F464765

General Info

Members Datasets Scaffolds Average Seq Length
569 426 426 227

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0097875|Ga0496121_0097875_1237_1842
Length 201
Sequence MTEAAAERPSLRGRFITFEGGEGSGKSTQIRKLAERLDAAKLRAIVTREPGGSPGAEIIRHLVLSGMGKLLGPDAETLLFAAARDDHVRTVILPALNQGIWVLCDRFFDSTRAYQGQLDVPVEVGLQRAAARRGDATADRFEAEGIKFHQDLREAYQRIAAEDPQRCVLIDATADPDTVAGRIWAALREHLRSTFTADSPA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
13 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
16 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
23 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
24 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
25 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
26 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
27 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
28 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
29 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
30 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
31 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
32 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
33 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
34 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
35 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
36 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
37 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
38 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
39 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
40 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
41 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
42 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
43 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
44 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
45 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
46 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
47 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
48 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
49 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
50 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
51 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
52 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
53 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
54 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
55 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
56 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
59 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
60 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
61 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
62 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
63 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
64 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
65 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
66 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
67 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
68 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
69 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
70 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
71 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
72 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
73 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
74 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
75 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
76 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
77 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
78 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
79 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
80 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
81 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
82 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
83 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
84 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
85 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
86 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
87 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
88 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
89 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
90 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
91 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
92 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
93 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
94 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
95 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
96 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
97 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
98 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
99 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
100 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
101 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
102 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
103 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
104 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
105 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
106 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
107 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
108 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
109 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
110 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
111 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
112 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
113 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
114 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
115 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
116 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
117 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
118 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
119 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
120 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
121 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
122 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
123 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
124 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
125 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
126 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
127 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
128 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
129 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
130 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
131 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
132 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
133 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
134 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
135 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
136 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
140 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
148 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
149 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
150 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
151 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
152 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
155 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
156 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
157 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
160 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
168 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
169 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
170 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
171 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
172 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
175 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
176 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
177 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
178 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
179 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
180 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
216 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
