F464765
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 426 | 426 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0097875|Ga0496121_0097875_1237_1842 |
| Length | 201 |
| Sequence | MTEAAAERPSLRGRFITFEGGEGSGKSTQIRKLAERLDAAKLRAIVTREPGGSPGAEIIRHLVLSGMGKLLGPDAETLLFAAARDDHVRTVILPALNQGIWVLCDRFFDSTRAYQGQLDVPVEVGLQRAAARRGDATADRFEAEGIKFHQDLREAYQRIAAEDPQRCVLIDATADPDTVAGRIWAALREHLRSTFTADSPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 13 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 16 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 23 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 24 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 25 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 26 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 27 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 28 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 29 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 30 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 31 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 32 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 33 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 34 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 35 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 36 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 37 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 38 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 39 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 40 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 41 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 42 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 43 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 44 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 45 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 46 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 47 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 48 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 49 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 50 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 51 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 52 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 53 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 54 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 55 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 56 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 57 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 58 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 59 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 60 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 61 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 62 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 63 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 64 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 65 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 66 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 67 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 68 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 69 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 70 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 71 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 72 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 73 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 74 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 75 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 76 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 77 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 78 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 79 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 80 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 81 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 82 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 83 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 84 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 85 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 86 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 87 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 88 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 89 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 90 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 91 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 92 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 93 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 94 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 95 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 96 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 97 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 98 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 99 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 100 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 101 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 102 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 103 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 104 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 105 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 106 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 107 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 108 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 109 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 110 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 111 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 112 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 113 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 114 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 115 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 116 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 117 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 118 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 119 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 120 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 121 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 127 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 148 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 149 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 150 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 152 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 153 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 154 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 157 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 158 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 159 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 160 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 161 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 170 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 177 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 178 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 179 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 180 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 216 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 217 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 218 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 245 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 375 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 376 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 377 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 378 