacteria 19946
109 Ga0068863_100037128 3300005841 Bacteria 4639
110 Ga0068858_100000238 3300005842 Bacteria 59573
111 Ga0068858_100009148 3300005842 Bacteria 9473
112 Ga0068858_100013228 3300005842 Bacteria 7776
113 Ga0068858_100124906 3300005842 Bacteria 2408
114 Ga0068860_100000873 3300005843 Bacteria 33457
115 Ga0068860_100009657 3300005843 Bacteria 9584
116 Ga0068860_100023675 3300005843 Bacteria 5936
117 Ga0068860_100509477 3300005843 Bacteria 1202
118 Ga0068862_100046333 3300005844 Bacteria 3710
119 Ga0068862_100131207 3300005844 Bacteria 2216
120 Ga0081539_10000123 3300005985 Bacteria 181245
121 Ga0075365_10011690 3300006038 Bacteria 5174
122 Ga0075368_10029483 3300006042 Bacteria 2121
123 Ga0075368_10035288 3300006042 Bacteria 1951
124 Ga0075368_10036639 3300006042 Bacteria 1916
125 Ga0075368_10094912 3300006042 Bacteria 1222
126 Ga0075363_100015115 3300006048 Bacteria 3787
127 Ga0075363_100018743 3300006048 Bacteria 3452
128 Ga0075363_100062413 3300006048 Bacteria 2009
129 Ga0075364_10001926 3300006051 Bacteria 11551
130 Ga0075364_10120451 3300006051 Bacteria 1756
131 Ga0070712_100015939 3300006175 Bacteria 4847
132 Ga0070712_100212332 3300006175 Bacteria 1527
133 Ga0097621_100007905 3300006237 Bacteria 7628
134 Ga0097621_100029117 3300006237 Bacteria 4359
135 Ga0097621_100052527 3300006237 Bacteria 3320
136 Ga0097621_100109888 3300006237 Bacteria 2329
137 Ga0075370_10173701 3300006353 Bacteria 1267
138 Ga0068871_100024321 3300006358 Bacteria 4696
139 Ga0068871_100026980 3300006358 Bacteria 4488
140 Ga0075428_100003594 3300006844 Bacteria 16993
141 Ga0075428_100030576 3300006844 Bacteria 5955
142 Ga0075428_100039971 3300006844 Bacteria 5162
143 Ga0075430_100004707 3300006846 Bacteria 11476
144 Ga0075430_100548036 3300006846 Bacteria 954
145 Ga0075431_100295564 3300006847 Bacteria 1637
146 Ga0075433_10001734 3300006852 Bacteria 16274
147 Ga0075433_10073215 3300006852 Bacteria 3013
148 Ga0075429_100259710 3300006880 Bacteria 1521
149 Ga0068865_100000673 3300006881 Bacteria 19281
150 Ga0068865_100364810 3300006881 Bacteria 1174
151 Ga0075436_100000476 3300006914 Bacteria 26049
152 Ga0097620_100001667 3300006931 Bacteria 22614
153 Ga0097620_100001713 3300006931 Bacteria 22369
154 Ga0097620_100070621 3300006931 Bacteria 3528
155 Ga0097620_100133812 3300006931 Bacteria 2551
156 Ga0097620_100245846 3300006931 Bacteria 1879
157 Ga0075435_100001047 3300007076 Bacteria 17522
158 Ga0075435_100065017 3300007076 Bacteria 2965
159 Ga0075435_100128948 3300007076 Bacteria 2116
160 Ga0075435_100173668 3300007076 Bacteria 1819
161 Ga0105250_10135451 3300009092 Bacteria 1018
162 Ga0105240_10001667 3300009093 Bacteria 37697
163 Ga0105240_10011070 3300009093 Bacteria 12612
164 Ga0105240_10022406 3300009093 Bacteria 8374
165 Ga0105240_10031951 3300009093 Bacteria 6819
166 Ga0105240_10090783 3300009093 Bacteria 3733
167 Ga0105240_10153053 3300009093 Bacteria 2745
168 Ga0105245_10000216 3300009098 Bacteria 55016
169 Ga0105245_10006136 3300009098 Bacteria 10575
170 Ga0105247_10000162 3300009101 Bacteria 65804
171 Ga0105247_10107898 3300009101 Bacteria 1788
172 Ga0114129_10029481 3300009147 Bacteria 7773
173 Ga0114129_10075941 3300009147 Bacteria 4678
174 Ga0114129_10206354 3300009147 Bacteria 2658
175 Ga0105243_10000351 3300009148 Bacteria 49081
176 Ga0105242_10000213 3300009176 Bacteria 45343
177 Ga0105248_10000732 3300009177 Bacteria 36950
178 Ga0105248_10023489 3300009177 Bacteria 6849
179 Ga0105248_10066798 3300009177 Bacteria 4037
180 Ga0105248_10322238 3300009177 Bacteria 1741
181 Ga0105238_10005467 3300009551 Bacteria 12560
182 Ga0105238_10043549 3300009551 Bacteria 4541
183 Ga0105238_10067312 3300009551 Bacteria 3583
184 Ga0105238_10474463 3300009551 Bacteria 1250
185 Ga0105249_10000741 3300009553 Bacteria 29423
186 Ga0105249_10017725 3300009553 Bacteria 6325
187 Ga0105239_10043360 3300010375 Bacteria 4931
188 Ga0157370_10002946 3300013104 Bacteria 20263
189 Ga0157370_10013826 3300013104 Bacteria 8291
190 Ga0157370_10140238 3300013104 Bacteria 2252
191 Ga0157369_10002769 3300013105 Bacteria 20942
192 Ga0157369_10010329 3300013105 Bacteria 10647
193 Ga0157369_10176136 3300013105 Bacteria 2252
194 Ga0157374_10018681 3300013296 Bacteria 6123
195 Ga0157378_10000354 3300013297 Bacteria 45097
196 Ga0163162_10026604 3300013306 Bacteria 5719
197 Ga0163162_10129523 3300013306 Bacteria 2631
198 Ga0157372_10109273 3300013307 Bacteria 3166
199 Ga0157375_10184874 3300013308 Bacteria 2237
200 Ga0163163_10275592 3300014325 Bacteria 1733
201 Ga0157380_10246705 3300014326 Bacteria 1614
202 Ga0157380_10346442 3300014326 Bacteria 1388
203 Ga0157377_10145125 3300014745 Bacteria 1462
204 Ga0157379_10003779 3300014968 Bacteria 12888
205 Ga0157379_10011481 3300014968 Bacteria 7731
206 Ga0157379_10137258 3300014968 Bacteria 2204
207 Ga0157376_10012315 3300014969 Bacteria 6345
208 Ga0157376_10103519 3300014969 Bacteria 2493
209 Ga0206353_10573776 3300020082 Bacteria 2013
210 Ga0213871_10001009 3300021441 Bacteria 4411
211 Ga0207656_10068118 3300025321 Bacteria 1576
212 Ga0207696_1066868 3300025711 Bacteria 1003
213 Ga0207653_10056740 3300025885 Bacteria 1314
214 Ga0207642_10001235 3300025899 Bacteria 7910
215 Ga0207642_10085337 3300025899 Bacteria 1545
216 Ga0207680_10013226 3300025903 Bacteria 4232
217 Ga0207680_10031331 3300025903 Bacteria 3011
218 Ga0207680_10036047 3300025903 Bacteria 2846
219 Ga0207647_10007751 3300025904 Bacteria 7728
220 Ga0207647_10164104 3300025904 Bacteria 1295
221 Ga0207643_10018680 3300025908 Bacteria 3797
222 Ga0207684_10013597 3300025910 Bacteria 7035
223 Ga0207684_10120246 3300025910 Bacteria 2252
224 Ga0207707_10000035 3300025912 Bacteria 147299
225 Ga0207707_10000591 3300025912 Bacteria 36552
226 Ga0207707_10006531 3300025912 Bacteria 10178
227 Ga0207707_10016998 3300025912 Bacteria 6337
228 Ga0207707_10052167 3300025912 Bacteria 3562
229 Ga0207707_10073754 3300025912 Bacteria 2976
230 Ga0207695_10003010 3300025913 Bacteria 24221
231 Ga0207695_10008455 3300025913 Bacteria 12888
232 Ga0207695_10018181 3300025913 Bacteria 8134
233 Ga0207695_10034578 3300025913 Bacteria 5493
234 Ga0207695_10048033 3300025913 Bacteria 4510
235 Ga0207695_10135433 3300025913 Unclassified 2417
236 Ga0207671_10250392 3300025914 Bacteria 1393
237 Ga0207693_10012278 3300025915 Bacteria 6922
238 Ga0207660_10000599 3300025917 Bacteria 24309
239 Ga0207660_10021662 3300025917 Bacteria 4325
240 Ga0207660_10098037 3300025917 Bacteria 2185
241 Ga0207662_10000021 3300025918 Bacteria 72688
242 Ga0207649_10069913 3300025920 Bacteria 2237
243 Ga0207652_10001126 3300025921 Bacteria 24078
244 Ga0207652_10007317 3300025921 Bacteria 8895
245 Ga0207652_10051036 3300025921 Bacteria 3545
246 Ga0207652_10270102 3300025921 Bacteria 1534
247 Ga0207646_10005579 3300025922 Bacteria 13213
248 Ga0207646_10016170 3300025922 Bacteria 7012
249 Ga0207646_10286414 3300025922 Bacteria 1489
250 Ga0207650_10207764 3300025925 Bacteria 1571
251 Ga0207659_10000107 3300025926 Bacteria 49113
252 Ga0207687_10000136 3300025927 Bacteria 48993
253 Ga0207687_10035395 3300025927 Bacteria 3395
254 Ga0207644_10001361 3300025931 Bacteria 15730
255 Ga0207644_10017983 3300025931 Bacteria 4780
256 Ga0207644_10018233 3300025931 Bacteria 4746
257 Ga0207644_10146280 3300025931 Bacteria 1825
258 Ga0207644_10258273 3300025931 Bacteria 1392