217 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
218 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
219 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
245 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
368 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
375 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
376 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
377 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
378 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
379 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
380 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
381 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
382 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
383 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
384 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
385 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
392 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
393 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
396 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
401 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
402 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
403 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
404 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
405 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
406 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
407 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
408 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
409 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
410 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
411 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
412 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
413 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
414 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
415 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
416 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
417 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
418 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
419 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
420 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
421 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
422 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
423 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
424 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
425 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
426 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.27
Metatranscriptomes 0
Isolates 24.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.48
Nodule 18.8
Rhizoplane 7.56
Rhizosphere 49.21
Stem 0
Stem Tuber 0
Unclassified 11.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000004 3300003203 Bacteria 149772
2 JGI25153J46596_10007377 3300003215 Bacteria 5421
3 rootH2_10026632 3300003320 Bacteria 1037
4 JGI25160J50197_1002741 3300003354 Bacteria 8085
5 Ga0055531_10009470 3300003794 Bacteria 4975
6 Ga0065165_1000435 3300005262 Bacteria 65756
7 Ga0065165_1011997 3300005262 Bacteria 3561
8 Ga0070658_10077697 3300005327 Bacteria 2723
9 Ga0070676_10025156 3300005328 Bacteria 3362
10 Ga0070670_100458234 3300005331 Bacteria 1131
11 Ga0070666_10364212 3300005335 Bacteria 1036
12 Ga0070682_100085840 3300005337 Bacteria 2048
13 Ga0070687_100274155 3300005343 Bacteria 1059
14 Ga0070661_100049681 3300005344 Bacteria 3071
15 Ga0070675_100171626 3300005354 Bacteria 1870
16 Ga0070659_100407998 3300005366 Bacteria 1148
17 Ga0070714_100431734 3300005435 Bacteria 1249
18 Ga0070713_100005205 3300005436 Bacteria 8859
19 Ga0070713_101013794 3300005436 Bacteria 801
20 Ga0070710_10004671 3300005437 Bacteria 6478
21 Ga0070663_100152010 3300005455 Bacteria 1776
22 Ga0070663_100412267 3300005455 Bacteria 1106
23 Ga0070678_100678398 3300005456 Bacteria 926
24 Ga0070698_100336952 3300005471 Bacteria 1440
25 Ga0068853_100217134 3300005539 Bacteria 1745
26 Ga0068853_100384823 3300005539 Bacteria 1311
27 Ga0070665_100113799 3300005548 Bacteria 2708
28 Ga0070665_100266138 3300005548 Bacteria 1716
29 Ga0070665_100293077 3300005548 Bacteria 1629
30 Ga0070665_100432897 3300005548 Bacteria 1324
31 Ga0068855_100153318 3300005563 Bacteria 2619
32 Ga0070664_100483579 3300005564 Bacteria 1139
33 Ga0068857_100088782 3300005577 Bacteria 2766
34 Ga0068856_100020962 3300005614 Bacteria 6351
35 Ga0068852_100052999 3300005616 Bacteria 3490
36 Ga0068852_100196056 3300005616 Bacteria 1908
37 Ga0068861_100147185 3300005719 Bacteria 1928
38 Ga0068861_100815800 3300005719 Bacteria 877
39 Ga0068870_10444016 3300005840 Bacteria 854
40 Ga0068863_100321690 3300005841 Bacteria 1503
41 Ga0068863_100593115 3300005841 Bacteria 1096
42 Ga0068858_100179490 3300005842 Bacteria 1998
43 Ga0068858_100202284 3300005842 Bacteria 1878
44 Ga0068862_100164855 3300005844 Bacteria 1980
45 Ga0081540_1002798 3300005983 Bacteria 14141
46 Ga0081539_10000080 3300005985 Bacteria 222745
47 Ga0081539_10030484 3300005985 Bacteria 3346
48 Ga0081539_10064174 3300005985 Bacteria 2000
49 Ga0070717_10094917 3300006028 Bacteria 2524
50 Ga0075365_10107920 3300006038 Bacteria 1911
51 Ga0075368_10020559 3300006042 Bacteria 2501
52 Ga0075364_10276958 3300006051 Bacteria 1141
53 Ga0070715_10007314 3300006163 Bacteria 3798
54 Ga0070716_100015184 3300006173 Bacteria 3952
55 Ga0070716_100250218 3300006173 Bacteria 1207
56 Ga0070712_100007796 3300006175 Bacteria 6702
57 Ga0070712_100420120 3300006175 Bacteria 1108
58 Ga0075367_10042634 3300006178 Bacteria 2656
59 Ga0075366_10058309 3300006195 Bacteria 2293
60 Ga0075366_10206750 3300006195 Bacteria 1194
61 Ga0075366_10222631 3300006195 Bacteria 1150
62 Ga0075370_10010462 3300006353 Bacteria 4852
63 Ga0075370_10060841 3300006353 Bacteria 2151
64 Ga0075370_10074957 3300006353 Bacteria 1939
65 Ga0099824_1027854 3300006942 Bacteria 2657
66 Ga0105240_10376054 3300009093 Bacteria 1605
67 Ga0105247_10039053 3300009101 Bacteria 2900
68 Ga0105247_10110304 3300009101 Bacteria 1770
69 Ga0105247_10132668 3300009101 Bacteria 1625
70 Ga0105241_10360894 3300009174 Bacteria 1264
71 Ga0105248_10234747 3300009177 Bacteria 2064
72 Ga0105248_10840445 3300009177 Bacteria 1036
73 Ga0105237_10007285 3300009545 Bacteria 12135
74 Ga0105237_10031690 3300009545 Bacteria 5354
75 Ga0105237_10107116 3300009545 Bacteria 2787
76 Ga0105237_10478088 3300009545 Bacteria 1252
77 Ga0105238_10056315 3300009551 Bacteria 3945
78 Ga0105238_11039658 3300009551 Bacteria 841
79 Ga0105239_10075990 3300010375 Bacteria 3694
80 Ga0105239_10351163 3300010375 Bacteria 1665
81 Ga0105239_10405002 3300010375 Bacteria 1544
82 Ga0105246_10047878 3300011119 Bacteria 2922
83 Ga0157314_1003922 3300012500 Bacteria 1075
84 Ga0157378_10070844 3300013297 Bacteria 3130
85 Ga0157378_10198845 3300013297 Bacteria 1895
86 Ga0163162_10115535 3300013306 Bacteria 2784
87 Ga0157372_10914876 3300013307 Bacteria 1017
88 Ga0163163_10088422 3300014325 Bacteria 3109
89 Ga0163163_10755278 3300014325 Bacteria 1036
90 Ga0157379_10556011 3300014968 Bacteria 1068
91 Ga0163161_10261546 3300017792 Bacteria 1351
92 Ga0214544_1001370 3300021320 Bacteria 50261
93 Ga0214542_1000153 3300021321 Bacteria 101854
94 Ga0214545_1000018 3300021324 Bacteria 172019
95 Ga0214543_1005445 3300021327 Bacteria 23409
96 Ga0209677_103529 3300025253 Bacteria 5008
97 Ga0209233_1003425 3300025261 Bacteria 5590
98 Ga0209233_1019951 3300025261 Bacteria 1769
99 Ga0209673_1018472 3300025273 Bacteria 2534
100 Ga0209758_1000021 3300025297 Bacteria 697691
101 Ga0209758_1000211 3300025297 Bacteria 127721
102 Ga0209758_1006738 3300025297 Bacteria 8082
103 Ga0209758_1019966 3300025297 Bacteria 3198
104 Ga0207426_1004377 3300025302 Bacteria 6929
105 Ga0207426_1012187 3300025302 Bacteria 3241
106 Ga0209257_1008824 3300025304 Bacteria 5579
107 Ga0209257_1014097 3300025304 Bacteria 3472
108 Ga0207692_10011132 3300025898 Bacteria 3813
109 Ga0207647_10002611 3300025904 Bacteria 13619
110 Ga0207685_10017068 3300025905 Bacteria 2338
111 Ga0207699_10012020 3300025906 Bacteria 4393
112 Ga0207705_10057685 3300025909 Bacteria 2800
113 Ga0207705_10122063 3300025909 Bacteria 1934
114 Ga0207671_10022626 3300025914 Bacteria 4748