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 379 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 381 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 382 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 383 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 384 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 385 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 386 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 392 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 393 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 395 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 396 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 401 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 402 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 403 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 404 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 405 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 406 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 407 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 408 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 409 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 410 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 411 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 412 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 413 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 414 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 415 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 416 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 417 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 418 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 419 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 420 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 421 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 422 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 423 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 424 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 425 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 426 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.27 |
| Metatranscriptomes | 0 |
| Isolates | 24.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.48 |
| Nodule | 18.8 |
| Rhizoplane | 7.56 |
| Rhizosphere | 49.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000004 | 3300003203 | Bacteria | 149772 |
| 2 | JGI25153J46596_10007377 | 3300003215 | Bacteria | 5421 |
| 3 | rootH2_10026632 | 3300003320 | Bacteria | 1037 |
| 4 | JGI25160J50197_1002741 | 3300003354 | Bacteria | 8085 |
| 5 | Ga0055531_10009470 | 3300003794 | Bacteria | 4975 |
| 6 | Ga0065165_1000435 | 3300005262 | Bacteria | 65756 |
| 7 | Ga0065165_1011997 | 3300005262 | Bacteria | 3561 |
| 8 | Ga0070658_10077697 | 3300005327 | Bacteria | 2723 |
| 9 | Ga0070676_10025156 | 3300005328 | Bacteria | 3362 |
| 10 | Ga0070670_100458234 | 3300005331 | Bacteria | 1131 |
| 11 | Ga0070666_10364212 | 3300005335 | Bacteria | 1036 |
| 12 | Ga0070682_100085840 | 3300005337 | Bacteria | 2048 |
| 13 | Ga0070687_100274155 | 3300005343 | Bacteria | 1059 |
| 14 | Ga0070661_100049681 | 3300005344 | Bacteria | 3071 |
| 15 | Ga0070675_100171626 | 3300005354 | Bacteria | 1870 |
| 16 | Ga0070659_100407998 | 3300005366 | Bacteria | 1148 |
| 17 | Ga0070714_100431734 | 3300005435 | Bacteria | 1249 |
| 18 | Ga0070713_100005205 | 3300005436 | Bacteria | 8859 |
| 19 | Ga0070713_101013794 | 3300005436 | Bacteria | 801 |
| 20 | Ga0070710_10004671 | 3300005437 | Bacteria | 6478 |
| 21 | Ga0070663_100152010 | 3300005455 | Bacteria | 1776 |
| 22 | Ga0070663_100412267 | 3300005455 | Bacteria | 1106 |
| 23 | Ga0070678_100678398 | 3300005456 | Bacteria | 926 |
| 24 | Ga0070698_100336952 | 3300005471 | Bacteria | 1440 |