259 Ga0207686_10000345 3300025934 Bacteria 33420
260 Ga0207709_10000272 3300025935 Bacteria 60885
261 Ga0207670_10000515 3300025936 Bacteria 21318
262 Ga0207670_10026864 3300025936 Bacteria 3633
263 Ga0207704_10000208 3300025938 Bacteria 29760
264 Ga0207704_10315996 3300025938 Bacteria 1203
265 Ga0207691_10016680 3300025940 Bacteria 6974
266 Ga0207711_10016315 3300025941 Bacteria 6170
267 Ga0207711_10032731 3300025941 Bacteria 4397
268 Ga0207711_10225848 3300025941 Bacteria 1714
269 Ga0207689_10000170 3300025942 Bacteria 57072
270 Ga0207661_10067559 3300025944 Bacteria 2908
271 Ga0207661_10307150 3300025944 Bacteria 1423
272 Ga0207661_10386486 3300025944 Bacteria 1267
273 Ga0207679_10263788 3300025945 Bacteria 1470
274 Ga0207667_10001513 3300025949 Bacteria 29191
275 Ga0207667_10008858 3300025949 Bacteria 11909
276 Ga0207667_10029840 3300025949 Bacteria 5908
277 Ga0207651_10010884 3300025960 Bacteria 5063
278 Ga0207712_10005705 3300025961 Bacteria 7846
279 Ga0207712_10065089 3300025961 Bacteria 2601
280 Ga0207712_10087398 3300025961 Bacteria 2286
281 Ga0207640_10001341 3300025981 Bacteria 13336
282 Ga0207640_10004757 3300025981 Bacteria 7369
283 Ga0207640_10198793 3300025981 Bacteria 1517
284 Ga0207640_10342488 3300025981 Bacteria 1198
285 Ga0207658_10063011 3300025986 Bacteria 2777
286 Ga0207658_10109291 3300025986 Bacteria 2182
287 Ga0207677_10001117 3300026023 Bacteria 14634
288 Ga0207703_10002163 3300026035 Bacteria 17264
289 Ga0207703_10021905 3300026035 Bacteria 5004
290 Ga0207703_10022681 3300026035 Bacteria 4929
291 Ga0207703_10031123 3300026035 Bacteria 4217
292 Ga0207639_10084273 3300026041 Bacteria 2525
293 Ga0207639_10118330 3300026041 Bacteria 2172
294 Ga0207708_10000222 3300026075 Bacteria 45117
295 Ga0207708_10003419 3300026075 Bacteria 11692
296 Ga0207702_10004976 3300026078 Bacteria 11672
297 Ga0207702_10162288 3300026078 Bacteria 2042
298 Ga0207702_10179529 3300026078 Bacteria 1948
299 Ga0207702_10443839 3300026078 Bacteria 1258
300 Ga0207641_10001356 3300026088 Bacteria 24281
301 Ga0207641_10005349 3300026088 Bacteria 10961
302 Ga0207641_10137396 3300026088 Bacteria 2201
303 Ga0207648_10000152 3300026089 Bacteria 69770
304 Ga0207648_10077413 3300026089 Bacteria 2899
305 Ga0207676_10033646 3300026095 Bacteria 3874
306 Ga0207676_10255772 3300026095 Bacteria 1579
307 Ga0207674_10008204 3300026116 Bacteria 12102
308 Ga0207674_10119488 3300026116 Bacteria 2604
309 Ga0207674_10371176 3300026116 Unclassified 1383
310 Ga0207675_100000086 3300026118 Bacteria 72707
311 Ga0207675_100006894 3300026118 Bacteria 10761
312 Ga0207675_100098870 3300026118 Bacteria 2748
313 Ga0207675_100470211 3300026118 Bacteria 1248
314 Ga0207698_10000019 3300026142 Bacteria 145910
315 Ga0207428_10137560 3300027907 Bacteria 1867
316 Ga0268266_10004464 3300028379 Bacteria 13380
317 Ga0268266_10024820 3300028379 Bacteria 5101
318 Ga0268266_10175956 3300028379 Bacteria 1945
319 Ga0268266_10372364 3300028379 Bacteria 1345
320 Ga0268265_10002783 3300028380 Bacteria 12884
321 Ga0268264_10000774 3300028381 Bacteria 35274
322 Ga0268264_10001005 3300028381 Bacteria 28618
323 Ga0265319_1009432 3300028563 Bacteria 4156
324 Ga0265334_10019300 3300028573 Bacteria 2806
325 Ga0265318_10000024 3300028577 Bacteria 159801
326 Ga0265318_10047125 3300028577 Bacteria 1626
327 Ga0265336_10004397 3300028666 Bacteria 5339
328 Ga0265338_10007488 3300028800 Bacteria 13527
329 Ga0265338_10052060 3300028800 Bacteria 3679
330 Ga0265338_10053797 3300028800 Bacteria 3597
331 Ga0265338_10085922 3300028800 Bacteria 2620
332 Ga0265330_10012913 3300031235 Bacteria 3899
333 Ga0265332_10002113 3300031238 Bacteria 10276
334 Ga0265332_10076060 3300031238 Bacteria 1427
335 Ga0265328_10007361 3300031239 Bacteria 4591
336 Ga0265320_10000217 3300031240 Bacteria 46656
337 Ga0265320_10015499 3300031240 Bacteria 4307
338 Ga0265325_10011042 3300031241 Bacteria 5198
339 Ga0265325_10015830 3300031241 Bacteria 4230
340 Ga0265329_10020127 3300031242 Bacteria 2257
341 Ga0265340_10003472 3300031247 Bacteria 8885
342 Ga0265340_10051332 3300031247 Bacteria 1997
343 Ga0265339_10045137 3300031249 Bacteria 2427
344 Ga0265331_10011346 3300031250 Bacteria 4884
345 Ga0265316_10018256 3300031344 Bacteria 6032
346 Ga0307408_100065283 3300031548 Bacteria 2669
347 Ga0265313_10017080 3300031595 Bacteria 4141
348 Ga0265314_10090066 3300031711 Bacteria 1999
349 Ga0265342_10009081 3300031712 Bacteria 7049
350 Ga0307405_10160853 3300031731 Bacteria 1590
351 Ga0307405_10190907 3300031731 Bacteria 1479
352 Ga0307405_10466995 3300031731 Bacteria 1004
353 Ga0307412_10004605 3300031911 Bacteria 7686
354 Ga0307412_10006032 3300031911 Bacteria 6823
355 Ga0307416_100030772 3300032002 Bacteria 4032
356 Ga0307416_100071335 3300032002 Bacteria 2885
357 Ga0307416_100363515 3300032002 Bacteria 1470
358 Ga0307414_10000390 3300032004 Bacteria 23921
359 Ga0307411_10145275 3300032005 Bacteria 1755
360 Ga0373930_0025394 3300034816 Bacteria 1189
361 Ga0373926_0044867 3300035083 Bacteria 1584
362 Ga0373928_0004005 3300035084 Bacteria 2811
363 Ga0373949_0028488 3300035090 Bacteria 1318
364 Ga0373932_0020316 3300035112 Bacteria 1740
365 Ga0373936_0011553 3300035113 Bacteria 3345
366 Ga0373936_0061891 3300035113 Bacteria 1529
367 Ga0373945_0034550 3300035116 Bacteria 1802
368 Ga0373943_0061368 3300035170 Bacteria 1879
369 Ga0373943_0184707 3300035170 Bacteria 1147
370 Ga0373946_0028409 3300035171 Bacteria 2219
371 Ga0373942_0052255 3300035207 Bacteria 1149
372 Ga0316574_0191623 3300035398 Bacteria 1315
373 Ga0373931_0001153 3300035691 Bacteria 11239
374 Ga0373931_0015971 3300035691 Bacteria 3689
375 Ga0373931_0025239 3300035691 Bacteria 3018
376 Ga0373935_0033987 3300035692 Bacteria 3176
377 Ga0373933_0004140 3300035724 Bacteria 7989
378 Ga0373937_0008905 3300036401 Bacteria 8714
379 Ga0373937_0108974 3300036401 Bacteria 2575
380 Ga0372808_015607 3300036459 Bacteria 1087
381 Ga0373925_0060563 3300037068 Bacteria 2842
382 Ga0395900_0017250 3300037418 Bacteria 7369
383 Ga0395898_0055931 3300037466 Bacteria 3848
384 Ga0395898_0084176 3300037466 Bacteria 3066
385 Ga0395905_0012722 3300037471 Bacteria 8093
386 Ga0395905_0034067 3300037471 Bacteria 4782
387 Ga0395905_0216948 3300037471 Bacteria 1791
388 Ga0395905_0245308 3300037471 Bacteria 1673
389 Ga0436364_0310337 3300037853 Bacteria 5020
390 Ga0436364_0376956 3300037853 Bacteria 951
391 Ga0436364_0498727 3300037853 Bacteria 1274
392 Ga0436362_1180834 3300039453 Bacteria 2560
393 Ga0439460_0060487 3300042461 Bacteria 1155
394 Ga0451577_0013166 3300042876 Bacteria 7751
395 Ga0451577_0271149 3300042876 Bacteria 1537
396 Ga0466969_0001888 3300044656 Bacteria 11211
397 Ga0466969_0004139 3300044656 Bacteria 7701
398 Ga0466969_0091609 3300044656 Bacteria 1440
399 Ga0466966_0006317 3300044684 Bacteria 7837
400 Ga0466966_0024109 3300044684 Bacteria 3982
401 Ga0466966_0025325 3300044684 Bacteria 3876
402 Ga0466961_0008054 3300044693 Bacteria 6715
403 Ga0466964_0001512 3300044706 Bacteria 7984
404 Ga0453684_0187413 3300044712 Bacteria 2423
405 Ga0466971_0001325 3300044719 Bacteria 10346
406 Ga0466957_0013671 3300044842 Bacteria 4713
407 Ga0466959_0006379 3300045049 Bacteria 8166
408 Ga0466959_0024043 3300045049 Bacteria 4512
409 Ga0451576_0004839 3300045051 Bacteria 17244
410 Ga0451576_0020965 3300045051 Bacteria 7111