115 Ga0207671_10163325 3300025914 Bacteria 1726
116 Ga0207671_10260732 3300025914 Bacteria 1364
117 Ga0207693_10002655 3300025915 Bacteria 15538
118 Ga0207663_10002699 3300025916 Bacteria 8560
119 Ga0207662_10186695 3300025918 Bacteria 1336
120 Ga0207657_10106111 3300025919 Bacteria 2325
121 Ga0207649_10080147 3300025920 Bacteria 2111
122 Ga0207694_10565215 3300025924 Bacteria 955
123 Ga0207659_10305961 3300025926 Bacteria 1307
124 Ga0207700_10025335 3300025928 Bacteria 4117
125 Ga0207664_10020349 3300025929 Bacteria 4917
126 Ga0207664_10288779 3300025929 Bacteria 1441
127 Ga0207644_10064026 3300025931 Bacteria 2671
128 Ga0207706_10060148 3300025933 Bacteria 3346
129 Ga0207709_10121510 3300025935 Bacteria 1764
130 Ga0207665_10001529 3300025939 Bacteria 15562
131 Ga0207667_10580977 3300025949 Bacteria 1131
132 Ga0207640_10203949 3300025981 Bacteria 1501
133 Ga0207658_10074115 3300025986 Bacteria 2586
134 Ga0207703_10207725 3300026035 Bacteria 1744
135 Ga0207703_10405533 3300026035 Bacteria 1265
136 Ga0207639_10611015 3300026041 Bacteria 1006
137 Ga0207678_10040313 3300026067 Bacteria 4051
138 Ga0207678_10498677 3300026067 Bacteria 1061
139 Ga0207702_10302804 3300026078 Bacteria 1517
140 Ga0207641_10646000 3300026088 Bacteria 1039
141 Ga0207675_100380325 3300026118 Bacteria 1388
142 Ga0207675_100940720 3300026118 Bacteria 881
143 Ga0207698_10348895 3300026142 Bacteria 1397
144 Ga0207698_10659110 3300026142 Bacteria 1037
145 Ga0209389_1000495 3300027296 Bacteria 23648
146 Ga0209589_1000072 3300027357 Bacteria 98789
147 Ga0209489_100031 3300027361 Bacteria 184074
148 Ga0209813_10040665 3300027866 Bacteria 1414
149 Ga0268266_10016444 3300028379 Bacteria 6323
150 Ga0268266_10126801 3300028379 Bacteria 2279
151 Ga0268266_10224646 3300028379 Bacteria 1727
152 Ga0268266_10322331 3300028379 Bacteria 1446
153 Ga0268266_10418050 3300028379 Bacteria 1270
154 Ga0268266_10419759 3300028379 Bacteria 1267
155 Ga0268265_10530671 3300028380 Bacteria 1114
156 Ga0268265_10730839 3300028380 Bacteria 959
157 Ga0268264_11215916 3300028381 Bacteria 763
158 Ga0307513_10345631 3300031456 Bacteria 1237
159 Ga0307516_10436186 3300031730 Bacteria 967
160 Ga0307405_10460782 3300031731 Bacteria 1010
161 Ga0307413_10103301 3300031824 Bacteria 1889
162 Ga0307410_10780919 3300031852 Bacteria 811
163 Ga0307409_100282604 3300031995 Bacteria 1535
164 Ga0307409_100466353 3300031995 Bacteria 1222
165 Ga0307411_10533915 3300032005 Bacteria 998
166 Ga0307415_100240509 3300032126 Bacteria 1464
167 Ga0307510_10042971 3300033180 Bacteria 4917
168 Ga0315911_1000001 3300033442 Bacteria 1088602
169 Ga0373936_0006070 3300035113 Bacteria 4552
170 Ga0373936_0141525 3300035113 Bacteria 1039
171 Ga0373945_0015147 3300035116 Bacteria 2592
172 Ga0373954_0024565 3300035118 Bacteria 2748
173 Ga0373935_0009202 3300035692 Bacteria 5912
174 Ga0373927_0201066 3300035695 Bacteria 1308
175 Ga0373937_0049573 3300036401 Bacteria 3845
176 Ga0373925_0006309 3300037068 Bacteria 8734
177 Ga0395899_0801852 3300037312 Bacteria 582
178 Ga0395905_0040435 3300037471 Bacteria 4374
179 Ga0395901_0173823 3300038443 Bacteria 2260
180 Ga0451787_239584 3300041441 Bacteria 828
181 Ga0451793_1082569 3300041452 Bacteria 893
182 Ga0451793_1166649 3300041452 Bacteria 2829
183 Ga0451798_0180606 3300041458 Bacteria 1191
184 Ga0439448_0105831 3300042005 Bacteria 959
185 Ga0466972_0000188 3300044658 Bacteria 47766
186 Ga0466972_0001486 3300044658 Bacteria 11399
187 Ga0466972_0053744 3300044658 Bacteria 1939
188 Ga0466972_0188089 3300044658 Bacteria 968
189 Ga0466971_0265095 3300044719 Bacteria 820
190 Ga0466968_0008336 3300044735 Bacteria 3967
191 Ga0466970_0053067 3300044765 Bacteria 2165
192 Ga0466970_0125112 3300044765 Bacteria 1410
193 Ga0466957_0287156 3300044842 Bacteria 1102
194 Ga0466960_0017846 3300044901 Bacteria 3102
195 Ga0466960_0106207 3300044901 Bacteria 1452
196 Ga0495592_0139834 3300046454 Bacteria 1685
197 Ga0495592_0276179 3300046454 Bacteria 1100
198 Ga0495603_0000160 3300046455 Bacteria 33986
199 Ga0495603_0008023 3300046455 Bacteria 6375
200 Ga0495603_0019910 3300046455 Bacteria 4064
201 Ga0495603_0310753 3300046455 Bacteria 905
202 Ga0495590_0036012 3300046457 Bacteria 1726
203 Ga0495629_0000155 3300046459 Bacteria 60057
204 Ga0495641_0007890 3300046461 Bacteria 6574
205 Ga0495651_0010063 3300046462 Bacteria 7265
206 Ga0495653_0072411 3300046463 Bacteria 2573
207 Ga0495580_0009027 3300046472 Bacteria 7871
208 Ga0495580_0165291 3300046472 Bacteria 1531
209 Ga0495582_0000866 3300046473 Bacteria 16777
210 Ga0495582_0296021 3300046473 Bacteria 930
211 Ga0495605_0057604 3300046474 Bacteria 1869
212 Ga0495662_0104931 3300046476 Bacteria 1383
213 Ga0495664_0006573 3300046477 Bacteria 6425
214 Ga0495664_0036827 3300046477 Bacteria 2885
215 Ga0495664_0120328 3300046477 Bacteria 1588
216 Ga0495585_0069735 3300046492 Bacteria 1918
217 Ga0495585_0079428 3300046492 Bacteria 1779
218 Ga0495585_0092686 3300046492 Bacteria 1625
219 Ga0495594_0000042 3300046499 Bacteria 55641
220 Ga0495606_0002525 3300046507 Bacteria 21061
221 Ga0495606_0236335 3300046507 Bacteria 1021
222 Ga0495606_0357268 3300046507 Bacteria 773
223 Ga0495608_0087971 3300046511 Bacteria 2011
224 Ga0495610_0048264 3300046512 Bacteria 2091
225 Ga0495616_0040710 3300046513 Bacteria 2372
226 Ga0495618_0176302 3300046514 Bacteria 1359
227 Ga0495628_0166273 3300046516 Bacteria 1674
228 Ga0495632_0047252 3300046519 Bacteria 2135
229 Ga0495643_0027359 3300046522 Bacteria 3206
230 Ga0495643_0233088 3300046522 Bacteria 867
231 Ga0495644_0122832 3300046523 Bacteria 988
232 Ga0495648_0124268 3300046524 Bacteria 1381
233 Ga0495642_0049692 3300046528 Bacteria 1723
234 Ga0495642_0099958 3300046528 Bacteria 1234
235 Ga0495652_0050583 3300046529 Bacteria 3552
236 Ga0495652_0208197 3300046529 Bacteria 1479
237 Ga0495654_0074481 3300046530 Bacteria 1603
238 Ga0495665_0002439 3300046531 Bacteria 10048
239 Ga0495640_0007997 3300046533 Bacteria 8311
240 Ga0495640_0036750 3300046533 Bacteria 3458
241 Ga0495598_0013678 3300046537 Bacteria 2017
242 Ga0495598_0047481 3300046537 Bacteria 1280
243 Ga0495609_0020159 3300046538 Bacteria 3081
244 Ga0495597_0045794 3300046542 Bacteria 1940
245 Ga0495645_0159849 3300046543 Bacteria 1558
246 Ga0495622_0003165 3300046557 Bacteria 7793
247 Ga0495622_0059705 3300046557 Bacteria 1765
248 Ga0495633_0055335 3300046558 Bacteria 1865
249 Ga0495667_0007085 3300046559 Bacteria 7606
250 Ga0495656_0025218 3300046615 Bacteria 2355
251 Ga0495634_0000798 3300046642 Bacteria 30556
252 Ga0495634_0081679 3300046642 Bacteria 2113
253 Ga0495635_0003922 3300046663 Bacteria 10342
254 Ga0495661_0233630 3300046665 Bacteria 947
255 Ga0495588_0005942 3300046674 Bacteria 5471
256 Ga0495588_0075666 3300046674 Bacteria 1754
257 Ga0495657_0002141 3300046675 Bacteria 16768
258 Ga0495623_0007037 3300046679 Bacteria 7309
259 Ga0495647_0000396 3300046681 Bacteria 12448
260 Ga0495658_0000434 3300046683 Bacteria 23322
261 Ga0495669_0056752 3300046684 Bacteria 1765
262 Ga0495669_0157432 3300046684 Bacteria 1077
263 Ga0495613_0090928 3300046689 Bacteria 2210
264 Ga0495613_0428972 3300046689 Bacteria 898
265 Ga0495624_0002112 3300046690 Bacteria 15160
266 Ga0495589_0162725 3300046794 Bacteria 1063
267 Ga0495589_0162766 3300046794 Bacteria 1062
268 Ga0495581_0000239 3300047315 Bacteria 26032
269 Ga0495581_0273387 3300047315 Bacteria 988
270 Ga0495604_0004398 3300047317 Bacteria 11154
271 Ga0495604_0139204 3300047317 Bacteria 1736
272 Ga0495674_0001352 3300047319 Bacteria 23898
273 Ga0495674_0041024 3300047319 Bacteria 4137
274 Ga0495672_0078633 3300047320 Bacteria 1844
275 Ga0495676_0054226 3300047321 Bacteria 3188
276 Ga0495680_0007089 3300047322 Bacteria 10322
277 Ga0495687_032219 3300047443 Bacteria 2395
278 Ga0495675_0007985 3300047444 Bacteria 6546
279 Ga0495681_0071270 3300047470 Bacteria 1574
280 Ga0495684_0001910 3300047471 Bacteria 16717
281 Ga0495593_0000013 3300047673 Bacteria 82874
282 Ga0495602_0019341 3300048088 Bacteria 6764
283 Ga0495602_0298318 3300048088 Bacteria 1180
284 Ga0495626_0067469 3300048091 Bacteria 1615
285 Ga0496101_0048646 3300048904 Bacteria 3048
286 Ga0496101_0468943 3300048904 Bacteria 994
287 Ga0496102_0014768 3300048905 Bacteria 6791
288 Ga0496102_0109224 3300048905 Bacteria 2577