| 25 | Ga0068853_100217134 | 3300005539 | Bacteria | 1745 |
| 26 | Ga0068853_100384823 | 3300005539 | Bacteria | 1311 |
| 27 | Ga0070665_100113799 | 3300005548 | Bacteria | 2708 |
| 28 | Ga0070665_100266138 | 3300005548 | Bacteria | 1716 |
| 29 | Ga0070665_100293077 | 3300005548 | Bacteria | 1629 |
| 30 | Ga0070665_100432897 | 3300005548 | Bacteria | 1324 |
| 31 | Ga0068855_100153318 | 3300005563 | Bacteria | 2619 |
| 32 | Ga0070664_100483579 | 3300005564 | Bacteria | 1139 |
| 33 | Ga0068857_100088782 | 3300005577 | Bacteria | 2766 |
| 34 | Ga0068856_100020962 | 3300005614 | Bacteria | 6351 |
| 35 | Ga0068852_100052999 | 3300005616 | Bacteria | 3490 |
| 36 | Ga0068852_100196056 | 3300005616 | Bacteria | 1908 |
| 37 | Ga0068861_100147185 | 3300005719 | Bacteria | 1928 |
| 38 | Ga0068861_100815800 | 3300005719 | Bacteria | 877 |
| 39 | Ga0068870_10444016 | 3300005840 | Bacteria | 854 |
| 40 | Ga0068863_100321690 | 3300005841 | Bacteria | 1503 |
| 41 | Ga0068863_100593115 | 3300005841 | Bacteria | 1096 |
| 42 | Ga0068858_100179490 | 3300005842 | Bacteria | 1998 |
| 43 | Ga0068858_100202284 | 3300005842 | Bacteria | 1878 |
| 44 | Ga0068862_100164855 | 3300005844 | Bacteria | 1980 |
| 45 | Ga0081540_1002798 | 3300005983 | Bacteria | 14141 |
| 46 | Ga0081539_10000080 | 3300005985 | Bacteria | 222745 |
| 47 | Ga0081539_10030484 | 3300005985 | Bacteria | 3346 |
| 48 | Ga0081539_10064174 | 3300005985 | Bacteria | 2000 |
| 49 | Ga0070717_10094917 | 3300006028 | Bacteria | 2524 |
| 50 | Ga0075365_10107920 | 3300006038 | Bacteria | 1911 |
| 51 | Ga0075368_10020559 | 3300006042 | Bacteria | 2501 |
| 52 | Ga0075364_10276958 | 3300006051 | Bacteria | 1141 |
| 53 | Ga0070715_10007314 | 3300006163 | Bacteria | 3798 |
| 54 | Ga0070716_100015184 | 3300006173 | Bacteria | 3952 |
| 55 | Ga0070716_100250218 | 3300006173 | Bacteria | 1207 |
| 56 | Ga0070712_100007796 | 3300006175 | Bacteria | 6702 |
| 57 | Ga0070712_100420120 | 3300006175 | Bacteria | 1108 |
| 58 | Ga0075367_10042634 | 3300006178 | Bacteria | 2656 |
| 59 | Ga0075366_10058309 | 3300006195 | Bacteria | 2293 |
| 60 | Ga0075366_10206750 | 3300006195 | Bacteria | 1194 |
| 61 | Ga0075366_10222631 | 3300006195 | Bacteria | 1150 |
| 62 | Ga0075370_10010462 | 3300006353 | Bacteria | 4852 |
| 63 | Ga0075370_10060841 | 3300006353 | Bacteria | 2151 |
| 64 | Ga0075370_10074957 | 3300006353 | Bacteria | 1939 |
| 65 | Ga0099824_1027854 | 3300006942 | Bacteria | 2657 |
| 66 | Ga0105240_10376054 | 3300009093 | Bacteria | 1605 |
| 67 | Ga0105247_10039053 | 3300009101 | Bacteria | 2900 |
| 68 | Ga0105247_10110304 | 3300009101 | Bacteria | 1770 |
| 69 | Ga0105247_10132668 | 3300009101 | Bacteria | 1625 |
| 70 | Ga0105241_10360894 | 3300009174 | Bacteria | 1264 |
| 71 | Ga0105248_10234747 | 3300009177 | Bacteria | 2064 |
| 72 | Ga0105248_10840445 | 3300009177 | Bacteria | 1036 |
| 73 | Ga0105237_10007285 | 3300009545 | Bacteria | 12135 |
| 74 | Ga0105237_10031690 | 3300009545 | Bacteria | 5354 |
| 75 | Ga0105237_10107116 | 3300009545 | Bacteria | 2787 |
| 76 | Ga0105237_10478088 | 3300009545 | Bacteria | 1252 |
| 77 | Ga0105238_10056315 | 3300009551 | Bacteria | 3945 |
| 78 | Ga0105238_11039658 | 3300009551 | Bacteria | 841 |
| 79 | Ga0105239_10075990 | 3300010375 | Bacteria | 3694 |
| 80 | Ga0105239_10351163 | 3300010375 | Bacteria | 1665 |
| 81 | Ga0105239_10405002 | 3300010375 | Bacteria | 1544 |
| 82 | Ga0105246_10047878 | 3300011119 | Bacteria | 2922 |
| 83 | Ga0157314_1003922 | 3300012500 | Bacteria | 1075 |
| 84 | Ga0157378_10070844 | 3300013297 | Bacteria | 3130 |
| 85 | Ga0157378_10198845 | 3300013297 | Bacteria | 1895 |
| 86 | Ga0163162_10115535 | 3300013306 | Bacteria | 2784 |
| 87 | Ga0157372_10914876 | 3300013307 | Bacteria | 1017 |
| 88 | Ga0163163_10088422 | 3300014325 | Bacteria | 3109 |
| 89 | Ga0163163_10755278 | 3300014325 | Bacteria | 1036 |