411 Ga0451576_0328971 3300045051 Bacteria 1599
412 Ga0466967_0531602 3300045976 Bacteria 1156
413 Ga0495603_0175977 3300046455 Bacteria 1239
414 Ga0495638_0000209 3300046460 Bacteria 82799
415 Ga0495650_0068414 3300046471 Bacteria 1401
416 Ga0495580_0029410 3300046472 Bacteria 3987
417 Ga0495582_0063147 3300046473 Bacteria 2046
418 Ga0495583_0163042 3300046506 Unclassified 919
419 Ga0495628_0144522 3300046516 Bacteria 1814
420 Ga0495666_0008777 3300046526 Bacteria 5065
421 Ga0495665_0112473 3300046531 Bacteria 1428
422 Ga0495586_0129868 3300046535 Bacteria 1410
423 Ga0495656_0082675 3300046615 Bacteria 1452
424 Ga0495635_0041609 3300046663 Bacteria 3174
425 Ga0495635_0091079 3300046663 Bacteria 2086
426 Ga0495659_0082851 3300046664 Bacteria 1220
427 Ga0495647_0007402 3300046681 Bacteria 3676
428 Ga0495658_0089711 3300046683 Bacteria 1818
429 Ga0495658_0118422 3300046683 Bacteria 1599
430 Ga0495600_0085337 3300046809 Bacteria 2060
431 Ga0495674_0125499 3300047319 Bacteria 2166
432 Ga0495676_0089442 3300047321 Bacteria 2307
433 Ga0495680_0158401 3300047322 Bacteria 1646
434 Ga0495684_0179252 3300047471 Bacteria 1571
435 Ga0495686_0038541 3300047472 Bacteria 3056
436 Ga0496107_0110724 3300048910 Bacteria 2018
437 Ga0496108_0401191 3300048911 Bacteria 1198
438 Ga0496112_0014951 3300048915 Bacteria 7223
439 Ga0496112_0167092 3300048915 Bacteria 2166
440 Ga0496114_0414516 3300048917 Bacteria 1193
441 Ga0496118_0004788 3300048921 Bacteria 15804
442 Ga0501031_0012961 3300049568 Bacteria 5442
443 Ga0501032_0150090 3300049569 Bacteria 1533
444 Ga0501032_0183893 3300049569 Bacteria 1368
445 Ga0501033_0006089 3300049570 Bacteria 9460
446 Ga0501034_0006776 3300049571 Bacteria 12251
447 Ga0501034_0318566 3300049571 Bacteria 1488
448 Ga0501034_0493796 3300049571 Bacteria 1138
449 Ga0501036_0000813 3300049572 Bacteria 23193
450 Ga0501036_0151633 3300049572 Bacteria 1955
451 Ga0501037_0260410 3300049573 Bacteria 1212
452 Ga0501037_0330198 3300049573 Bacteria 1055
453 Ga0501038_0003073 3300049574 Bacteria 15555
454 Ga0501038_0040317 3300049574 Bacteria 4080
455 Ga0501039_0009779 3300049575 Bacteria 7306
456 Ga0501039_0070861 3300049575 Bacteria 2708
457 Ga0501040_0001615 3300049576 Bacteria 14363
458 Ga0501040_0039177 3300049576 Bacteria 3223
459 Ga0501040_0083076 3300049576 Bacteria 2221
460 Ga0501040_0145752 3300049576 Bacteria 1669
461 Ga0501041_0001139 3300049577 Bacteria 14553
462 Ga0501041_0024105 3300049577 Bacteria 3651
463 Ga0501042_0002291 3300049578 Bacteria 11694
464 Ga0501042_0068524 3300049578 Bacteria 2537
465 Ga0501042_0091857 3300049578 Bacteria 2179
466 Ga0501043_0277632 3300049579 Bacteria 1285
467 Ga0501046_0072937 3300049580 Bacteria 2665
468 Ga0501046_0094467 3300049580 Bacteria 2298
469 Ga0501046_0102513 3300049580 Bacteria 2194
470 Ga0501046_0122997 3300049580 Bacteria 1973
471 Ga0501048_0001889 3300049582 Bacteria 15912
472 Ga0501048_0244020 3300049582 Bacteria 1275
473 Ga0501048_0294911 3300049582 Bacteria 1153
474 Ga0501068_0206206 3300049584 Bacteria 1247
475 Ga0501070_0080845 3300049586 Bacteria 2688
476 Ga0501070_0194860 3300049586 Bacteria 1664
477 Ga0501071_0021725 3300049587 Bacteria 4473
478 Ga0501071_0025290 3300049587 Bacteria 4158
479 Ga0501071_0029311 3300049587 Bacteria 3884
480 Ga0501072_0003575 3300049588 Bacteria 11694
481 Ga0501072_0006523 3300049588 Bacteria 8889
482 Ga0501072_0061211 3300049588 Bacteria 2968
483 Ga0501073_0114285 3300049589 Bacteria 1872
484 Ga0501073_0116143 3300049589 Bacteria 1855
485 Ga0501075_0013830 3300049591 Bacteria 5771
486 Ga0501075_0030184 3300049591 Bacteria 4014
487 Ga0501075_0158123 3300049591 Bacteria 1728
488 Ga0501076_0002359 3300049592 Bacteria 12925
489 Ga0501076_0019099 3300049592 Bacteria 5232
490 Ga0501076_0041955 3300049592 Bacteria 3602
491 Ga0501076_0065989 3300049592 Bacteria 2887
492 Ga0501077_0000739 3300049593 Bacteria 19791
493 Ga0501077_0022632 3300049593 Bacteria 3982
494 Ga0501077_0099223 3300049593 Bacteria 1846
495 Ga0501198_005077 3300049649 Bacteria 1843
496 Ga0501223_000107 3300049663 Bacteria 23945
497 Ga0501224_000031 3300049664 Bacteria 43294
498 Ga0501233_007275 3300049668 Bacteria 2103
499 Ga0501235_001538 3300049669 Bacteria 4941
500 Ga0501225_0000702 3300049705 Bacteria 10488
501 Ga0501234_000659 3300049707 Bacteria 5352
502 Ga0501079_0003530 3300049741 Bacteria 11495
503 Ga0501079_0014922 3300049741 Bacteria 5921
504 Ga0501080_0009560 3300049742 Bacteria 8851
505 Ga0501081_0003860 3300049743 Bacteria 9599
506 Ga0501081_0029081 3300049743 Bacteria 3732
507 Ga0501083_0308559 3300049744 Bacteria 1029
508 Ga0501241_002928 3300049758 Bacteria 3270
509 Ga0501035_0026246 3300049822 Bacteria 5331
510 Ga0501035_0191530 3300049822 Bacteria 1758
511 Ga0501035_0345146 3300049822 Bacteria 1247
512 Ga0501044_0207392 3300049823 Bacteria 1916
513 Ga0501044_0297449 3300049823 Bacteria 1544
514 Ga0501045_0004583 3300049824 Bacteria 9542
515 Ga0501045_0030226 3300049824 Bacteria 3920
516 Ga0501045_0382581 3300049824 Bacteria 1047
517 Ga0501045_0394528 3300049824 Bacteria 1030
518 Ga0501226_000051 3300049853 Bacteria 49149
519 nmdc:mga03n38_121763_c1 3300050490 Bacteria 1283
520 nmdc:mga03n38_8024_c1 3300050490 Bacteria 3767
521 nmdc:mga00v17_13016_c1 3300050491 Bacteria 4609
522 nmdc:mga05p37_57167_c1 3300050507 Bacteria 4804
523 nmdc:mga05p37_9320_c1 3300050507 Bacteria 11612
524 nmdc:mga0qj67_2568_c1 3300050509 Bacteria 12972
525 nmdc:mga06r32_13215_c1 3300050510 Bacteria 7477
526 nmdc:mga08y16_53688_c1 3300050511 Bacteria 4213
527 nmdc:mga0n895_114549_c1 3300050512 Bacteria 2714
528 nmdc:mga0n895_61699_c1 3300050512 Bacteria 3703
529 nmdc:mga0rr50_1703_c1 3300050513 Bacteria 12138
530 nmdc:mga0rr50_24001_c1 3300050513 Bacteria 4217
531 nmdc:mga08x19_202513_c1 3300050514 Bacteria 1361
532 nmdc:mga08x19_846_c1 3300050514 Bacteria 19420
533 nmdc:mga0a205_1761_c1 3300050515 Bacteria 18734
534 Ga0495601_0156377 3300053077 Bacteria 1489
535 Ga0495601_0160492 3300053077 Bacteria 1469
536 Ga0495619_0057318 3300053085 Bacteria 2585
537 Ga0500583_0055179 3300053092 Bacteria 1857
538 Ga0500640_000036 3300053095 Bacteria 20472
539 Ga0500641_0011113 3300053096 Bacteria 3264
540 Ga0500641_0028444 3300053096 Bacteria 2183
541 Ga0500572_002914 3300053111 Bacteria 4012
542 Ga0500591_063635 3300053115 Bacteria 1693
543 Ga0500595_001238 3300053119 Bacteria 14072
544 Ga0500595_018830 3300053119 Bacteria 2517
545 Ga0500595_053197 3300053119 Bacteria 1247
546 Ga0500614_000846 3300053123 Bacteria 7731
547 Ga0500652_137765 3300053131 Bacteria 1017
548 Ga0500603_000195 3300053150 Bacteria 15888
549 Ga0500616_0000030 3300053153 Bacteria 415224
550 Ga0500616_0013131 3300053153 Bacteria 4821
551 Ga0500622_0048877 3300053156 Bacteria 2181
552 Ga0500630_001646 3300053159 Bacteria 10694
553 Ga0500638_072606 3300053162 Bacteria 1643
554 Ga0500639_000170 3300053163 Bacteria 31566
555 Ga0500637_0021629 3300053178 Bacteria 3495
556 Ga0500637_0060065 3300053178 Bacteria 2176
557 Ga0500596_000047 3300053735 Bacteria 16297
558 Ga0500601_001015 3300053737 Bacteria 3232
559 Ga0500587_001606 3300053739 Bacteria 3215
560 Ga0501084_0003144 3300054114 Bacteria 13350
561 Ga0501084_0085989 3300054114 Bacteria 2640
562 Ga0501082_0002898 3300060353 Bacteria 14954
563 Ga0501082_0046675 3300060353 Bacteria 3733
564 Ga0466962_0003099 3300061719 Bacteria 7902