289 Ga0496102_0327161 3300048905 Bacteria 1444
290 Ga0496102_0451342 3300048905 Bacteria 1206
291 Ga0496103_0010689 3300048906 Bacteria 5430
292 Ga0496103_0350139 3300048906 Bacteria 950
293 Ga0496104_0059024 3300048907 Bacteria 3632
294 Ga0496104_0096243 3300048907 Bacteria 2832
295 Ga0496104_0901843 3300048907 Bacteria 789
296 Ga0496105_0106873 3300048908 Bacteria 2310
297 Ga0496105_0230021 3300048908 Bacteria 1507
298 Ga0496106_0014945 3300048909 Bacteria 5743
299 Ga0496106_0194903 3300048909 Bacteria 1611
300 Ga0496106_0343202 3300048909 Bacteria 1199
301 Ga0496106_0736687 3300048909 Bacteria 784
302 Ga0496107_0091489 3300048910 Bacteria 2223
303 Ga0496108_0028358 3300048911 Bacteria 4631
304 Ga0496108_0030420 3300048911 Bacteria 4475
305 Ga0496109_0011290 3300048912 Bacteria 7671
306 Ga0496109_0115702 3300048912 Bacteria 2495
307 Ga0496109_0718516 3300048912 Bacteria 937
308 Ga0496110_0096823 3300048913 Bacteria 2644
309 Ga0496110_0787130 3300048913 Bacteria 855
310 Ga0496111_0125393 3300048914 Bacteria 1897
311 Ga0496111_0266991 3300048914 Bacteria 1269
312 Ga0496112_0000009 3300048915 Bacteria 299708
313 Ga0496112_0025787 3300048915 Bacteria 5647
314 Ga0496112_0091026 3300048915 Bacteria 3019
315 Ga0496112_0190074 3300048915 Bacteria 2015
316 Ga0496112_0363285 3300048915 Bacteria 1389
317 Ga0496112_0829878 3300048915 Bacteria 848
318 Ga0496113_0121356 3300048916 Bacteria 2044
319 Ga0496113_0220170 3300048916 Bacteria 1512
320 Ga0496114_0079575 3300048917 Bacteria 2767
321 Ga0496115_0086316 3300048918 Bacteria 2560
322 Ga0496115_0145521 3300048918 Bacteria 1956
323 Ga0496116_0148110 3300048919 Bacteria 1309
324 Ga0496117_0113420 3300048920 Bacteria 1683
325 Ga0496117_0164358 3300048920 Bacteria 1296
326 Ga0496118_0030011 3300048921 Bacteria 4549
327 Ga0496118_0219241 3300048921 Bacteria 1109
328 Ga0496119_0135252 3300048922 Bacteria 1338
329 Ga0496119_0177963 3300048922 Bacteria 1118
330 Ga0496120_0056663 3300048923 Bacteria 2210
331 Ga0496120_0219524 3300048923 Bacteria 909
332 Ga0496121_0097875 3300048924 Bacteria 2272
333 Ga0496121_0117109 3300048924 Bacteria 2019
334 Ga0496121_0221479 3300048924 Bacteria 1332
335 Ga0496121_0359811 3300048924 Bacteria 966
336 Ga0496124_0016895 3300048927 Bacteria 6915
337 Ga0496124_0149140 3300048927 Bacteria 1837
338 Ga0496124_0405341 3300048927 Bacteria 945
339 Ga0496125_0033268 3300048928 Bacteria 4565
340 Ga0496126_0006548 3300048929 Bacteria 12967
341 Ga0496126_0055001 3300048929 Bacteria 3602
342 Ga0496126_0060317 3300048929 Bacteria 3412
343 Ga0496126_0344721 3300048929 Bacteria 1220
344 Ga0495678_047912 3300049459 Bacteria 1670
345 Ga0495682_0052111 3300049460 Bacteria 1487
346 Ga0501031_0000775 3300049568 Bacteria 19167
347 Ga0501033_0000408 3300049570 Bacteria 41114
348 Ga0501033_0006452 3300049570 Bacteria 9178
349 Ga0501034_0209552 3300049571 Bacteria 1904
350 Ga0501037_0000122 3300049573 Bacteria 72764
351 Ga0501037_0018175 3300049573 Bacteria 5179
352 Ga0501038_0007515 3300049574 Bacteria 10047
353 Ga0501038_0180304 3300049574 Bacteria 1704
354 Ga0501039_0003596 3300049575 Bacteria 11622
355 Ga0501039_0177199 3300049575 Bacteria 1676
356 Ga0501040_0349200 3300049576 Bacteria 1059
357 Ga0501041_0072044 3300049577 Bacteria 2122
358 Ga0501042_0006101 3300049578 Bacteria 7808
359 Ga0501043_0006251 3300049579 Bacteria 9562
360 Ga0501043_0240097 3300049579 Bacteria 1397
361 Ga0501046_0015190 3300049580 Bacteria 6474
362 Ga0501047_0144600 3300049581 Bacteria 2255
363 Ga0501067_0067325 3300049583 Bacteria 1982
364 Ga0501068_0019104 3300049584 Bacteria 3973
365 Ga0501069_0010603 3300049585 Bacteria 4883
366 Ga0501069_0036807 3300049585 Bacteria 2700
367 Ga0501069_0084567 3300049585 Bacteria 1790
368 Ga0501071_0067065 3300049587 Bacteria 2609
369 Ga0501073_0021482 3300049589 Bacteria 4653
370 Ga0501074_0011738 3300049590 Bacteria 6368
371 Ga0501079_0116017 3300049741 Bacteria 2081
372 Ga0501080_0828304 3300049742 Bacteria 810
373 Ga0501083_0058075 3300049744 Bacteria 2589
374 Ga0501035_0005412 3300049822 Bacteria 12068
375 Ga0501035_0027858 3300049822 Bacteria 5162
376 Ga0501035_0394303 3300049822 Bacteria 1152
377 Ga0501044_0046551 3300049823 Bacteria 4489
378 Ga0501045_0130554 3300049824 Bacteria 1867
379 nmdc:mga03683_133025_c1 3300050489 Bacteria 1114
380 nmdc:mga03n38_341327_c1 3300050490 Bacteria 813
381 nmdc:mga00v17_282320_c1 3300050491 Bacteria 1078
382 nmdc:mga00v17_64217_c1 3300050491 Bacteria 2262
383 nmdc:mga0yw44_145701_c1 3300050492 Bacteria 1542
384 nmdc:mga0yw44_265101_c1 3300050492 Bacteria 1146
385 nmdc:mga0k408_164316_c1 3300050493 Bacteria 1323
386 nmdc:mga06z11_109149_c1 3300050494 Bacteria 1530
387 nmdc:mga06z11_86588_c1 3300050494 Bacteria 1693
388 nmdc:mga04h51_11614_c1 3300050495 Bacteria 2450
389 nmdc:mga07m45_103282_c1 3300050496 Bacteria 1638
390 nmdc:mga07m45_33137_c1 3300050496 Bacteria 2868
391 Ga0495655_0006847 3300053083 Bacteria 2093
392 Ga0495655_0026246 3300053083 Bacteria 1371
393 Ga0495619_0084829 3300053085 Bacteria 2138
394 Ga0500578_0099998 3300053086 Bacteria 1836
395 Ga0500646_0152008 3300053090 Bacteria 767
396 Ga0500583_0003444 3300053092 Bacteria 4976
397 Ga0500651_0122415 3300053093 Bacteria 1578
398 Ga0500651_0316684 3300053093 Bacteria 892
399 Ga0500566_0000407 3300053094 Bacteria 23864
400 Ga0500566_0004841 3300053094 Bacteria 8028
401 Ga0500641_0117315 3300053096 Bacteria 1146
402 Ga0500554_018535 3300053102 Bacteria 1881
403 Ga0500557_000002 3300053105 Bacteria 234207
404 Ga0500572_001046 3300053111 Bacteria 8255
405 Ga0500594_0035845 3300053118 Bacteria 1332
406 Ga0500595_001199 3300053119 Bacteria 14322
407 Ga0500595_002759 3300053119 Bacteria 8464
408 Ga0500642_0000139 3300053130 Bacteria 32335
409 Ga0500658_0019715 3300053134 Bacteria 2540
410 Ga0500559_0000609 3300053136 Bacteria 24325
411 Ga0500568_0037449 3300053139 Bacteria 1968
412 Ga0500603_007329 3300053150 Bacteria 2420
413 Ga0500622_0113289 3300053156 Bacteria 1323
414 Ga0500638_009875 3300053162 Bacteria 4151
415 Ga0500639_104340 3300053163 Bacteria 1389
416 Ga0500636_0040334 3300053177 Bacteria 2761
417 Ga0500636_0135011 3300053177 Bacteria 1371
418 Ga0500636_0257337 3300053177 Bacteria 886
419 Ga0500637_0003584 3300053178 Bacteria 7202
420 Ga0500625_030542 3300053729 Bacteria 2557
421 Ga0500645_061130 3300053730 Bacteria 1089
422 Ga0500596_001736 3300053735 Bacteria 4407
423 Ga0501084_0067729 3300054114 Bacteria 2988
424 Ga0500661_000427 3300055283 Bacteria 7780
425 Ga0500661_008524 3300055283 Bacteria 1886
426 Ga0530510_0176688 3300061734 Bacteria 1583

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0801852 Ga0395899_0801852_11_568 178
2 3300048927 Ga0496124_0405341 Ga0496124_0405341_365_928 182
3 3300053090 Ga0500646_0152008 Ga0500646_0152008_17_580 182
4 3300046665 Ga0495661_0233630 Ga0495661_0233630_369_932 184
5 3300048915 Ga0496112_0190074 Ga0496112_0190074_1162_1743 192
6 3300041452 Ga0451793_1082569 Ga0451793_1082569_189_791 196
7 3300044842 Ga0466957_0287156 Ga0466957_0287156_19_609 196
8 3300048924 Ga0496121_0097875 Ga0496121_0097875_1237_1842 201
9 3300005436 Ga0070713_101013794 Ga0070713_1010137941 213
10 3300005840 Ga0068870_10444016 Ga0068870_104440162 213
11 3300005262 Ga0065165_1000435 Ga0065165_100043525 215
12 3300025302 Ga0207426_1012187 Ga0207426_10121871 215
13 iso_pu_bacteria 2507262055 2507509006 219
14 iso_pu_bacteria 2508501009 2508543069 219
15 iso_pu_bacteria 2508501042 2508691200 219
16 iso_pu_bacteria 2511231028 2511394699 219
17 iso_pu_bacteria 2513237092 2513624369 219
18 iso_pu_bacteria 2513237095 2513650200 219
19 iso_pu_bacteria 2513237102 2513703284 219
20 iso_pu_bacteria 2513237139 2513872445 219
21 iso_pu_bacteria 2513237161 2514015995 219
22 iso_pu_bacteria 2515154112 2515626425 219
23 iso_pu_bacteria 2524023205 2524436925 219
24 iso_pu_bacteria 2617270735 2617348674 219
25 iso_pu_bacteria 2617270741 2617376133 219
26 iso_pu_bacteria 2744054633 2745080131 219
27 iso_pu_bacteria 2791355196 2793065867 219
28 iso_pu_bacteria 2802429603 2805917968 219
29 iso_pu_bacteria 2816332527 2818241276 219
30 iso_pu_bacteria 2824617872 2824623320 219
31 iso_pu_bacteria 2824626560 2824631304 219
32 iso_pu_bacteria 2824635225 2824638905 219
33 iso_pu_bacteria 2824644064 2824648933 219