| 90 | Ga0157379_10556011 | 3300014968 | Bacteria | 1068 |
| 91 | Ga0163161_10261546 | 3300017792 | Bacteria | 1351 |
| 92 | Ga0214544_1001370 | 3300021320 | Bacteria | 50261 |
| 93 | Ga0214542_1000153 | 3300021321 | Bacteria | 101854 |
| 94 | Ga0214545_1000018 | 3300021324 | Bacteria | 172019 |
| 95 | Ga0214543_1005445 | 3300021327 | Bacteria | 23409 |
| 96 | Ga0209677_103529 | 3300025253 | Bacteria | 5008 |
| 97 | Ga0209233_1003425 | 3300025261 | Bacteria | 5590 |
| 98 | Ga0209233_1019951 | 3300025261 | Bacteria | 1769 |
| 99 | Ga0209673_1018472 | 3300025273 | Bacteria | 2534 |
| 100 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 101 | Ga0209758_1000211 | 3300025297 | Bacteria | 127721 |
| 102 | Ga0209758_1006738 | 3300025297 | Bacteria | 8082 |
| 103 | Ga0209758_1019966 | 3300025297 | Bacteria | 3198 |
| 104 | Ga0207426_1004377 | 3300025302 | Bacteria | 6929 |
| 105 | Ga0207426_1012187 | 3300025302 | Bacteria | 3241 |
| 106 | Ga0209257_1008824 | 3300025304 | Bacteria | 5579 |
| 107 | Ga0209257_1014097 | 3300025304 | Bacteria | 3472 |
| 108 | Ga0207692_10011132 | 3300025898 | Bacteria | 3813 |
| 109 | Ga0207647_10002611 | 3300025904 | Bacteria | 13619 |
| 110 | Ga0207685_10017068 | 3300025905 | Bacteria | 2338 |
| 111 | Ga0207699_10012020 | 3300025906 | Bacteria | 4393 |
| 112 | Ga0207705_10057685 | 3300025909 | Bacteria | 2800 |
| 113 | Ga0207705_10122063 | 3300025909 | Bacteria | 1934 |
| 114 | Ga0207671_10022626 | 3300025914 | Bacteria | 4748 |
| 115 | Ga0207671_10163325 | 3300025914 | Bacteria | 1726 |
| 116 | Ga0207671_10260732 | 3300025914 | Bacteria | 1364 |
| 117 | Ga0207693_10002655 | 3300025915 | Bacteria | 15538 |
| 118 | Ga0207663_10002699 | 3300025916 | Bacteria | 8560 |
| 119 | Ga0207662_10186695 | 3300025918 | Bacteria | 1336 |
| 120 | Ga0207657_10106111 | 3300025919 | Bacteria | 2325 |
| 121 | Ga0207649_10080147 | 3300025920 | Bacteria | 2111 |
| 122 | Ga0207694_10565215 | 3300025924 | Bacteria | 955 |
| 123 | Ga0207659_10305961 | 3300025926 | Bacteria | 1307 |
| 124 | Ga0207700_10025335 | 3300025928 | Bacteria | 4117 |
| 125 | Ga0207664_10020349 | 3300025929 | Bacteria | 4917 |
| 126 | Ga0207664_10288779 | 3300025929 | Bacteria | 1441 |
| 127 | Ga0207644_10064026 | 3300025931 | Bacteria | 2671 |
| 128 | Ga0207706_10060148 | 3300025933 | Bacteria | 3346 |
| 129 | Ga0207709_10121510 | 3300025935 | Bacteria | 1764 |
| 130 | Ga0207665_10001529 | 3300025939 | Bacteria | 15562 |
| 131 | Ga0207667_10580977 | 3300025949 | Bacteria | 1131 |
| 132 | Ga0207640_10203949 | 3300025981 | Bacteria | 1501 |
| 133 | Ga0207658_10074115 | 3300025986 | Bacteria | 2586 |
| 134 | Ga0207703_10207725 | 3300026035 | Bacteria | 1744 |
| 135 | Ga0207703_10405533 | 3300026035 | Bacteria | 1265 |
| 136 | Ga0207639_10611015 | 3300026041 | Bacteria | 1006 |
| 137 | Ga0207678_10040313 | 3300026067 | Bacteria | 4051 |
| 138 | Ga0207678_10498677 | 3300026067 | Bacteria | 1061 |
| 139 | Ga0207702_10302804 | 3300026078 | Bacteria | 1517 |
| 140 | Ga0207641_10646000 | 3300026088 | Bacteria | 1039 |
| 141 | Ga0207675_100380325 | 3300026118 | Bacteria | 1388 |
| 142 | Ga0207675_100940720 | 3300026118 | Bacteria | 881 |
| 143 | Ga0207698_10348895 | 3300026142 | Bacteria | 1397 |
| 144 | Ga0207698_10659110 | 3300026142 | Bacteria | 1037 |
| 145 | Ga0209389_1000495 | 3300027296 | Bacteria | 23648 |
| 146 | Ga0209589_1000072 | 3300027357 | Bacteria | 98789 |
| 147 | Ga0209489_100031 | 3300027361 | Bacteria | 184074 |
| 148 | Ga0209813_10040665 | 3300027866 | Bacteria | 1414 |
| 149 | Ga0268266_10016444 | 3300028379 | Bacteria | 6323 |
| 150 | Ga0268266_10126801 | 3300028379 | Bacteria | 2279 |
| 151 | Ga0268266_10224646 | 3300028379 | Bacteria | 1727 |
| 152 | Ga0268266_10322331 | 3300028379 | Bacteria | 1446 |
| 153 | Ga0268266_10418050 | 3300028379 | Bacteria | 1270 |