565 Ga0530510_0000675 3300061734 Bacteria 21957
566 Ga0530510_0002365 3300061734 Bacteria 12954
567 Ga0530510_0093780 3300061734 Bacteria 2192
568 Ga0530510_0109437 3300061734 Bacteria 2023

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042461 Ga0439460_0060487 Ga0439460_0060487_14_724 219
2 3300053739 Ga0500587_001606 Ga0500587_001606_59_859 266
3 3300005444 Ga0070694_100126085 Ga0070694_1001260852 267
4 3300005548 Ga0070665_100003310 Ga0070665_10000331012 267
5 3300005843 Ga0068860_100509477 Ga0068860_1005094772 267
6 3300009177 Ga0105248_10322238 Ga0105248_103222381 267
7 3300014326 Ga0157380_10246705 Ga0157380_102467052 267
8 3300025938 Ga0207704_10315996 Ga0207704_103159962 267
9 3300025941 Ga0207711_10225848 Ga0207711_102258482 267
10 3300026118 Ga0207675_100470211 Ga0207675_1004702111 267
11 3300028379 Ga0268266_10004464 Ga0268266_100044643 267
12 3300046455 Ga0495603_0175977 Ga0495603_0175977_78_887 267
13 3300005288 Ga0065714_10115941 Ga0065714_101159411 270
14 3300005290 Ga0065712_10068613 Ga0065712_100686132 270
15 3300005343 Ga0070687_100340981 Ga0070687_1003409811 270
16 3300005440 Ga0070705_100144062 Ga0070705_1001440622 270
17 3300005617 Ga0068859_100245840 Ga0068859_1002458402 270
18 3300005842 Ga0068858_100124906 Ga0068858_1001249062 270
19 3300006931 Ga0097620_100245846 Ga0097620_1002458462 270
20 3300009098 Ga0105245_10006136 Ga0105245_100061366 270
21 3300009101 Ga0105247_10107898 Ga0105247_101078982 270
22 3300009177 Ga0105248_10000732 Ga0105248_1000073232 270
23 3300009177 Ga0105248_10066798 Ga0105248_100667981 270
24 3300013296 Ga0157374_10018681 Ga0157374_100186814 270
25 3300013306 Ga0163162_10129523 Ga0163162_101295232 270
26 3300014325 Ga0163163_10275592 Ga0163163_102755923 270
27 3300014968 Ga0157379_10011481 Ga0157379_100114813 270
28 3300014968 Ga0157379_10137258 Ga0157379_101372582 270
29 3300014969 Ga0157376_10103519 Ga0157376_101035192 270
30 3300025926 Ga0207659_10000107 Ga0207659_1000010738 270
31 3300025927 Ga0207687_10035395 Ga0207687_100353952 270
32 3300025941 Ga0207711_10016315 Ga0207711_100163153 270
33 3300025961 Ga0207712_10065089 Ga0207712_100650892 270
34 3300026035 Ga0207703_10022681 Ga0207703_100226812 270
35 3300035113 Ga0373936_0061891 Ga0373936_0061891_322_1140 270
36 3300036401 Ga0373937_0108974 Ga0373937_0108974_971_1801 270
37 3300046516 Ga0495628_0144522 Ga0495628_0144522_132_962 270
38 3300046663 Ga0495635_0091079 Ga0495635_0091079_796_1611 270
39 3300048911 Ga0496108_0401191 Ga0496108_0401191_308_1138 270
40 3300048915 Ga0496112_0014951 Ga0496112_0014951_3362_4192 270
41 3300053077 Ga0495601_0160492 Ga0495601_0160492_237_1052 270
42 3300053085 Ga0495619_0057318 Ga0495619_0057318_1267_2082 270
43 3300053119 Ga0500595_001238 Ga0500595_001238_9955_10998 272
44 3300050490 nmdc:mga03n38_121763_c1 nmdc:mga03n38_121763_c1_390_1235 273
45 3300006042 Ga0075368_10035288 Ga0075368_100352882 274
46 3300053119 Ga0500595_053197 Ga0500595_053197_256_1131 274
47 3300037471 Ga0395905_0034067 Ga0395905_0034067_543_1385 278
48 3300005467 Ga0070706_100091186 Ga0070706_1000911863 280
49 3300005468 Ga0070707_100019315 Ga0070707_1000193151 280
50 3300005518 Ga0070699_100058982 Ga0070699_1000589823 280
51 3300025910 Ga0207684_10120246 Ga0207684_101202463 280
52 3300025922 Ga0207646_10005579 Ga0207646_100055792 280
53 3300031241 Ga0265325_10011042 Ga0265325_100110422 282
54 3300005468 Ga0070707_100051739 Ga0070707_1000517392 283
55 3300005546 Ga0070696_100047489 Ga0070696_1000474892 283
56 3300006042 Ga0075368_10029483 Ga0075368_100294832 283
57 3300049582 Ga0501048_0244020 Ga0501048_0244020_321_1208 283
58 3300050512 nmdc:mga0n895_114549_c1 nmdc:mga0n895_114549_c1_124_1008 283
59 3300025885 Ga0207653_10056740 Ga0207653_100567401 284
60 iso_pu_bacteria 2852103415 2852105308 284
61 3300003373 JGI25407J50210_10011898 JGI25407J50210_100118981 286
62 3300005544 Ga0070686_100043036 Ga0070686_1000430362 286
63 3300006048 Ga0075363_100018743 Ga0075363_1000187432 286
64 3300006237 Ga0097621_100052527 Ga0097621_1000525272 286
65 3300006846 Ga0075430_100548036 Ga0075430_1005480361 286
66 3300006847 Ga0075431_100295564 Ga0075431_1002955642 286
67 3300006852 Ga0075433_10001734 Ga0075433_100017343 286
68 3300006914 Ga0075436_100000476 Ga0075436_1000004765 286
69 3300007076 Ga0075435_100001047 Ga0075435_1000010474 286
70 3300007076 Ga0075435_100065017 Ga0075435_1000650173 286
71 3300007076 Ga0075435_100128948 Ga0075435_1001289482 286
72 3300025922 Ga0207646_10286414 Ga0207646_102864141 286
73 3300025931 Ga0207644_10258273 Ga0207644_102582732 286
74 3300026078 Ga0207702_10162288 Ga0207702_101622881 286
75 3300026095 Ga0207676_10033646 Ga0207676_100336466 286
76 3300032002 Ga0307416_100363515 Ga0307416_1003635152 286
77 3300032005 Ga0307411_10145275 Ga0307411_101452752 286
78 3300035691 Ga0373931_0025239 Ga0373931_0025239_734_1597 286
79 3300037853 Ga0436364_0310337 Ga0436364_0310337_27_902 286
80 3300042876 Ga0451577_0013166 Ga0451577_0013166_6534_7397 286
81 3300045051 Ga0451576_0004839 Ga0451576_0004839_1639_2502 286
82 3300048921 Ga0496118_0004788 Ga0496118_0004788_6643_7557 286
83 3300049568 Ga0501031_0012961 Ga0501031_0012961_3862_4725 286
84 3300049569 Ga0501032_0150090 Ga0501032_0150090_43_915 286
85 3300049570 Ga0501033_0006089 Ga0501033_0006089_7880_8743 286
86 3300049571 Ga0501034_0493796 Ga0501034_0493796_98_961 286
87 3300049572 Ga0501036_0000813 Ga0501036_0000813_10761_11624 286
88 3300049574 Ga0501038_0003073 Ga0501038_0003073_11475_12338 286
89 3300049575 Ga0501039_0009779 Ga0501039_0009779_3134_3997 286
90 3300049576 Ga0501040_0001615 Ga0501040_0001615_799_1662 286
91 3300049577 Ga0501041_0001139 Ga0501041_0001139_7902_8765 286
92 3300049578 Ga0501042_0002291 Ga0501042_0002291_347_1210 286
93 3300049580 Ga0501046_0122997 Ga0501046_0122997_435_1307 286
94 3300049582 Ga0501048_0001889 Ga0501048_0001889_927_1790 286
95 3300049586 Ga0501070_0194860 Ga0501070_0194860_336_1199 286
96 3300049587 Ga0501071_0025290 Ga0501071_0025290_221_1084 286
97 3300049588 Ga0501072_0003575 Ga0501072_0003575_10297_11160 286
98 3300049591 Ga0501075_0013830 Ga0501075_0013830_511_1374 286
99 3300049592 Ga0501076_0002359 Ga0501076_0002359_2921_3784 286
100 3300049593 Ga0501077_0000739 Ga0501077_0000739_7658_8521 286
101 3300049741 Ga0501079_0003530 Ga0501079_0003530_2965_3828 286
102 3300049742 Ga0501080_0009560 Ga0501080_0009560_2972_3835 286
103 3300049743 Ga0501081_0003860 Ga0501081_0003860_7881_8744 286
104 3300049822 Ga0501035_0026246 Ga0501035_0026246_3649_4512 286
105 3300049823 Ga0501044_0297449 Ga0501044_0297449_236_1099 286
106 3300049824 Ga0501045_0004583 Ga0501045_0004583_799_1662 286
107 3300050512 nmdc:mga0n895_61699_c1 nmdc:mga0n895_61699_c1_1221_2084 286
108 3300050513 nmdc:mga0rr50_1703_c1 nmdc:mga0rr50_1703_c1_9528_10391 286
109 3300050513 nmdc:mga0rr50_24001_c1 nmdc:mga0rr50_24001_c1_517_1380 286
110 3300050514 nmdc:mga08x19_846_c1 nmdc:mga08x19_846_c1_149_1012 286
111 3300050515 nmdc:mga0a205_1761_c1 nmdc:mga0a205_1761_c1_16538_17401 286
112 3300054114 Ga0501084_0003144 Ga0501084_0003144_811_1674 286
113 3300060353 Ga0501082_0002898 Ga0501082_0002898_1474_2337 286
114 3300061734 Ga0530510_0000675 Ga0530510_0000675_10120_10983 286
115 3300005355 Ga0070671_100006717 Ga0070671_1000067173 287