34 iso_pu_bacteria 2824671348 2824676782 219
35 iso_pu_bacteria 2824679649 2824684029 219
36 iso_pu_bacteria 2824687955 2824693128 219
37 iso_pu_bacteria 2824696289 2824704324 219
38 iso_pu_bacteria 2824704595 2824708803 219
39 iso_pu_bacteria 2824714736 2824719036 219
40 iso_pu_bacteria 2824723954 2824732566 219
41 iso_pu_bacteria 2824732956 2824737009 219
42 iso_pu_bacteria 2824746037 2824749477 219
43 iso_pu_bacteria 2824753945 2824757182 219
44 iso_pu_bacteria 2824763712 2824766780 219
45 iso_pu_bacteria 2824773399 2824776455 219
46 iso_pu_bacteria 2838122688 2838124107 219
47 iso_pu_bacteria 2841941048 2841943765 219
48 iso_pu_bacteria 2841949485 2841950207 219
49 iso_pu_bacteria 2841966195 2841966600 219
50 iso_pu_bacteria 2841974524 2841975340 219
51 iso_pu_bacteria 2841983080 2841983095 219
52 iso_pu_bacteria 2842038055 2842039406 219
53 iso_pu_bacteria 2842045827 2842047648 219
54 iso_pu_bacteria 2847939898 2847946213 219
55 iso_pu_bacteria 2849076700 2849079639 219
56 iso_pu_bacteria 2857509624 2857513940 219
57 iso_pu_bacteria 2874590934 2874592666 219
58 iso_pu_bacteria 2874612657 2874616151 219
59 iso_pu_bacteria 2874620515 2874627457 219
60 iso_pu_bacteria 2874628541 2874629788 219
61 iso_pu_bacteria 2874645413 2874648297 219
62 iso_pu_bacteria 2876761206 2876767319 219
63 iso_pu_bacteria 2876771140 2876772879 219
64 iso_pu_bacteria 2876818435 2876820207 219
65 iso_pu_bacteria 2879074833 2879076710 219
66 iso_pu_bacteria 2879127579 2879131679 219
67 iso_pu_bacteria 2879142872 2879148028 219
68 iso_pu_bacteria 2881364244 2881371783 219
69 iso_pu_bacteria 2881665667 2881666416 219
70 iso_pu_bacteria 2885366525 2885372160 219
71 iso_pu_bacteria 2885409591 2885418935 219
72 iso_pu_bacteria 2888378607 2888383726 219
73 iso_pu_bacteria 2888388044 2888394250 219
74 iso_pu_bacteria 2888419890 2888424144 219
75 iso_pu_bacteria 2904666416 2904671025 219
76 iso_pu_bacteria 2904711408 2904720899 219
77 iso_pu_bacteria 2906626472 2906630039 219
78 iso_pu_bacteria 2922393267 2922396690 219
79 iso_pu_bacteria 2935608549 2935612147 219
80 iso_pu_bacteria 2935648319 2935649717 219
81 iso_pu_bacteria 2935656913 2935658768 219
82 iso_pu_bacteria 2935769743 2935774984 219
83 iso_pu_bacteria 2935777560 2935782643 219
84 iso_pu_bacteria 2935785616 2935791771 219
85 iso_pu_bacteria 2935793552 2935799997 219
86 iso_pu_bacteria 2935819856 2935821617 219
87 iso_pu_bacteria 2935847175 2935847218 219
88 iso_pu_bacteria 2935908558 2935914678 219
89 iso_pu_bacteria 2935916978 2935924855 219
90 iso_pu_bacteria 2935926038 2935932244 219
91 iso_pu_bacteria 2935934488 2935940842 219
92 iso_pu_bacteria 2935942939 2935948915 219
93 iso_pu_bacteria 2935951376 2935957473 219
94 iso_pu_bacteria 2935959822 2935960051 219
95 iso_pu_bacteria 2935967501 2935973920 219
96 iso_pu_bacteria 2935975950 2935977332 219
97 iso_pu_bacteria 2935984226 2935988525 219
98 iso_pu_bacteria 2936011229 2936012801 219
99 iso_pu_bacteria 2936019824 2936021365 219
100 iso_pu_bacteria 2936028420 2936030094 219
101 iso_pu_bacteria 2936046547 2936047559 219
102 iso_pu_bacteria 2936055302 2936057283 219
103 iso_pu_bacteria 3005483717 3005486930 219
104 iso_pu_bacteria 3005506211 3005510121 219
105 iso_pu_bacteria 3005587118 3005592465 219
106 iso_pu_bacteria 3005594810 3005598910 219
107 iso_pu_bacteria 3005710791 3005714502 219
108 iso_pu_bacteria 8016522445 8016530009 219
109 iso_pu_bacteria 8016530956 8016535245 219
110 iso_pu_bacteria 8016539877 8016548454 219
111 iso_pu_bacteria 8016548790 8016553674 219
112 iso_pu_bacteria 8016557553 8016562055 219
113 iso_pu_bacteria 8016575299 8016577712 219
114 iso_pu_bacteria 8016583857 8016592270 219
115 iso_pu_bacteria 8016595262 8016599878 219
116 iso_pu_bacteria 8016603502 8016610935 219
117 iso_pu_bacteria 8016622563 8016627026 219
118 iso_pu_bacteria 8016630954 8016640728 219
119 iso_pu_bacteria 8019530166 8019534997 219
120 iso_pu_bacteria 8019538911 8019544470 219
121 iso_pu_bacteria 8019547302 8019554122 219
122 iso_pu_bacteria 8019629233 8019634812 219
123 iso_pu_bacteria 8019638758 8019644888 219
124 iso_pu_bacteria 8019659431 8019662711 219
125 iso_pu_bacteria 8019668869 8019672322 219
126 iso_pu_bacteria 8019678201 8019683887 219
127 iso_pu_bacteria 8019687851 8019689627 219
128 3300053094 Ga0500566_0004841 Ga0500566_0004841_4911_5597 220
129 3300053102 Ga0500554_018535 Ga0500554_018535_478_1164 220
130 3300053119 Ga0500595_002759 Ga0500595_002759_3494_4180 220
131 3300053150 Ga0500603_007329 Ga0500603_007329_425_1111 220
132 3300053162 Ga0500638_009875 Ga0500638_009875_2847_3533 220
133 3300053178 Ga0500637_0003584 Ga0500637_0003584_4831_5517 220
134 3300055283 Ga0500661_000427 Ga0500661_000427_2236_2922 220
135 iso_pu_bacteria 2513237101 2513692186 221
136 iso_pu_bacteria 2721755755 2723845432 221
137 iso_pu_bacteria 8006926726 8006932335 221
138 iso_pu_bacteria 8006984368 8006993654 221
139 iso_pu_bacteria 8006994254 8007000138 221
140 iso_pu_bacteria 8056673599 8056674194 221
141 3300003215 JGI25153J46596_10007377 JGI25153J46596_100073774 223
142 3300003354 JGI25160J50197_1002741 JGI25160J50197_10027416 223
143 3300003794 Ga0055531_10009470 Ga0055531_100094703 223
144 3300005262 Ga0065165_1011997 Ga0065165_10119973 223
145 3300005327 Ga0070658_10077697 Ga0070658_100776972 223
146 3300005337 Ga0070682_100085840 Ga0070682_1000858402 223
147 3300005344 Ga0070661_100049681 Ga0070661_1000496812 223
148 3300005366 Ga0070659_100407998 Ga0070659_1004079982 223
149 3300005455 Ga0070663_100152010 Ga0070663_1001520102 223
150 3300005539 Ga0068853_100384823 Ga0068853_1003848232 223
151 3300005548 Ga0070665_100113799 Ga0070665_1001137992 223
152 3300005548 Ga0070665_100266138 Ga0070665_1002661382 223
153 3300005563 Ga0068855_100153318 Ga0068855_1001533182 223
154 3300005616 Ga0068852_100196056 Ga0068852_1001960562 223
155 3300005719 Ga0068861_100815800 Ga0068861_1008158001 223
156 3300005842 Ga0068858_100179490 Ga0068858_1001794902 223
157 3300006042 Ga0075368_10020559 Ga0075368_100205592 223
158 3300006051 Ga0075364_10276958 Ga0075364_102769582 223
159 3300006175 Ga0070712_100420120 Ga0070712_1004201202 223
160 3300006178 Ga0075367_10042634 Ga0075367_100426342 223
161 3300006195 Ga0075366_10058309 Ga0075366_100583092 223
162 3300006195 Ga0075366_10222631 Ga0075366_102226312 223
163 3300006353 Ga0075370_10010462 Ga0075370_100104624 223
164 3300006353 Ga0075370_10074957 Ga0075370_100749572 223
165 3300006942 Ga0099824_1027854 Ga0099824_10278542 223
166 3300009101 Ga0105247_10132668 Ga0105247_101326682 223
167 3300009174 Ga0105241_10360894 Ga0105241_103608942 223
168 3300009545 Ga0105237_10031690 Ga0105237_100316903 223
169 3300009551 Ga0105238_11039658 Ga0105238_110396581 223
170 3300010375 Ga0105239_10351163 Ga0105239_103511632 223
171 3300011119 Ga0105246_10047878 Ga0105246_100478781 223
172 3300012500 Ga0157314_1003922 Ga0157314_10039221 223
173 3300013306 Ga0163162_10115535 Ga0163162_101155352 223
174 3300014325 Ga0163163_10088422 Ga0163163_100884222 223
175 3300014968 Ga0157379_10556011 Ga0157379_105560112 223
176 3300021320 Ga0214544_1001370 Ga0214544_100137039 223
177 3300021321 Ga0214542_1000153 Ga0214542_100015315 223
178 3300021324 Ga0214545_1000018 Ga0214545_1000018127 223
179 3300021327 Ga0214543_1005445 Ga0214543_100544515 223
180 3300025253 Ga0209677_103529 Ga0209677_1035293 223
181 3300025261 Ga0209233_1019951 Ga0209233_10199512 223
182 3300025273 Ga0209673_1018472 Ga0209673_10184722 223
183 3300025297 Ga0209758_1000021 Ga0209758_1000021346 223
184 3300025297 Ga0209758_1000211 Ga0209758_100021150 223
185 3300025297 Ga0209758_1006738 Ga0209758_10067383 223
186 3300025302 Ga0207426_1004377 Ga0207426_10043773 223
187 3300025304 Ga0209257_1008824 Ga0209257_10088243 223
188 3300025304 Ga0209257_1014097 Ga0209257_10140972 223
189 3300025904 Ga0207647_10002611 Ga0207647_1000261119 223
190 3300025909 Ga0207705_10122063 Ga0207705_101220632 223
191 3300025919 Ga0207657_10106111 Ga0207657_101061112 223
192 3300025920 Ga0207649_10080147 Ga0207649_100801472 223
193 3300025931 Ga0207644_10064026 Ga0207644_100640262 223
194 3300025933 Ga0207706_10060148 Ga0207706_100601484 223
195 3300025935 Ga0207709_10121510 Ga0207709_101215102 223
196 3300025949 Ga0207667_10580977 Ga0207667_105809772 223