| 154 | Ga0268266_10419759 | 3300028379 | Bacteria | 1267 |
| 155 | Ga0268265_10530671 | 3300028380 | Bacteria | 1114 |
| 156 | Ga0268265_10730839 | 3300028380 | Bacteria | 959 |
| 157 | Ga0268264_11215916 | 3300028381 | Bacteria | 763 |
| 158 | Ga0307513_10345631 | 3300031456 | Bacteria | 1237 |
| 159 | Ga0307516_10436186 | 3300031730 | Bacteria | 967 |
| 160 | Ga0307405_10460782 | 3300031731 | Bacteria | 1010 |
| 161 | Ga0307413_10103301 | 3300031824 | Bacteria | 1889 |
| 162 | Ga0307410_10780919 | 3300031852 | Bacteria | 811 |
| 163 | Ga0307409_100282604 | 3300031995 | Bacteria | 1535 |
| 164 | Ga0307409_100466353 | 3300031995 | Bacteria | 1222 |
| 165 | Ga0307411_10533915 | 3300032005 | Bacteria | 998 |
| 166 | Ga0307415_100240509 | 3300032126 | Bacteria | 1464 |
| 167 | Ga0307510_10042971 | 3300033180 | Bacteria | 4917 |
| 168 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 169 | Ga0373936_0006070 | 3300035113 | Bacteria | 4552 |
| 170 | Ga0373936_0141525 | 3300035113 | Bacteria | 1039 |
| 171 | Ga0373945_0015147 | 3300035116 | Bacteria | 2592 |
| 172 | Ga0373954_0024565 | 3300035118 | Bacteria | 2748 |
| 173 | Ga0373935_0009202 | 3300035692 | Bacteria | 5912 |
| 174 | Ga0373927_0201066 | 3300035695 | Bacteria | 1308 |
| 175 | Ga0373937_0049573 | 3300036401 | Bacteria | 3845 |
| 176 | Ga0373925_0006309 | 3300037068 | Bacteria | 8734 |
| 177 | Ga0395899_0801852 | 3300037312 | Bacteria | 582 |
| 178 | Ga0395905_0040435 | 3300037471 | Bacteria | 4374 |
| 179 | Ga0395901_0173823 | 3300038443 | Bacteria | 2260 |
| 180 | Ga0451787_239584 | 3300041441 | Bacteria | 828 |
| 181 | Ga0451793_1082569 | 3300041452 | Bacteria | 893 |
| 182 | Ga0451793_1166649 | 3300041452 | Bacteria | 2829 |
| 183 | Ga0451798_0180606 | 3300041458 | Bacteria | 1191 |
| 184 | Ga0439448_0105831 | 3300042005 | Bacteria | 959 |
| 185 | Ga0466972_0000188 | 3300044658 | Bacteria | 47766 |
| 186 | Ga0466972_0001486 | 3300044658 | Bacteria | 11399 |
| 187 | Ga0466972_0053744 | 3300044658 | Bacteria | 1939 |
| 188 | Ga0466972_0188089 | 3300044658 | Bacteria | 968 |
| 189 | Ga0466971_0265095 | 3300044719 | Bacteria | 820 |
| 190 | Ga0466968_0008336 | 3300044735 | Bacteria | 3967 |
| 191 | Ga0466970_0053067 | 3300044765 | Bacteria | 2165 |
| 192 | Ga0466970_0125112 | 3300044765 | Bacteria | 1410 |
| 193 | Ga0466957_0287156 | 3300044842 | Bacteria | 1102 |
| 194 | Ga0466960_0017846 | 3300044901 | Bacteria | 3102 |
| 195 | Ga0466960_0106207 | 3300044901 | Bacteria | 1452 |
| 196 | Ga0495592_0139834 | 3300046454 | Bacteria | 1685 |
| 197 | Ga0495592_0276179 | 3300046454 | Bacteria | 1100 |
| 198 | Ga0495603_0000160 | 3300046455 | Bacteria | 33986 |
| 199 | Ga0495603_0008023 | 3300046455 | Bacteria | 6375 |
| 200 | Ga0495603_0019910 | 3300046455 | Bacteria | 4064 |
| 201 | Ga0495603_0310753 | 3300046455 | Bacteria | 905 |
| 202 | Ga0495590_0036012 | 3300046457 | Bacteria | 1726 |
| 203 | Ga0495629_0000155 | 3300046459 | Bacteria | 60057 |
| 204 | Ga0495641_0007890 | 3300046461 | Bacteria | 6574 |
| 205 | Ga0495651_0010063 | 3300046462 | Bacteria | 7265 |
| 206 | Ga0495653_0072411 | 3300046463 | Bacteria | 2573 |
| 207 | Ga0495580_0009027 | 3300046472 | Bacteria | 7871 |
| 208 | Ga0495580_0165291 | 3300046472 | Bacteria | 1531 |
| 209 | Ga0495582_0000866 | 3300046473 | Bacteria | 16777 |
| 210 | Ga0495582_0296021 | 3300046473 | Bacteria | 930 |
| 211 | Ga0495605_0057604 | 3300046474 | Bacteria | 1869 |
| 212 | Ga0495662_0104931 | 3300046476 | Bacteria | 1383 |
| 213 | Ga0495664_0006573 | 3300046477 | Bacteria | 6425 |
| 214 | Ga0495664_0036827 | 3300046477 | Bacteria | 2885 |
| 215 | Ga0495664_0120328 | 3300046477 | Bacteria | 1588 |
| 216 | Ga0495585_0069735 | 3300046492 | Bacteria | 1918 |
| 217 | Ga0495585_0079428 | 3300046492 | Bacteria | 1779 |
| 218 | Ga0495585_0092686 | 3300046492 | Bacteria | 1625 |