116 3300005367 Ga0070667_100043035 Ga0070667_1000430354 287
117 3300005518 Ga0070699_100007601 Ga0070699_1000076017 287
118 3300005615 Ga0070702_100161146 Ga0070702_1001611462 287
119 3300006038 Ga0075365_10011690 Ga0075365_100116902 287
120 3300006042 Ga0075368_10036639 Ga0075368_100366392 287
121 3300006048 Ga0075363_100062413 Ga0075363_1000624132 287
122 3300006051 Ga0075364_10001926 Ga0075364_100019265 287
123 3300006051 Ga0075364_10120451 Ga0075364_101204512 287
124 3300006353 Ga0075370_10173701 Ga0075370_101737012 287
125 3300006844 Ga0075428_100030576 Ga0075428_1000305762 287
126 3300006844 Ga0075428_100039971 Ga0075428_1000399714 287
127 3300006846 Ga0075430_100004707 Ga0075430_1000047073 287
128 3300006880 Ga0075429_100259710 Ga0075429_1002597102 287
129 3300009147 Ga0114129_10029481 Ga0114129_100294812 287
130 3300009147 Ga0114129_10206354 Ga0114129_102063542 287
131 3300025903 Ga0207680_10013226 Ga0207680_100132262 287
132 3300025931 Ga0207644_10017983 Ga0207644_100179835 287
133 3300025940 Ga0207691_10016680 Ga0207691_100166803 287
134 3300025986 Ga0207658_10063011 Ga0207658_100630112 287
135 3300031731 Ga0307405_10160853 Ga0307405_101608532 287
136 3300046663 Ga0495635_0041609 Ga0495635_0041609_1990_2871 287
137 3300046809 Ga0495600_0085337 Ga0495600_0085337_379_1260 287
138 3300047319 Ga0495674_0125499 Ga0495674_0125499_1042_1923 287
139 3300047471 Ga0495684_0179252 Ga0495684_0179252_122_1003 287
140 3300049572 Ga0501036_0151633 Ga0501036_0151633_1002_1868 287
141 3300049576 Ga0501040_0039177 Ga0501040_0039177_11_877 287
142 3300049576 Ga0501040_0145752 Ga0501040_0145752_446_1315 287
143 3300049577 Ga0501041_0024105 Ga0501041_0024105_1857_2723 287
144 3300049578 Ga0501042_0068524 Ga0501042_0068524_1135_2001 287
145 3300049580 Ga0501046_0102513 Ga0501046_0102513_99_965 287
146 3300049588 Ga0501072_0006523 Ga0501072_0006523_3995_4861 287
147 3300049592 Ga0501076_0019099 Ga0501076_0019099_4021_4887 287
148 3300049593 Ga0501077_0099223 Ga0501077_0099223_672_1538 287
149 3300049824 Ga0501045_0394528 Ga0501045_0394528_57_926 287
150 3300050490 nmdc:mga03n38_8024_c1 nmdc:mga03n38_8024_c1_784_1659 287
151 3300050491 nmdc:mga00v17_13016_c1 nmdc:mga00v17_13016_c1_315_1190 287
152 3300050507 nmdc:mga05p37_57167_c1 nmdc:mga05p37_57167_c1_1297_2163 287
153 3300050509 nmdc:mga0qj67_2568_c1 nmdc:mga0qj67_2568_c1_1091_1957 287
154 3300050510 nmdc:mga06r32_13215_c1 nmdc:mga06r32_13215_c1_3072_3938 287
155 3300053077 Ga0495601_0156377 Ga0495601_0156377_323_1204 287
156 3300061734 Ga0530510_0002365 Ga0530510_0002365_953_1819 287
157 3300005330 Ga0070690_100000209 Ga0070690_10000020926 288
158 3300005334 Ga0068869_100003175 Ga0068869_1000031752 288
159 3300005336 Ga0070680_100009242 Ga0070680_1000092427 288
160 3300005337 Ga0070682_100001825 Ga0070682_1000018257 288
161 3300005338 Ga0068868_100000337 Ga0068868_10000033721 288
162 3300005340 Ga0070689_100003242 Ga0070689_1000032429 288
163 3300005343 Ga0070687_100000022 Ga0070687_10000002224 288
164 3300005345 Ga0070692_10001244 Ga0070692_100012448 288
165 3300005438 Ga0070701_10000098 Ga0070701_1000009811 288
166 3300005440 Ga0070705_100000199 Ga0070705_10000019912 288
167 3300005441 Ga0070700_100000502 Ga0070700_10000050210 288
168 3300005444 Ga0070694_100009600 Ga0070694_1000096008 288
169 3300005458 Ga0070681_10018326 Ga0070681_100183264 288
170 3300005459 Ga0068867_100000231 Ga0068867_10000023134 288
171 3300005530 Ga0070679_100029290 Ga0070679_1000292905 288
172 3300005536 Ga0070697_100136230 Ga0070697_1001362302 288
173 3300005539 Ga0068853_100148576 Ga0068853_1001485763 288
174 3300005544 Ga0070686_100000124 Ga0070686_10000012429 288
175 3300005545 Ga0070695_100000276 Ga0070695_10000027624 288
176 3300005546 Ga0070696_100000275 Ga0070696_1000002758 288
177 3300005547 Ga0070693_100000130 Ga0070693_10000013024 288
178 3300005549 Ga0070704_100001666 Ga0070704_10000166612 288
179 3300005563 Ga0068855_100000977 Ga0068855_10000097712 288
180 3300005578 Ga0068854_100000985 Ga0068854_10000098512 288
181 3300005614 Ga0068856_100045097 Ga0068856_1000450975 288
182 3300005615 Ga0070702_100000042 Ga0070702_10000004210 288
183 3300005617 Ga0068859_100001713 Ga0068859_10000171313 288
184 3300005718 Ga0068866_10002281 Ga0068866_100022815 288
185 3300005719 Ga0068861_100001131 Ga0068861_1000011318 288
186 3300005840 Ga0068870_10024963 Ga0068870_100249633 288
187 3300005842 Ga0068858_100009148 Ga0068858_1000091488 288
188 3300005843 Ga0068860_100023675 Ga0068860_1000236752 288
189 3300005844 Ga0068862_100131207 Ga0068862_1001312072 288
190 3300006237 Ga0097621_100007905 Ga0097621_1000079053 288
191 3300006358 Ga0068871_100024321 Ga0068871_1000243213 288
192 3300006881 Ga0068865_100000673 Ga0068865_10000067310 288
193 3300006931 Ga0097620_100001713 Ga0097620_10000171313 288
194 3300009092 Ga0105250_10135451 Ga0105250_101354511 288
195 3300009098 Ga0105245_10000216 Ga0105245_1000021634 288
196 3300009147 Ga0114129_10075941 Ga0114129_100759415 288
197 3300009148 Ga0105243_10000351 Ga0105243_1000035126 288
198 3300009176 Ga0105242_10000213 Ga0105242_1000021320 288
199 3300009553 Ga0105249_10000741 Ga0105249_1000074111 288
200 3300013297 Ga0157378_10000354 Ga0157378_1000035426 288
201 3300013308 Ga0157375_10184874 Ga0157375_101848743 288
202 3300014745 Ga0157377_10145125 Ga0157377_101451252 288
203 3300014969 Ga0157376_10012315 Ga0157376_100123157 288
204 3300025711 Ga0207696_1066868 Ga0207696_10668681 288
205 3300025899 Ga0207642_10001235 Ga0207642_100012355 288
206 3300025904 Ga0207647_10164104 Ga0207647_101641042 288
207 3300025908 Ga0207643_10018680 Ga0207643_100186804 288
208 3300025912 Ga0207707_10016998 Ga0207707_100169987 288
209 3300025917 Ga0207660_10000599 Ga0207660_1000059910 288
210 3300025918 Ga0207662_10000021 Ga0207662_1000002119 288
211 3300025921 Ga0207652_10007317 Ga0207652_100073174 288
212 3300025927 Ga0207687_10000136 Ga0207687_1000013621 288
213 3300025934 Ga0207686_10000345 Ga0207686_1000034530 288
214 3300025935 Ga0207709_10000272 Ga0207709_1000027231 288
215 3300025936 Ga0207670_10000515 Ga0207670_1000051516 288
216 3300025938 Ga0207704_10000208 Ga0207704_1000020820 288
217 3300025942 Ga0207689_10000170 Ga0207689_1000017024 288
218 3300025949 Ga0207667_10001513 Ga0207667_100015138 288
219 3300025961 Ga0207712_10005705 Ga0207712_100057057 288
220 3300025981 Ga0207640_10004757 Ga0207640_100047573 288
221 3300026023 Ga0207677_10001117 Ga0207677_1000111715 288
222 3300026035 Ga0207703_10031123 Ga0207703_100311235 288
223 3300026041 Ga0207639_10084273 Ga0207639_100842734 288
224 3300026075 Ga0207708_10000222 Ga0207708_1000022247 288
225 3300026089 Ga0207648_10000152 Ga0207648_1000015246 288
226 3300026118 Ga0207675_100000086 Ga0207675_10000008654 288
227 3300028380 Ga0268265_10002783 Ga0268265_100027833 288
228 3300028381 Ga0268264_10001005 Ga0268264_100010056 288
229 3300028800 Ga0265338_10053797 Ga0265338_100537972 288
230 3300031247 Ga0265340_10003472 Ga0265340_100034726 288
231 3300034816 Ga0373930_0025394 Ga0373930_0025394_241_1119 288
232 3300035083 Ga0373926_0044867 Ga0373926_0044867_690_1565 288
233 3300035084 Ga0373928_0004005 Ga0373928_0004005_1017_1895 288
234 3300035090 Ga0373949_0028488 Ga0373949_0028488_71_949 288
235 3300035112 Ga0373932_0020316 Ga0373932_0020316_164_1042 288
236 3300035113 Ga0373936_0011553 Ga0373936_0011553_1819_2694 288