197 3300025981 Ga0207640_10203949 Ga0207640_102039492 223
198 3300025986 Ga0207658_10074115 Ga0207658_100741152 223
199 3300026035 Ga0207703_10405533 Ga0207703_104055332 223
200 3300026041 Ga0207639_10611015 Ga0207639_106110152 223
201 3300026067 Ga0207678_10498677 Ga0207678_104986772 223
202 3300026118 Ga0207675_100940720 Ga0207675_1009407202 223
203 3300026142 Ga0207698_10659110 Ga0207698_106591102 223
204 3300027296 Ga0209389_1000495 Ga0209389_100049511 223
205 3300027357 Ga0209589_1000072 Ga0209589_100007211 223
206 3300027361 Ga0209489_100031 Ga0209489_100031101 223
207 3300027866 Ga0209813_10040665 Ga0209813_100406652 223
208 3300028379 Ga0268266_10126801 Ga0268266_101268012 223
209 3300028380 Ga0268265_10530671 Ga0268265_105306712 223
210 3300037471 Ga0395905_0040435 Ga0395905_0040435_1981_2667 223
211 3300038443 Ga0395901_0173823 Ga0395901_0173823_1045_1737 223
212 3300041452 Ga0451793_1166649 Ga0451793_1166649_1797_2483 223
213 3300041458 Ga0451798_0180606 Ga0451798_0180606_256_942 223
214 3300042005 Ga0439448_0105831 Ga0439448_0105831_16_702 223
215 3300044658 Ga0466972_0000188 Ga0466972_0000188_10531_11217 223
216 3300044658 Ga0466972_0001486 Ga0466972_0001486_10377_11063 223
217 3300044658 Ga0466972_0053744 Ga0466972_0053744_678_1364 223
218 3300044658 Ga0466972_0188089 Ga0466972_0188089_109_795 223
219 3300044735 Ga0466968_0008336 Ga0466968_0008336_2692_3378 223
220 3300044765 Ga0466970_0125112 Ga0466970_0125112_107_793 223
221 3300044901 Ga0466960_0017846 Ga0466960_0017846_2101_2787 223
222 3300044901 Ga0466960_0106207 Ga0466960_0106207_61_747 223
223 3300046454 Ga0495592_0139834 Ga0495592_0139834_580_1266 223
224 3300046462 Ga0495651_0010063 Ga0495651_0010063_4809_5495 223
225 3300046463 Ga0495653_0072411 Ga0495653_0072411_341_1027 223
226 3300046476 Ga0495662_0104931 Ga0495662_0104931_523_1209 223
227 3300046477 Ga0495664_0036827 Ga0495664_0036827_885_1571 223
228 3300046507 Ga0495606_0236335 Ga0495606_0236335_300_986 223
229 3300046507 Ga0495606_0357268 Ga0495606_0357268_49_735 223
230 3300046511 Ga0495608_0087971 Ga0495608_0087971_673_1359 223
231 3300046512 Ga0495610_0048264 Ga0495610_0048264_1346_2032 223
232 3300046516 Ga0495628_0166273 Ga0495628_0166273_396_1082 223
233 3300046522 Ga0495643_0027359 Ga0495643_0027359_324_1010 223
234 3300046528 Ga0495642_0099958 Ga0495642_0099958_85_771 223
235 3300046533 Ga0495640_0036750 Ga0495640_0036750_69_755 223
236 3300046542 Ga0495597_0045794 Ga0495597_0045794_252_938 223
237 3300046543 Ga0495645_0159849 Ga0495645_0159849_435_1121 223
238 3300046642 Ga0495634_0081679 Ga0495634_0081679_754_1440 223
239 3300046675 Ga0495657_0002141 Ga0495657_0002141_14415_15101 223
240 3300046679 Ga0495623_0007037 Ga0495623_0007037_1953_2639 223
241 3300046689 Ga0495613_0090928 Ga0495613_0090928_1078_1764 223
242 3300047317 Ga0495604_0004398 Ga0495604_0004398_8287_8973 223
243 3300047319 Ga0495674_0041024 Ga0495674_0041024_2279_2965 223
244 3300047322 Ga0495680_0007089 Ga0495680_0007089_7219_7905 223
245 3300047443 Ga0495687_032219 Ga0495687_032219_1026_1712 223
246 3300047444 Ga0495675_0007985 Ga0495675_0007985_4359_5045 223
247 3300048088 Ga0495602_0019341 Ga0495602_0019341_3660_4346 223
248 3300048904 Ga0496101_0048646 Ga0496101_0048646_1793_2485 223
249 3300048905 Ga0496102_0014768 Ga0496102_0014768_3547_4233 223
250 3300048905 Ga0496102_0451342 Ga0496102_0451342_390_1082 223
251 3300048906 Ga0496103_0010689 Ga0496103_0010689_385_1071 223
252 3300048907 Ga0496104_0059024 Ga0496104_0059024_2297_2983 223
253 3300048907 Ga0496104_0096243 Ga0496104_0096243_1933_2625 223
254 3300048908 Ga0496105_0106873 Ga0496105_0106873_1224_1910 223
255 3300048908 Ga0496105_0230021 Ga0496105_0230021_188_880 223
256 3300048909 Ga0496106_0014945 Ga0496106_0014945_630_1322 223
257 3300048909 Ga0496106_0343202 Ga0496106_0343202_31_717 223
258 3300048910 Ga0496107_0091489 Ga0496107_0091489_1140_1832 223
259 3300048911 Ga0496108_0028358 Ga0496108_0028358_2052_2744 223
260 3300048911 Ga0496108_0030420 Ga0496108_0030420_2771_3457 223
261 3300048912 Ga0496109_0011290 Ga0496109_0011290_2288_2980 223
262 3300048912 Ga0496109_0115702 Ga0496109_0115702_400_1086 223
263 3300048913 Ga0496110_0096823 Ga0496110_0096823_415_1107 223
264 3300048914 Ga0496111_0125393 Ga0496111_0125393_966_1658 223
265 3300048914 Ga0496111_0266991 Ga0496111_0266991_254_940 223
266 3300048915 Ga0496112_0025787 Ga0496112_0025787_3073_3765 223
267 3300048915 Ga0496112_0363285 Ga0496112_0363285_361_1047 223
268 3300048916 Ga0496113_0220170 Ga0496113_0220170_586_1272 223
269 3300048918 Ga0496115_0145521 Ga0496115_0145521_855_1541 223
270 3300048920 Ga0496117_0113420 Ga0496117_0113420_595_1281 223
271 3300048920 Ga0496117_0164358 Ga0496117_0164358_518_1204 223
272 3300048921 Ga0496118_0030011 Ga0496118_0030011_2811_3497 223
273 3300048922 Ga0496119_0177963 Ga0496119_0177963_211_897 223
274 3300048923 Ga0496120_0056663 Ga0496120_0056663_1058_1744 223
275 3300048923 Ga0496120_0219524 Ga0496120_0219524_185_871 223
276 3300048927 Ga0496124_0149140 Ga0496124_0149140_882_1568 223
277 3300048929 Ga0496126_0344721 Ga0496126_0344721_463_1149 223
278 3300050489 nmdc:mga03683_133025_c1 nmdc:mga03683_133025_c1_243_929 223
279 3300050490 nmdc:mga03n38_341327_c1 nmdc:mga03n38_341327_c1_62_748 223
280 3300050491 nmdc:mga00v17_282320_c1 nmdc:mga00v17_282320_c1_186_872 223
281 3300050492 nmdc:mga0yw44_145701_c1 nmdc:mga0yw44_145701_c1_725_1411 223
282 3300050492 nmdc:mga0yw44_265101_c1 nmdc:mga0yw44_265101_c1_398_1084 223
283 3300050493 nmdc:mga0k408_164316_c1 nmdc:mga0k408_164316_c1_194_880 223
284 3300050494 nmdc:mga06z11_86588_c1 nmdc:mga06z11_86588_c1_624_1310 223
285 3300050495 nmdc:mga04h51_11614_c1 nmdc:mga04h51_11614_c1_258_944 223
286 3300050496 nmdc:mga07m45_103282_c1 nmdc:mga07m45_103282_c1_478_1164 223
287 3300053083 Ga0495655_0026246 Ga0495655_0026246_450_1136 223
288 3300053085 Ga0495619_0084829 Ga0495619_0084829_727_1413 223
289 3300053086 Ga0500578_0099998 Ga0500578_0099998_430_1116 223
290 3300053093 Ga0500651_0316684 Ga0500651_0316684_10_696 223
291 3300053094 Ga0500566_0000407 Ga0500566_0000407_13381_14067 223
292 3300053105 Ga0500557_000002 Ga0500557_000002_47371_48057 223
293 3300053130 Ga0500642_0000139 Ga0500642_0000139_19508_20194 223
294 3300053177 Ga0500636_0135011 Ga0500636_0135011_77_763 223
295 3300053729 Ga0500625_030542 Ga0500625_030542_1431_2117 223
296 3300055283 Ga0500661_008524 Ga0500661_008524_851_1537 223
297 3300003320 rootH2_10026632 rootH2_100266322 224
298 3300005614 Ga0068856_100020962 Ga0068856_1000209626 224
299 3300005616 Ga0068852_100052999 Ga0068852_1000529993 224
300 3300005985 Ga0081539_10064174 Ga0081539_100641742 224
301 3300026078 Ga0207702_10302804 Ga0207702_103028042 224
302 3300026142 Ga0207698_10348895 Ga0207698_103488952 224
303 3300031731 Ga0307405_10460782 Ga0307405_104607822 224
304 3300031852 Ga0307410_10780919 Ga0307410_107809192 224
305 3300048904 Ga0496101_0468943 Ga0496101_0468943_107_781 224
306 3300048909 Ga0496106_0736687 Ga0496106_0736687_75_749 224
307 3300048913 Ga0496110_0787130 Ga0496110_0787130_91_765 224
308 3300049585 Ga0501069_0036807 Ga0501069_0036807_1207_1890 224
309 3300053730 Ga0500645_061130 Ga0500645_061130_107_790 224
310 iso_pu_bacteria 2513237096 2513654373 224
311 iso_pu_bacteria 2513237137 2513859170 224
312 iso_pu_bacteria 2513237145 2513915448 224
313 iso_pu_bacteria 2517572143 2517892781 224
314 iso_pu_bacteria 2667528175 2671117493 224
315 iso_pu_bacteria 2885374607 2885381194 224
316 iso_pu_bacteria 2903748898 2903750493 224
317 iso_pu_bacteria 2904699407 2904702928 224
318 iso_pu_bacteria 2906610324 2906618209 224
319 iso_pu_bacteria 2906635258 2906642543 224
320 iso_pu_bacteria 2906660503 2906664311 224
321 iso_pu_bacteria 2908739725 2908743116 224
322 iso_pu_bacteria 2922425934 2922429849 224
323 iso_pu_bacteria 2935630451 2935633501 224
324 iso_pu_bacteria 2941507105 2941510392 224
325 iso_pu_bacteria 2941515067 2941517871 224
326 iso_pu_bacteria 2941523033 2941525887 224
327 iso_pu_bacteria 3005474847 3005479804 224
328 iso_pu_bacteria 8019555841 8019557206 224
329 iso_pu_bacteria 8019565922 8019568095 224
330 3300005328 Ga0070676_10025156 Ga0070676_100251563 225
331 3300005331 Ga0070670_100458234 Ga0070670_1004582342 225