| 219 | Ga0495594_0000042 | 3300046499 | Bacteria | 55641 |
| 220 | Ga0495606_0002525 | 3300046507 | Bacteria | 21061 |
| 221 | Ga0495606_0236335 | 3300046507 | Bacteria | 1021 |
| 222 | Ga0495606_0357268 | 3300046507 | Bacteria | 773 |
| 223 | Ga0495608_0087971 | 3300046511 | Bacteria | 2011 |
| 224 | Ga0495610_0048264 | 3300046512 | Bacteria | 2091 |
| 225 | Ga0495616_0040710 | 3300046513 | Bacteria | 2372 |
| 226 | Ga0495618_0176302 | 3300046514 | Bacteria | 1359 |
| 227 | Ga0495628_0166273 | 3300046516 | Bacteria | 1674 |
| 228 | Ga0495632_0047252 | 3300046519 | Bacteria | 2135 |
| 229 | Ga0495643_0027359 | 3300046522 | Bacteria | 3206 |
| 230 | Ga0495643_0233088 | 3300046522 | Bacteria | 867 |
| 231 | Ga0495644_0122832 | 3300046523 | Bacteria | 988 |
| 232 | Ga0495648_0124268 | 3300046524 | Bacteria | 1381 |
| 233 | Ga0495642_0049692 | 3300046528 | Bacteria | 1723 |
| 234 | Ga0495642_0099958 | 3300046528 | Bacteria | 1234 |
| 235 | Ga0495652_0050583 | 3300046529 | Bacteria | 3552 |
| 236 | Ga0495652_0208197 | 3300046529 | Bacteria | 1479 |
| 237 | Ga0495654_0074481 | 3300046530 | Bacteria | 1603 |
| 238 | Ga0495665_0002439 | 3300046531 | Bacteria | 10048 |
| 239 | Ga0495640_0007997 | 3300046533 | Bacteria | 8311 |
| 240 | Ga0495640_0036750 | 3300046533 | Bacteria | 3458 |
| 241 | Ga0495598_0013678 | 3300046537 | Bacteria | 2017 |
| 242 | Ga0495598_0047481 | 3300046537 | Bacteria | 1280 |
| 243 | Ga0495609_0020159 | 3300046538 | Bacteria | 3081 |
| 244 | Ga0495597_0045794 | 3300046542 | Bacteria | 1940 |
| 245 | Ga0495645_0159849 | 3300046543 | Bacteria | 1558 |
| 246 | Ga0495622_0003165 | 3300046557 | Bacteria | 7793 |
| 247 | Ga0495622_0059705 | 3300046557 | Bacteria | 1765 |
| 248 | Ga0495633_0055335 | 3300046558 | Bacteria | 1865 |
| 249 | Ga0495667_0007085 | 3300046559 | Bacteria | 7606 |
| 250 | Ga0495656_0025218 | 3300046615 | Bacteria | 2355 |
| 251 | Ga0495634_0000798 | 3300046642 | Bacteria | 30556 |
| 252 | Ga0495634_0081679 | 3300046642 | Bacteria | 2113 |
| 253 | Ga0495635_0003922 | 3300046663 | Bacteria | 10342 |
| 254 | Ga0495661_0233630 | 3300046665 | Bacteria | 947 |
| 255 | Ga0495588_0005942 | 3300046674 | Bacteria | 5471 |
| 256 | Ga0495588_0075666 | 3300046674 | Bacteria | 1754 |
| 257 | Ga0495657_0002141 | 3300046675 | Bacteria | 16768 |
| 258 | Ga0495623_0007037 | 3300046679 | Bacteria | 7309 |
| 259 | Ga0495647_0000396 | 3300046681 | Bacteria | 12448 |
| 260 | Ga0495658_0000434 | 3300046683 | Bacteria | 23322 |
| 261 | Ga0495669_0056752 | 3300046684 | Bacteria | 1765 |
| 262 | Ga0495669_0157432 | 3300046684 | Bacteria | 1077 |
| 263 | Ga0495613_0090928 | 3300046689 | Bacteria | 2210 |
| 264 | Ga0495613_0428972 | 3300046689 | Bacteria | 898 |
| 265 | Ga0495624_0002112 | 3300046690 | Bacteria | 15160 |
| 266 | Ga0495589_0162725 | 3300046794 | Bacteria | 1063 |
| 267 | Ga0495589_0162766 | 3300046794 | Bacteria | 1062 |
| 268 | Ga0495581_0000239 | 3300047315 | Bacteria | 26032 |
| 269 | Ga0495581_0273387 | 3300047315 | Bacteria | 988 |
| 270 | Ga0495604_0004398 | 3300047317 | Bacteria | 11154 |
| 271 | Ga0495604_0139204 | 3300047317 | Bacteria | 1736 |
| 272 | Ga0495674_0001352 | 3300047319 | Bacteria | 23898 |
| 273 | Ga0495674_0041024 | 3300047319 | Bacteria | 4137 |
| 274 | Ga0495672_0078633 | 3300047320 | Bacteria | 1844 |
| 275 | Ga0495676_0054226 | 3300047321 | Bacteria | 3188 |
| 276 | Ga0495680_0007089 | 3300047322 | Bacteria | 10322 |
| 277 | Ga0495687_032219 | 3300047443 | Bacteria | 2395 |
| 278 | Ga0495675_0007985 | 3300047444 | Bacteria | 6546 |
| 279 | Ga0495681_0071270 | 3300047470 | Bacteria | 1574 |
| 280 | Ga0495684_0001910 | 3300047471 | Bacteria | 16717 |
| 281 | Ga0495593_0000013 | 3300047673 | Bacteria | 82874 |
| 282 | Ga0495602_0019341 | 3300048088 | Bacteria | 6764 |