237 3300035116 Ga0373945_0034550 Ga0373945_0034550_645_1520 288
238 3300035170 Ga0373943_0061368 Ga0373943_0061368_20_895 288
239 3300035170 Ga0373943_0184707 Ga0373943_0184707_253_1128 288
240 3300035171 Ga0373946_0028409 Ga0373946_0028409_993_1868 288
241 3300035207 Ga0373942_0052255 Ga0373942_0052255_15_893 288
242 3300035691 Ga0373931_0001153 Ga0373931_0001153_10196_11074 288
243 3300035691 Ga0373931_0015971 Ga0373931_0015971_942_1820 288
244 3300035692 Ga0373935_0033987 Ga0373935_0033987_2207_3082 288
245 3300037068 Ga0373925_0060563 Ga0373925_0060563_498_1373 288
246 3300037853 Ga0436364_0498727 Ga0436364_0498727_203_1075 288
247 3300045051 Ga0451576_0328971 Ga0451576_0328971_490_1368 288
248 3300046472 Ga0495580_0029410 Ga0495580_0029410_476_1351 288
249 3300046473 Ga0495582_0063147 Ga0495582_0063147_47_922 288
250 3300046526 Ga0495666_0008777 Ga0495666_0008777_3340_4215 288
251 3300046531 Ga0495665_0112473 Ga0495665_0112473_149_1024 288
252 3300046615 Ga0495656_0082675 Ga0495656_0082675_211_1089 288
253 3300046681 Ga0495647_0007402 Ga0495647_0007402_2289_3164 288
254 3300046683 Ga0495658_0089711 Ga0495658_0089711_554_1426 288
255 3300046683 Ga0495658_0118422 Ga0495658_0118422_256_1131 288
256 3300047321 Ga0495676_0089442 Ga0495676_0089442_1401_2276 288
257 3300048917 Ga0496114_0414516 Ga0496114_0414516_144_1022 288
258 3300050507 nmdc:mga05p37_9320_c1 nmdc:mga05p37_9320_c1_9401_10279 288
259 3300050511 nmdc:mga08y16_53688_c1 nmdc:mga08y16_53688_c1_586_1464 288
260 3300003203 JGI25406J46586_10016100 JGI25406J46586_100161002 289
261 3300005345 Ga0070692_10035296 Ga0070692_100352963 289
262 3300005366 Ga0070659_100065413 Ga0070659_1000654133 289
263 3300005530 Ga0070679_100315605 Ga0070679_1003156052 289
264 3300005535 Ga0070684_100701186 Ga0070684_1007011861 289
265 3300005985 Ga0081539_10000123 Ga0081539_10000123109 289
266 3300006042 Ga0075368_10094912 Ga0075368_100949122 289
267 3300006048 Ga0075363_100015115 Ga0075363_1000151152 289
268 3300013104 Ga0157370_10140238 Ga0157370_101402383 289
269 3300013105 Ga0157369_10002769 Ga0157369_1000276916 289
270 3300021441 Ga0213871_10001009 Ga0213871_100010092 289
271 3300025912 Ga0207707_10052167 Ga0207707_100521673 289
272 3300025917 Ga0207660_10021662 Ga0207660_100216624 289
273 3300025921 Ga0207652_10270102 Ga0207652_102701022 289
274 3300026116 Ga0207674_10119488 Ga0207674_101194882 289
275 3300026118 Ga0207675_100098870 Ga0207675_1000988702 289
276 3300031247 Ga0265340_10051332 Ga0265340_100513322 289
277 3300031548 Ga0307408_100065283 Ga0307408_1000652831 289
278 3300031911 Ga0307412_10004605 Ga0307412_100046053 289
279 3300032002 Ga0307416_100071335 Ga0307416_1000713353 289
280 3300032004 Ga0307414_10000390 Ga0307414_1000039020 289
281 3300035724 Ga0373933_0004140 Ga0373933_0004140_5229_6098 289
282 3300036401 Ga0373937_0008905 Ga0373937_0008905_3087_3956 289
283 3300037466 Ga0395898_0084176 Ga0395898_0084176_588_1457 289
284 3300039453 Ga0436362_1180834 Ga0436362_1180834_1568_2440 289
285 3300042876 Ga0451577_0271149 Ga0451577_0271149_112_987 289
286 3300044712 Ga0453684_0187413 Ga0453684_0187413_18_893 289
287 3300045051 Ga0451576_0020965 Ga0451576_0020965_1421_2296 289
288 3300045976 Ga0466967_0531602 Ga0466967_0531602_110_979 289
289 3300046664 Ga0495659_0082851 Ga0495659_0082851_173_1048 289
290 3300049571 Ga0501034_0006776 Ga0501034_0006776_1441_2310 289
291 3300049649 Ga0501198_005077 Ga0501198_005077_272_1141 289
292 3300049663 Ga0501223_000107 Ga0501223_000107_15012_15881 289
293 3300049664 Ga0501224_000031 Ga0501224_000031_8038_8907 289
294 3300049668 Ga0501233_007275 Ga0501233_007275_378_1247 289
295 3300049669 Ga0501235_001538 Ga0501235_001538_82_951 289
296 3300049705 Ga0501225_0000702 Ga0501225_0000702_1370_2239 289
297 3300049707 Ga0501234_000659 Ga0501234_000659_4396_5265 289
298 3300049744 Ga0501083_0308559 Ga0501083_0308559_35_910 289
299 3300049823 Ga0501044_0207392 Ga0501044_0207392_809_1678 289
300 3300049853 Ga0501226_000051 Ga0501226_000051_14018_14887 289
301 3300050514 nmdc:mga08x19_202513_c1 nmdc:mga08x19_202513_c1_443_1348 289
302 3300053131 Ga0500652_137765 Ga0500652_137765_117_992 289
303 3300053156 Ga0500622_0048877 Ga0500622_0048877_1228_2103 289
304 3300053178 Ga0500637_0021629 Ga0500637_0021629_1266_2147 289
305 3300005330 Ga0070690_100006618 Ga0070690_1000066182 290
306 3300005331 Ga0070670_100036463 Ga0070670_1000364634 290
307 3300005335 Ga0070666_10024585 Ga0070666_100245853 290
308 3300005335 Ga0070666_10106531 Ga0070666_101065313 290
309 3300005336 Ga0070680_100002272 Ga0070680_10000227214 290
310 3300005336 Ga0070680_100448697 Ga0070680_1004486971 290
311 3300005337 Ga0070682_100314484 Ga0070682_1003144841 290
312 3300005338 Ga0068868_100006826 Ga0068868_10000682610 290
313 3300005344 Ga0070661_100089370 Ga0070661_1000893702 290
314 3300005345 Ga0070692_10073413 Ga0070692_100734132 290
315 3300005355 Ga0070671_100001900 Ga0070671_1000019009 290
316 3300005355 Ga0070671_100034603 Ga0070671_1000346034 290
317 3300005356 Ga0070674_100410170 Ga0070674_1004101702 290
318 3300005364 Ga0070673_100015726 Ga0070673_1000157266 290
319 3300005367 Ga0070667_100000762 Ga0070667_10000076225 290
320 3300005367 Ga0070667_100023615 Ga0070667_1000236152 290
321 3300005434 Ga0070709_10058531 Ga0070709_100585313 290
322 3300005436 Ga0070713_100209515 Ga0070713_1002095152 290
323 3300005438 Ga0070701_10033049 Ga0070701_100330491 290
324 3300005441 Ga0070700_100045225 Ga0070700_1000452252 290
325 3300005444 Ga0070694_100227565 Ga0070694_1002275652 290
326 3300005457 Ga0070662_100365252 Ga0070662_1003652521 290
327 3300005458 Ga0070681_10010799 Ga0070681_100107994 290
328 3300005458 Ga0070681_10070649 Ga0070681_100706494 290
329 3300005530 Ga0070679_100003898 Ga0070679_1000038989 290
330 3300005530 Ga0070679_100010795 Ga0070679_1000107956 290
331 3300005544 Ga0070686_100065750 Ga0070686_1000657502 290
332 3300005548 Ga0070665_100061093 Ga0070665_1000610932 290
333 3300005548 Ga0070665_100158076 Ga0070665_1001580762 290
334 3300005549 Ga0070704_100004741 Ga0070704_1000047417 290
335 3300005564 Ga0070664_100000788 Ga0070664_10000078814 290
336 3300005614 Ga0068856_100081299 Ga0068856_1000812993 290
337 3300005617 Ga0068859_100001667 Ga0068859_10000166713 290
338 3300005617 Ga0068859_100070620 Ga0068859_1000706202 290
339 3300005617 Ga0068859_100133799 Ga0068859_1001337993 290
340 3300005618 Ga0068864_100005452 Ga0068864_10000545210 290
341 3300005718 Ga0068866_10117078 Ga0068866_101170782 290
342 3300005834 Ga0068851_10027023 Ga0068851_100270232 290
343 3300005841 Ga0068863_100002053 Ga0068863_1000020532 290
344 3300005841 Ga0068863_100037128 Ga0068863_1000371282 290
345 3300005842 Ga0068858_100000238 Ga0068858_10000023820 290
346 3300005842 Ga0068858_100013228 Ga0068858_1000132286 290
347 3300005843 Ga0068860_100000873 Ga0068860_10000087326 290
348 3300005843 Ga0068860_100009657 Ga0068860_1000096573 290
349 3300005844 Ga0068862_100046333 Ga0068862_1000463333 290
350 3300006175 Ga0070712_100015939 Ga0070712_1000159393 290
351 3300006175 Ga0070712_100212332 Ga0070712_1002123322 290
352 3300006237 Ga0097621_100029117 Ga0097621_1000291176 290
353 3300006237 Ga0097621_100109888 Ga0097621_1001098882 290
354 3300006358 Ga0068871_100026980 Ga0068871_1000269804 290