332 3300005335 Ga0070666_10364212 Ga0070666_103642122 225
333 3300005343 Ga0070687_100274155 Ga0070687_1002741552 225
334 3300005354 Ga0070675_100171626 Ga0070675_1001716262 225
335 3300005435 Ga0070714_100431734 Ga0070714_1004317342 225
336 3300005455 Ga0070663_100412267 Ga0070663_1004122672 225
337 3300005456 Ga0070678_100678398 Ga0070678_1006783981 225
338 3300005539 Ga0068853_100217134 Ga0068853_1002171342 225
339 3300005548 Ga0070665_100293077 Ga0070665_1002930772 225
340 3300005548 Ga0070665_100432897 Ga0070665_1004328972 225
341 3300005564 Ga0070664_100483579 Ga0070664_1004835792 225
342 3300005577 Ga0068857_100088782 Ga0068857_1000887823 225
343 3300005719 Ga0068861_100147185 Ga0068861_1001471852 225
344 3300005841 Ga0068863_100321690 Ga0068863_1003216902 225
345 3300005842 Ga0068858_100202284 Ga0068858_1002022841 225
346 3300005844 Ga0068862_100164855 Ga0068862_1001648552 225
347 3300005983 Ga0081540_1002798 Ga0081540_100279811 225
348 3300005985 Ga0081539_10030484 Ga0081539_100304842 225
349 3300006038 Ga0075365_10107920 Ga0075365_101079202 225
350 3300006173 Ga0070716_100250218 Ga0070716_1002502182 225
351 3300006195 Ga0075366_10206750 Ga0075366_102067501 225
352 3300006353 Ga0075370_10060841 Ga0075370_100608412 225
353 3300009093 Ga0105240_10376054 Ga0105240_103760542 225
354 3300009101 Ga0105247_10110304 Ga0105247_101103042 225
355 3300009177 Ga0105248_10234747 Ga0105248_102347472 225
356 3300009177 Ga0105248_10840445 Ga0105248_108404452 225
357 3300009545 Ga0105237_10478088 Ga0105237_104780882 225
358 3300010375 Ga0105239_10405002 Ga0105239_104050022 225
359 3300013297 Ga0157378_10070844 Ga0157378_100708443 225
360 3300013297 Ga0157378_10198845 Ga0157378_101988452 225
361 3300013307 Ga0157372_10914876 Ga0157372_109148762 225
362 3300014325 Ga0163163_10755278 Ga0163163_107552782 225
363 3300017792 Ga0163161_10261546 Ga0163161_102615462 225
364 3300025297 Ga0209758_1019966 Ga0209758_10199663 225
365 3300025914 Ga0207671_10163325 Ga0207671_101633252 225
366 3300025918 Ga0207662_10186695 Ga0207662_101866951 225
367 3300025926 Ga0207659_10305961 Ga0207659_103059612 225
368 3300025929 Ga0207664_10288779 Ga0207664_102887792 225
369 3300026035 Ga0207703_10207725 Ga0207703_102077252 225
370 3300026067 Ga0207678_10040313 Ga0207678_100403132 225
371 3300026118 Ga0207675_100380325 Ga0207675_1003803252 225
372 3300028379 Ga0268266_10016444 Ga0268266_100164446 225
373 3300028379 Ga0268266_10224646 Ga0268266_102246462 225
374 3300028379 Ga0268266_10322331 Ga0268266_103223312 225
375 3300028379 Ga0268266_10419759 Ga0268266_104197592 225
376 3300028380 Ga0268265_10730839 Ga0268265_107308392 225
377 3300028381 Ga0268264_11215916 Ga0268264_112159161 225
378 3300031456 Ga0307513_10345631 Ga0307513_103456312 225
379 3300031730 Ga0307516_10436186 Ga0307516_104361862 225
380 3300031824 Ga0307413_10103301 Ga0307413_101033012 225
381 3300031995 Ga0307409_100282604 Ga0307409_1002826042 225
382 3300031995 Ga0307409_100466353 Ga0307409_1004663532 225
383 3300032005 Ga0307411_10533915 Ga0307411_105339152 225
384 3300032126 Ga0307415_100240509 Ga0307415_1002405092 225
385 3300033180 Ga0307510_10042971 Ga0307510_100429712 225
386 3300035113 Ga0373936_0141525 Ga0373936_0141525_201_887 225
387 3300035695 Ga0373927_0201066 Ga0373927_0201066_361_1047 225
388 3300044719 Ga0466971_0265095 Ga0466971_0265095_63_740 225
389 3300044765 Ga0466970_0053067 Ga0466970_0053067_350_1027 225
390 3300046455 Ga0495603_0008023 Ga0495603_0008023_2395_3081 225
391 3300046455 Ga0495603_0019910 Ga0495603_0019910_1624_2310 225
392 3300046455 Ga0495603_0310753 Ga0495603_0310753_31_717 225
393 3300046457 Ga0495590_0036012 Ga0495590_0036012_861_1547 225
394 3300046472 Ga0495580_0165291 Ga0495580_0165291_13_690 225
395 3300046473 Ga0495582_0296021 Ga0495582_0296021_29_715 225
396 3300046474 Ga0495605_0057604 Ga0495605_0057604_934_1620 225
397 3300046477 Ga0495664_0120328 Ga0495664_0120328_687_1373 225
398 3300046492 Ga0495585_0069735 Ga0495585_0069735_49_735 225
399 3300046492 Ga0495585_0079428 Ga0495585_0079428_455_1141 225
400 3300046492 Ga0495585_0092686 Ga0495585_0092686_30_716 225
401 3300046513 Ga0495616_0040710 Ga0495616_0040710_1318_2004 225
402 3300046519 Ga0495632_0047252 Ga0495632_0047252_1270_1956 225
403 3300046522 Ga0495643_0233088 Ga0495643_0233088_81_767 225
404 3300046523 Ga0495644_0122832 Ga0495644_0122832_230_916 225
405 3300046524 Ga0495648_0124268 Ga0495648_0124268_53_739 225
406 3300046528 Ga0495642_0049692 Ga0495642_0049692_925_1611 225
407 3300046529 Ga0495652_0208197 Ga0495652_0208197_348_1034 225
408 3300046530 Ga0495654_0074481 Ga0495654_0074481_348_1034 225
409 3300046537 Ga0495598_0013678 Ga0495598_0013678_966_1652 225
410 3300046537 Ga0495598_0047481 Ga0495598_0047481_20_706 225
411 3300046538 Ga0495609_0020159 Ga0495609_0020159_1648_2334 225
412 3300046557 Ga0495622_0059705 Ga0495622_0059705_26_712 225
413 3300046558 Ga0495633_0055335 Ga0495633_0055335_503_1189 225
414 3300046615 Ga0495656_0025218 Ga0495656_0025218_493_1179 225
415 3300046674 Ga0495588_0005942 Ga0495588_0005942_326_1012 225
416 3300046684 Ga0495669_0056752 Ga0495669_0056752_414_1100 225
417 3300046684 Ga0495669_0157432 Ga0495669_0157432_20_706 225
418 3300046794 Ga0495589_0162725 Ga0495589_0162725_172_858 225
419 3300046794 Ga0495589_0162766 Ga0495589_0162766_135_821 225
420 3300047315 Ga0495581_0273387 Ga0495581_0273387_234_920 225
421 3300047317 Ga0495604_0139204 Ga0495604_0139204_523_1209 225
422 3300047320 Ga0495672_0078633 Ga0495672_0078633_93_779 225
423 3300048088 Ga0495602_0298318 Ga0495602_0298318_431_1117 225
424 3300048091 Ga0495626_0067469 Ga0495626_0067469_330_1016 225
425 3300048905 Ga0496102_0109224 Ga0496102_0109224_1488_2174 225
426 3300048906 Ga0496103_0350139 Ga0496103_0350139_44_730 225
427 3300048907 Ga0496104_0901843 Ga0496104_0901843_18_704 225
428 3300048909 Ga0496106_0194903 Ga0496106_0194903_390_1076 225
429 3300048912 Ga0496109_0718516 Ga0496109_0718516_200_886 225
430 3300048915 Ga0496112_0091026 Ga0496112_0091026_2261_2947 225
431 3300048916 Ga0496113_0121356 Ga0496113_0121356_862_1548 225
432 3300048921 Ga0496118_0219241 Ga0496118_0219241_328_1014 225
433 3300048922 Ga0496119_0135252 Ga0496119_0135252_253_942 225
434 3300048924 Ga0496121_0221479 Ga0496121_0221479_196_882 225
435 3300048929 Ga0496126_0006548 Ga0496126_0006548_10081_10767 225
436 3300049459 Ga0495678_047912 Ga0495678_047912_365_1051 225
437 3300049460 Ga0495682_0052111 Ga0495682_0052111_423_1109 225
438 3300050491 nmdc:mga00v17_64217_c1 nmdc:mga00v17_64217_c1_1149_1835 225
439 3300050494 nmdc:mga06z11_109149_c1 nmdc:mga06z11_109149_c1_175_861 225
440 3300050496 nmdc:mga07m45_33137_c1 nmdc:mga07m45_33137_c1_1306_1992 225
441 3300053083 Ga0495655_0006847 Ga0495655_0006847_1365_2051 225
442 3300053092 Ga0500583_0003444 Ga0500583_0003444_1629_2315 225
443 3300053093 Ga0500651_0122415 Ga0500651_0122415_46_732 225
444 3300053096 Ga0500641_0117315 Ga0500641_0117315_448_1134 225
445 3300053118 Ga0500594_0035845 Ga0500594_0035845_454_1140 225
446 3300053119 Ga0500595_001199 Ga0500595_001199_4817_5503 225
447 3300053134 Ga0500658_0019715 Ga0500658_0019715_1498_2184 225
448 3300053139 Ga0500568_0037449 Ga0500568_0037449_1020_1706 225
449 3300053156 Ga0500622_0113289 Ga0500622_0113289_467_1153 225
450 3300053177 Ga0500636_0257337 Ga0500636_0257337_155_844 225
451 iso_pu_bacteria 2508501128 2509151733 225
452 3300005841 Ga0068863_100593115 Ga0068863_1005931152 226
453 3300009101 Ga0105247_10039053 Ga0105247_100390533 226
454 3300009545 Ga0105237_10107116 Ga0105237_101071162 226
455 3300009551 Ga0105238_10056315 Ga0105238_100563153 226
456 3300010375 Ga0105239_10075990 Ga0105239_100759902 226
457 3300025914 Ga0207671_10260732 Ga0207671_102607322 226
458 3300025924 Ga0207694_10565215 Ga0207694_105652151 226
459 3300026088 Ga0207641_10646000 Ga0207641_106460002 226
460 3300028379 Ga0268266_10418050 Ga0268266_104180502 226
461 3300041441 Ga0451787_239584 Ga0451787_239584_118_798 226
462 3300048927 Ga0496124_0016895 Ga0496124_0016895_1050_1730 226
463 3300048928 Ga0496125_0033268 Ga0496125_0033268_1298_1978 226
464 iso_pu_bacteria 2513237141 2513894291 226
465 3300048919 Ga0496116_0148110 Ga0496116_0148110_139_822 227