355 3300006844 Ga0075428_100003594 Ga0075428_10000359417 290
356 3300006852 Ga0075433_10073215 Ga0075433_100732153 290
357 3300006881 Ga0068865_100364810 Ga0068865_1003648102 290
358 3300006931 Ga0097620_100001667 Ga0097620_1000016675 290
359 3300006931 Ga0097620_100070621 Ga0097620_1000706215 290
360 3300006931 Ga0097620_100133812 Ga0097620_1001338123 290
361 3300007076 Ga0075435_100173668 Ga0075435_1001736682 290
362 3300009093 Ga0105240_10001667 Ga0105240_100016677 290
363 3300009093 Ga0105240_10011070 Ga0105240_100110703 290
364 3300009093 Ga0105240_10022406 Ga0105240_100224067 290
365 3300009093 Ga0105240_10031951 Ga0105240_100319514 290
366 3300009101 Ga0105247_10000162 Ga0105247_1000016251 290
367 3300009177 Ga0105248_10023489 Ga0105248_100234895 290
368 3300009551 Ga0105238_10005467 Ga0105238_1000546712 290
369 3300009551 Ga0105238_10067312 Ga0105238_100673122 290
370 3300009551 Ga0105238_10474463 Ga0105238_104744631 290
371 3300009553 Ga0105249_10017725 Ga0105249_100177257 290
372 3300010375 Ga0105239_10043360 Ga0105239_100433605 290
373 3300013104 Ga0157370_10002946 Ga0157370_100029468 290
374 3300013105 Ga0157369_10010329 Ga0157369_100103293 290
375 3300013105 Ga0157369_10176136 Ga0157369_101761363 290
376 3300013306 Ga0163162_10026604 Ga0163162_100266042 290
377 3300014968 Ga0157379_10003779 Ga0157379_100037796 290
378 3300020082 Ga0206353_10573776 Ga0206353_105737763 290
379 3300025321 Ga0207656_10068118 Ga0207656_100681182 290
380 3300025899 Ga0207642_10085337 Ga0207642_100853371 290
381 3300025903 Ga0207680_10031331 Ga0207680_100313313 290
382 3300025903 Ga0207680_10036047 Ga0207680_100360472 290
383 3300025912 Ga0207707_10000035 Ga0207707_1000003577 290
384 3300025912 Ga0207707_10000591 Ga0207707_100005913 290
385 3300025912 Ga0207707_10073754 Ga0207707_100737542 290
386 3300025913 Ga0207695_10003010 Ga0207695_1000301018 290
387 3300025913 Ga0207695_10018181 Ga0207695_100181816 290
388 3300025913 Ga0207695_10034578 Ga0207695_100345782 290
389 3300025913 Ga0207695_10048033 Ga0207695_100480332 290
390 3300025913 Ga0207695_10135433 Ga0207695_101354333 290
391 3300025914 Ga0207671_10250392 Ga0207671_102503921 290
392 3300025915 Ga0207693_10012278 Ga0207693_100122785 290
393 3300025917 Ga0207660_10098037 Ga0207660_100980372 290
394 3300025920 Ga0207649_10069913 Ga0207649_100699132 290
395 3300025921 Ga0207652_10001126 Ga0207652_1000112614 290
396 3300025921 Ga0207652_10051036 Ga0207652_100510362 290
397 3300025925 Ga0207650_10207764 Ga0207650_102077642 290
398 3300025931 Ga0207644_10001361 Ga0207644_100013619 290
399 3300025931 Ga0207644_10018233 Ga0207644_100182334 290
400 3300025931 Ga0207644_10146280 Ga0207644_101462802 290
401 3300025936 Ga0207670_10026864 Ga0207670_100268643 290
402 3300025941 Ga0207711_10032731 Ga0207711_100327314 290
403 3300025944 Ga0207661_10067559 Ga0207661_100675592 290
404 3300025944 Ga0207661_10307150 Ga0207661_103071502 290
405 3300025944 Ga0207661_10386486 Ga0207661_103864862 290
406 3300025945 Ga0207679_10263788 Ga0207679_102637882 290
407 3300025949 Ga0207667_10029840 Ga0207667_100298406 290
408 3300025960 Ga0207651_10010884 Ga0207651_100108842 290
409 3300025961 Ga0207712_10087398 Ga0207712_100873983 290
410 3300025981 Ga0207640_10198793 Ga0207640_101987932 290
411 3300025986 Ga0207658_10109291 Ga0207658_101092912 290
412 3300026035 Ga0207703_10002163 Ga0207703_100021632 290
413 3300026035 Ga0207703_10021905 Ga0207703_100219053 290
414 3300026041 Ga0207639_10118330 Ga0207639_101183303 290
415 3300026075 Ga0207708_10003419 Ga0207708_100034193 290
416 3300026078 Ga0207702_10179529 Ga0207702_101795293 290
417 3300026078 Ga0207702_10443839 Ga0207702_104438392 290
418 3300026088 Ga0207641_10001356 Ga0207641_1000135620 290
419 3300026088 Ga0207641_10005349 Ga0207641_1000534910 290
420 3300026088 Ga0207641_10137396 Ga0207641_101373962 290
421 3300026089 Ga0207648_10077413 Ga0207648_100774133 290
422 3300026095 Ga0207676_10255772 Ga0207676_102557722 290
423 3300026116 Ga0207674_10371176 Ga0207674_103711762 290
424 3300026118 Ga0207675_100006894 Ga0207675_10000689411 290
425 3300027907 Ga0207428_10137560 Ga0207428_101375602 290
426 3300028379 Ga0268266_10024820 Ga0268266_100248206 290
427 3300028379 Ga0268266_10175956 Ga0268266_101759562 290
428 3300028381 Ga0268264_10000774 Ga0268264_100007744 290
429 3300028563 Ga0265319_1009432 Ga0265319_10094322 290
430 3300028573 Ga0265334_10019300 Ga0265334_100193003 290
431 3300028577 Ga0265318_10000024 Ga0265318_10000024131 290
432 3300028577 Ga0265318_10047125 Ga0265318_100471252 290
433 3300028800 Ga0265338_10052060 Ga0265338_100520602 290
434 3300028800 Ga0265338_10085922 Ga0265338_100859222 290
435 3300031235 Ga0265330_10012913 Ga0265330_100129134 290
436 3300031238 Ga0265332_10002113 Ga0265332_1000211311 290
437 3300031238 Ga0265332_10076060 Ga0265332_100760602 290
438 3300031239 Ga0265328_10007361 Ga0265328_100073612 290
439 3300031240 Ga0265320_10000217 Ga0265320_1000021713 290
440 3300031240 Ga0265320_10015499 Ga0265320_100154995 290
441 3300031241 Ga0265325_10015830 Ga0265325_100158305 290
442 3300031242 Ga0265329_10020127 Ga0265329_100201272 290
443 3300031249 Ga0265339_10045137 Ga0265339_100451372 290
444 3300031250 Ga0265331_10011346 Ga0265331_100113464 290
445 3300031344 Ga0265316_10018256 Ga0265316_100182563 290
446 3300031595 Ga0265313_10017080 Ga0265313_100170805 290
447 3300031711 Ga0265314_10090066 Ga0265314_100900661 290
448 3300031712 Ga0265342_10009081 Ga0265342_100090819 290
449 3300031731 Ga0307405_10466995 Ga0307405_104669951 290
450 3300032002 Ga0307416_100030772 Ga0307416_1000307722 290
451 3300035398 Ga0316574_0191623 Ga0316574_0191623_162_1037 290
452 3300036459 Ga0372808_015607 Ga0372808_015607_168_1046 290
453 3300037853 Ga0436364_0376956 Ga0436364_0376956_58_936 290
454 3300044656 Ga0466969_0004139 Ga0466969_0004139_5751_6632 290
455 3300044656 Ga0466969_0091609 Ga0466969_0091609_304_1185 290
456 3300044684 Ga0466966_0006317 Ga0466966_0006317_2917_3798 290
457 3300044684 Ga0466966_0025325 Ga0466966_0025325_2620_3501 290
458 3300045049 Ga0466959_0024043 Ga0466959_0024043_654_1532 290
459 3300046535 Ga0495586_0129868 Ga0495586_0129868_494_1375 290
460 3300047322 Ga0495680_0158401 Ga0495680_0158401_259_1140 290
461 3300048910 Ga0496107_0110724 Ga0496107_0110724_419_1351 290
462 3300048915 Ga0496112_0167092 Ga0496112_0167092_272_1165 290
463 3300049571 Ga0501034_0318566 Ga0501034_0318566_247_1131 290
464 3300049573 Ga0501037_0330198 Ga0501037_0330198_126_1010 290
465 3300049578 Ga0501042_0091857 Ga0501042_0091857_375_1277 290
466 3300049580 Ga0501046_0072937 Ga0501046_0072937_132_1016 290
467 3300049587 Ga0501071_0029311 Ga0501071_0029311_2909_3811 290
468 3300049592 Ga0501076_0065989 Ga0501076_0065989_1603_2505 290
469 3300049741 Ga0501079_0014922 Ga0501079_0014922_1080_1982 290
470 3300049743 Ga0501081_0029081 Ga0501081_0029081_397_1299 290
471 3300049822 Ga0501035_0191530 Ga0501035_0191530_690_1592 290
472 3300049824 Ga0501045_0382581 Ga0501045_0382581_128_1030 290
473 3300053095 Ga0500640_000036 Ga0500640_000036_3672_4607 290
474 3300053111 Ga0500572_002914 Ga0500572_002914_824_1759 290
475 3300053115 Ga0500591_063635 Ga0500591_063635_206_1141 290
476 3300053123 Ga0500614_000846 Ga0500614_000846_3667_4602 290
477 3300053150 Ga0500603_000195 Ga0500603_000195_6905_7840 290