466 3300048924 Ga0496121_0359811 Ga0496121_0359811_105_788 227
467 3300048929 Ga0496126_0060317 Ga0496126_0060317_892_1575 227
468 3300053111 Ga0500572_001046 Ga0500572_001046_339_1022 227
469 3300053136 Ga0500559_0000609 Ga0500559_0000609_20178_20861 227
470 3300053163 Ga0500639_104340 Ga0500639_104340_399_1082 227
471 3300053177 Ga0500636_0040334 Ga0500636_0040334_1066_1749 227
472 3300053735 Ga0500596_001736 Ga0500596_001736_2368_3051 227
473 3300009545 Ga0105237_10007285 Ga0105237_1000728510 228
474 3300025261 Ga0209233_1003425 Ga0209233_10034252 228
475 3300025914 Ga0207671_10022626 Ga0207671_100226264 228
476 3300033442 Ga0315911_1000001 Ga0315911_1000001777 228
477 3300046507 Ga0495606_0002525 Ga0495606_0002525_16675_17361 228
478 3300047470 Ga0495681_0071270 Ga0495681_0071270_616_1302 228
479 3300048915 Ga0496112_0000009 Ga0496112_0000009_262241_262927 228
480 3300048924 Ga0496121_0117109 Ga0496121_0117109_1027_1725 228
481 3300049585 Ga0501069_0084567 Ga0501069_0084567_511_1197 228
482 3300003203 JGI25406J46586_10000004 JGI25406J46586_1000000476 230
483 3300005436 Ga0070713_100005205 Ga0070713_1000052052 230
484 3300005437 Ga0070710_10004671 Ga0070710_100046713 230
485 3300005471 Ga0070698_100336952 Ga0070698_1003369522 230
486 3300005985 Ga0081539_10000080 Ga0081539_1000008051 230
487 3300006028 Ga0070717_10094917 Ga0070717_100949172 230
488 3300006163 Ga0070715_10007314 Ga0070715_100073142 230
489 3300006173 Ga0070716_100015184 Ga0070716_1000151843 230
490 3300006175 Ga0070712_100007796 Ga0070712_1000077962 230
491 3300025898 Ga0207692_10011132 Ga0207692_100111323 230
492 3300025905 Ga0207685_10017068 Ga0207685_100170682 230
493 3300025906 Ga0207699_10012020 Ga0207699_100120202 230
494 3300025909 Ga0207705_10057685 Ga0207705_100576852 230
495 3300025915 Ga0207693_10002655 Ga0207693_100026557 230
496 3300025916 Ga0207663_10002699 Ga0207663_100026993 230
497 3300025928 Ga0207700_10025335 Ga0207700_100253352 230
498 3300025929 Ga0207664_10020349 Ga0207664_100203495 230
499 3300025939 Ga0207665_10001529 Ga0207665_100015298 230
500 3300035113 Ga0373936_0006070 Ga0373936_0006070_1631_2323 230
501 3300035116 Ga0373945_0015147 Ga0373945_0015147_11_703 230
502 3300035118 Ga0373954_0024565 Ga0373954_0024565_1319_2011 230
503 3300035692 Ga0373935_0009202 Ga0373935_0009202_4584_5276 230
504 3300036401 Ga0373937_0049573 Ga0373937_0049573_1170_1862 230
505 3300037068 Ga0373925_0006309 Ga0373925_0006309_4590_5282 230
506 3300046454 Ga0495592_0276179 Ga0495592_0276179_358_1050 230
507 3300046455 Ga0495603_0000160 Ga0495603_0000160_24987_25679 230
508 3300046459 Ga0495629_0000155 Ga0495629_0000155_54483_55175 230
509 3300046461 Ga0495641_0007890 Ga0495641_0007890_2954_3646 230
510 3300046472 Ga0495580_0009027 Ga0495580_0009027_2007_2699 230
511 3300046473 Ga0495582_0000866 Ga0495582_0000866_4571_5263 230
512 3300046477 Ga0495664_0006573 Ga0495664_0006573_3905_4597 230
513 3300046499 Ga0495594_0000042 Ga0495594_0000042_4821_5513 230
514 3300046514 Ga0495618_0176302 Ga0495618_0176302_293_985 230
515 3300046529 Ga0495652_0050583 Ga0495652_0050583_1590_2282 230
516 3300046531 Ga0495665_0002439 Ga0495665_0002439_8175_8867 230
517 3300046533 Ga0495640_0007997 Ga0495640_0007997_1022_1714 230
518 3300046557 Ga0495622_0003165 Ga0495622_0003165_3956_4648 230
519 3300046559 Ga0495667_0007085 Ga0495667_0007085_2516_3208 230
520 3300046642 Ga0495634_0000798 Ga0495634_0000798_24859_25551 230
521 3300046663 Ga0495635_0003922 Ga0495635_0003922_5944_6636 230
522 3300046674 Ga0495588_0075666 Ga0495588_0075666_903_1595 230
523 3300046681 Ga0495647_0000396 Ga0495647_0000396_4527_5219 230
524 3300046683 Ga0495658_0000434 Ga0495658_0000434_18159_18851 230
525 3300046689 Ga0495613_0428972 Ga0495613_0428972_139_831 230
526 3300046690 Ga0495624_0002112 Ga0495624_0002112_3873_4565 230
527 3300047315 Ga0495581_0000239 Ga0495581_0000239_5246_5938 230
528 3300047319 Ga0495674_0001352 Ga0495674_0001352_5307_5999 230
529 3300047321 Ga0495676_0054226 Ga0495676_0054226_461_1153 230
530 3300047471 Ga0495684_0001910 Ga0495684_0001910_14241_14933 230
531 3300047673 Ga0495593_0000013 Ga0495593_0000013_5244_5936 230
532 3300048905 Ga0496102_0327161 Ga0496102_0327161_716_1411 230
533 3300048915 Ga0496112_0829878 Ga0496112_0829878_93_785 230
534 3300048917 Ga0496114_0079575 Ga0496114_0079575_325_1020 230
535 3300048918 Ga0496115_0086316 Ga0496115_0086316_213_908 230
536 3300048929 Ga0496126_0055001 Ga0496126_0055001_650_1345 230
537 3300049568 Ga0501031_0000775 Ga0501031_0000775_2507_3199 230
538 3300049570 Ga0501033_0000408 Ga0501033_0000408_29218_29910 230
539 3300049570 Ga0501033_0006452 Ga0501033_0006452_5484_6176 230
540 3300049571 Ga0501034_0209552 Ga0501034_0209552_189_881 230
541 3300049573 Ga0501037_0000122 Ga0501037_0000122_58445_59137 230
542 3300049573 Ga0501037_0018175 Ga0501037_0018175_195_887 230
543 3300049574 Ga0501038_0007515 Ga0501038_0007515_5354_6046 230
544 3300049574 Ga0501038_0180304 Ga0501038_0180304_607_1299 230
545 3300049575 Ga0501039_0003596 Ga0501039_0003596_179_871 230
546 3300049575 Ga0501039_0177199 Ga0501039_0177199_836_1528 230
547 3300049576 Ga0501040_0349200 Ga0501040_0349200_166_858 230
548 3300049577 Ga0501041_0072044 Ga0501041_0072044_876_1568 230
549 3300049578 Ga0501042_0006101 Ga0501042_0006101_5577_6269 230
550 3300049579 Ga0501043_0006251 Ga0501043_0006251_6528_7220 230
551 3300049579 Ga0501043_0240097 Ga0501043_0240097_631_1323 230
552 3300049580 Ga0501046_0015190 Ga0501046_0015190_958_1650 230
553 3300049581 Ga0501047_0144600 Ga0501047_0144600_1021_1713 230
554 3300049583 Ga0501067_0067325 Ga0501067_0067325_195_887 230
555 3300049584 Ga0501068_0019104 Ga0501068_0019104_3177_3869 230
556 3300049585 Ga0501069_0010603 Ga0501069_0010603_3339_4031 230
557 3300049587 Ga0501071_0067065 Ga0501071_0067065_887_1579 230
558 3300049589 Ga0501073_0021482 Ga0501073_0021482_3766_4458 230
559 3300049590 Ga0501074_0011738 Ga0501074_0011738_4343_5035 230
560 3300049741 Ga0501079_0116017 Ga0501079_0116017_769_1461 230
561 3300049742 Ga0501080_0828304 Ga0501080_0828304_98_790 230
562 3300049744 Ga0501083_0058075 Ga0501083_0058075_136_828 230
563 3300049822 Ga0501035_0005412 Ga0501035_0005412_11198_11890 230
564 3300049822 Ga0501035_0027858 Ga0501035_0027858_1024_1716 230
565 3300049822 Ga0501035_0394303 Ga0501035_0394303_282_974 230
566 3300049823 Ga0501044_0046551 Ga0501044_0046551_3167_3859 230
567 3300049824 Ga0501045_0130554 Ga0501045_0130554_765_1457 230
568 3300054114 Ga0501084_0067729 Ga0501084_0067729_837_1529 230
569 3300061734 Ga0530510_0176688 Ga0530510_0176688_439_1131 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

18

118

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x8d-assembly1.cif.gz_B d90l mutant of thermus thermophilus hb8 thymidylate kinase 0.9554 13 216
5zb4-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with adp and tmp from thermus thermophilus hb8 0.9545 13 216
5zb0-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with adp and tdp from thermus thermophilus hb8 0.9539 13 216
5xal-assembly1.cif.gz_A y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9497 13 216
5xal-assembly1.cif.gz_B y99f mutant of thermus thermophilus hb8 thymidylate kinase 0.9495 13 216
ID Description Score Start End Superfamily
2pbrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9366 15 216 3.40.50.300
3uwoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9205 13 216 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9149 13 216 3.40.50.300
3lv8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9111 13 222 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9109 15 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4D7QRC1-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9714 11 218 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A327KXA9-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.97 12 218 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A529TX53-F1-model_v4 deleted 0.969 11 208
AF-A0A4Q2U9M2-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9687 12 218 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A7Z8LVG8-F1-model_v4 deleted 0.9687 12 223

Feature Viewer

pLDDT pTM Quality
84.85 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map