478 3300053159 Ga0500630_001646 Ga0500630_001646_904_1839 290
479 3300053162 Ga0500638_072606 Ga0500638_072606_380_1315 290
480 3300053163 Ga0500639_000170 Ga0500639_000170_7862_8797 290
481 3300053178 Ga0500637_0060065 Ga0500637_0060065_630_1559 290
482 3300053735 Ga0500596_000047 Ga0500596_000047_13836_14771 290
483 3300053737 Ga0500601_001015 Ga0500601_001015_1098_2033 290
484 3300005468 Ga0070707_100008500 Ga0070707_1000085004 291
485 3300005577 Ga0068857_100341291 Ga0068857_1003412912 291
486 3300014326 Ga0157380_10346442 Ga0157380_103464421 291
487 3300025922 Ga0207646_10016170 Ga0207646_100161706 291
488 3300028379 Ga0268266_10372364 Ga0268266_103723641 291
489 3300046471 Ga0495650_0068414 Ga0495650_0068414_131_1015 291
490 3300046506 Ga0495583_0163042 Ga0495583_0163042_12_896 291
491 3300053092 Ga0500583_0055179 Ga0500583_0055179_372_1256 291
492 3300053119 Ga0500595_018830 Ga0500595_018830_300_1178 291
493 3300053153 Ga0500616_0000030 Ga0500616_0000030_277922_278806 291
494 3300053153 Ga0500616_0013131 Ga0500616_0013131_104_988 291
495 3300005458 Ga0070681_10001127 Ga0070681_1000112714 292
496 3300005530 Ga0070679_100073215 Ga0070679_1000732154 292
497 3300009093 Ga0105240_10090783 Ga0105240_100907834 292
498 3300013104 Ga0157370_10013826 Ga0157370_100138263 292
499 3300013307 Ga0157372_10109273 Ga0157372_101092732 292
500 3300025912 Ga0207707_10006531 Ga0207707_100065314 292
501 3300025981 Ga0207640_10342488 Ga0207640_103424882 292
502 3300037418 Ga0395900_0017250 Ga0395900_0017250_5896_6795 292
503 3300037466 Ga0395898_0055931 Ga0395898_0055931_1974_2873 292
504 3300037471 Ga0395905_0012722 Ga0395905_0012722_883_1782 292
505 3300037471 Ga0395905_0216948 Ga0395905_0216948_176_1075 292
506 3300037471 Ga0395905_0245308 Ga0395905_0245308_506_1405 292
507 3300049569 Ga0501032_0183893 Ga0501032_0183893_134_1123 292
508 3300049573 Ga0501037_0260410 Ga0501037_0260410_64_1026 292
509 3300049574 Ga0501038_0040317 Ga0501038_0040317_2325_3314 292
510 3300049575 Ga0501039_0070861 Ga0501039_0070861_177_1139 292
511 3300049576 Ga0501040_0083076 Ga0501040_0083076_355_1344 292
512 3300049579 Ga0501043_0277632 Ga0501043_0277632_13_1002 292
513 3300049580 Ga0501046_0094467 Ga0501046_0094467_279_1241 292
514 3300049582 Ga0501048_0294911 Ga0501048_0294911_98_1087 292
515 3300049584 Ga0501068_0206206 Ga0501068_0206206_177_1139 292
516 3300049586 Ga0501070_0080845 Ga0501070_0080845_1487_2365 292
517 3300049587 Ga0501071_0021725 Ga0501071_0021725_2426_3388 292
518 3300049588 Ga0501072_0061211 Ga0501072_0061211_1092_2084 292
519 3300049589 Ga0501073_0114285 Ga0501073_0114285_743_1705 292
520 3300049589 Ga0501073_0116143 Ga0501073_0116143_843_1832 292
521 3300049591 Ga0501075_0030184 Ga0501075_0030184_246_1235 292
522 3300049591 Ga0501075_0158123 Ga0501075_0158123_189_1151 292
523 3300049592 Ga0501076_0041955 Ga0501076_0041955_1575_2537 292
524 3300049593 Ga0501077_0022632 Ga0501077_0022632_892_1881 292
525 3300049822 Ga0501035_0345146 Ga0501035_0345146_33_995 292
526 3300049824 Ga0501045_0030226 Ga0501045_0030226_1608_2570 292
527 3300054114 Ga0501084_0085989 Ga0501084_0085989_568_1530 292
528 3300060353 Ga0501082_0046675 Ga0501082_0046675_2556_3545 292
529 3300061734 Ga0530510_0093780 Ga0530510_0093780_862_1851 292
530 3300061734 Ga0530510_0109437 Ga0530510_0109437_894_1856 292
531 3300044656 Ga0466969_0001888 Ga0466969_0001888_7321_8397 293
532 3300044684 Ga0466966_0024109 Ga0466966_0024109_1616_2692 293
533 3300044693 Ga0466961_0008054 Ga0466961_0008054_683_1759 293
534 3300044706 Ga0466964_0001512 Ga0466964_0001512_3803_4879 293
535 3300044719 Ga0466971_0001325 Ga0466971_0001325_8852_9928 293
536 3300044842 Ga0466957_0013671 Ga0466957_0013671_531_1607 293
537 3300045049 Ga0466959_0006379 Ga0466959_0006379_5383_6459 293
538 3300053096 Ga0500641_0028444 Ga0500641_0028444_349_1248 293
539 3300061719 Ga0466962_0003099 Ga0466962_0003099_4166_5242 293
540 3300005445 Ga0070708_100194917 Ga0070708_1001949172 294
541 3300005467 Ga0070706_100012692 Ga0070706_1000126923 294
542 3300005468 Ga0070707_100102262 Ga0070707_1001022622 294
543 3300005471 Ga0070698_100084672 Ga0070698_1000846722 294
544 3300005616 Ga0068852_100389335 Ga0068852_1003893351 294
545 3300025910 Ga0207684_10013597 Ga0207684_100135977 294
546 3300028666 Ga0265336_10004397 Ga0265336_100043975 294
547 3300028800 Ga0265338_10007488 Ga0265338_100074885 294
548 3300046460 Ga0495638_0000209 Ga0495638_0000209_65380_66267 294
549 3300047472 Ga0495686_0038541 Ga0495686_0038541_1126_2013 294
550 3300053096 Ga0500641_0011113 Ga0500641_0011113_813_1706 294
551 3300002075 JGI24738J21930_10003008 JGI24738J21930_100030082 295
552 3300005467 Ga0070706_100017917 Ga0070706_1000179173 295
553 3300005563 Ga0068855_100034599 Ga0068855_1000345992 295
554 3300005577 Ga0068857_100105348 Ga0068857_1001053483 295
555 3300005578 Ga0068854_100014686 Ga0068854_1000146864 295
556 3300005614 Ga0068856_100005115 Ga0068856_10000511513 295
557 3300005616 Ga0068852_100000919 Ga0068852_1000009191 295
558 3300009093 Ga0105240_10153053 Ga0105240_101530533 295
559 3300009551 Ga0105238_10043549 Ga0105238_100435494 295
560 3300025904 Ga0207647_10007751 Ga0207647_100077514 295
561 3300025913 Ga0207695_10008455 Ga0207695_100084554 295
562 3300025949 Ga0207667_10008858 Ga0207667_100088584 295
563 3300025981 Ga0207640_10001341 Ga0207640_100013414 295
564 3300026078 Ga0207702_10004976 Ga0207702_1000497613 295
565 3300026116 Ga0207674_10008204 Ga0207674_100082044 295
566 3300026142 Ga0207698_10000019 Ga0207698_1000001918 295
567 3300031731 Ga0307405_10190907 Ga0307405_101909071 295
568 3300031911 Ga0307412_10006032 Ga0307412_100060322 295
569 3300049758 Ga0501241_002928 Ga0501241_002928_2176_3087 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04909

Amidohydro_2

Amidohydrolase

58

322

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4di9-assembly1.cif.gz_A crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 6.5 0.9861 4 292
4d8l-assembly1.cif.gz_A crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis 0.9801 6 292
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.9754 4 292
4dia-assembly1.cif.gz_A crystal structure of the d248n mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 4.6 0.962 4 292
4d8l-assembly1.cif.gz_A crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis 0.957 6 292
ID Description Score Start End Superfamily
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9816 2 292 3.20.20.140
4d95A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9716 2 292 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.888 19 290 3.20.20.140
4mupC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8697 19 290 3.20.20.140
4i6kA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.8645 26 290 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A432JVJ7-F1-model_v4 deleted 0.9987 12 98
AF-A0A358D5D1-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.998 12 126 GO:0016787
AF-A0A3C0Y2J4-F1-model_v4 Amidohydrolase 0.9961 8 100 GO:0016787
AF-A0A1L6JAZ3-F1-model_v4 2-pyrone-4,6-dicarboxylate hydrolase 0.9949 2 292 GO:0016787
AF-X1G355-F1-model_v4 Amidohydrolase-related domain-containing protein 0.991 35 172 GO:0016787

Feature Viewer

pLDDT pTM Quality
95.23 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map