| 283 | Ga0495602_0298318 | 3300048088 | Bacteria | 1180 |
| 284 | Ga0495626_0067469 | 3300048091 | Bacteria | 1615 |
| 285 | Ga0496101_0048646 | 3300048904 | Bacteria | 3048 |
| 286 | Ga0496101_0468943 | 3300048904 | Bacteria | 994 |
| 287 | Ga0496102_0014768 | 3300048905 | Bacteria | 6791 |
| 288 | Ga0496102_0109224 | 3300048905 | Bacteria | 2577 |
| 289 | Ga0496102_0327161 | 3300048905 | Bacteria | 1444 |
| 290 | Ga0496102_0451342 | 3300048905 | Bacteria | 1206 |
| 291 | Ga0496103_0010689 | 3300048906 | Bacteria | 5430 |
| 292 | Ga0496103_0350139 | 3300048906 | Bacteria | 950 |
| 293 | Ga0496104_0059024 | 3300048907 | Bacteria | 3632 |
| 294 | Ga0496104_0096243 | 3300048907 | Bacteria | 2832 |
| 295 | Ga0496104_0901843 | 3300048907 | Bacteria | 789 |
| 296 | Ga0496105_0106873 | 3300048908 | Bacteria | 2310 |
| 297 | Ga0496105_0230021 | 3300048908 | Bacteria | 1507 |
| 298 | Ga0496106_0014945 | 3300048909 | Bacteria | 5743 |
| 299 | Ga0496106_0194903 | 3300048909 | Bacteria | 1611 |
| 300 | Ga0496106_0343202 | 3300048909 | Bacteria | 1199 |
| 301 | Ga0496106_0736687 | 3300048909 | Bacteria | 784 |
| 302 | Ga0496107_0091489 | 3300048910 | Bacteria | 2223 |
| 303 | Ga0496108_0028358 | 3300048911 | Bacteria | 4631 |
| 304 | Ga0496108_0030420 | 3300048911 | Bacteria | 4475 |
| 305 | Ga0496109_0011290 | 3300048912 | Bacteria | 7671 |
| 306 | Ga0496109_0115702 | 3300048912 | Bacteria | 2495 |
| 307 | Ga0496109_0718516 | 3300048912 | Bacteria | 937 |
| 308 | Ga0496110_0096823 | 3300048913 | Bacteria | 2644 |
| 309 | Ga0496110_0787130 | 3300048913 | Bacteria | 855 |
| 310 | Ga0496111_0125393 | 3300048914 | Bacteria | 1897 |
| 311 | Ga0496111_0266991 | 3300048914 | Bacteria | 1269 |
| 312 | Ga0496112_0000009 | 3300048915 | Bacteria | 299708 |
| 313 | Ga0496112_0025787 | 3300048915 | Bacteria | 5647 |
| 314 | Ga0496112_0091026 | 3300048915 | Bacteria | 3019 |
| 315 | Ga0496112_0190074 | 3300048915 | Bacteria | 2015 |
| 316 | Ga0496112_0363285 | 3300048915 | Bacteria | 1389 |
| 317 | Ga0496112_0829878 | 3300048915 | Bacteria | 848 |
| 318 | Ga0496113_0121356 | 3300048916 | Bacteria | 2044 |
| 319 | Ga0496113_0220170 | 3300048916 | Bacteria | 1512 |
| 320 | Ga0496114_0079575 | 3300048917 | Bacteria | 2767 |
| 321 | Ga0496115_0086316 | 3300048918 | Bacteria | 2560 |
| 322 | Ga0496115_0145521 | 3300048918 | Bacteria | 1956 |
| 323 | Ga0496116_0148110 | 3300048919 | Bacteria | 1309 |
| 324 | Ga0496117_0113420 | 3300048920 | Bacteria | 1683 |
| 325 | Ga0496117_0164358 | 3300048920 | Bacteria | 1296 |
| 326 | Ga0496118_0030011 | 3300048921 | Bacteria | 4549 |
| 327 | Ga0496118_0219241 | 3300048921 | Bacteria | 1109 |
| 328 | Ga0496119_0135252 | 3300048922 | Bacteria | 1338 |
| 329 | Ga0496119_0177963 | 3300048922 | Bacteria | 1118 |
| 330 | Ga0496120_0056663 | 3300048923 | Bacteria | 2210 |
| 331 | Ga0496120_0219524 | 3300048923 | Bacteria | 909 |
| 332 | Ga0496121_0097875 | 3300048924 | Bacteria | 2272 |
| 333 | Ga0496121_0117109 | 3300048924 | Bacteria | 2019 |
| 334 | Ga0496121_0221479 | 3300048924 | Bacteria | 1332 |
| 335 | Ga0496121_0359811 | 3300048924 | Bacteria | 966 |
| 336 | Ga0496124_0016895 | 3300048927 | Bacteria | 6915 |
| 337 | Ga0496124_0149140 | 3300048927 | Bacteria | 1837 |
| 338 | Ga0496124_0405341 | 3300048927 | Bacteria | 945 |
| 339 | Ga0496125_0033268 | 3300048928 | Bacteria | 4565 |
| 340 | Ga0496126_0006548 | 3300048929 | Bacteria | 12967 |
| 341 | Ga0496126_0055001 | 3300048929 | Bacteria | 3602 |
| 342 | Ga0496126_0060317 | 3300048929 | Bacteria | 3412 |
| 343 | Ga0496126_0344721 | 3300048929 | Bacteria | 1220 |
| 344 | Ga0495678_047912 | 3300049459 | Bacteria | 1670 |
| 345 | Ga0495682_0052111 | 3300049460 | Bacteria | 1487 |
| 346 | Ga0501031_0000775 | 3300049568 | Bacteria | 19167 |
| 347 | Ga0501033_0000408 | 3300049570 | Bacteria | 41114 |
| 348 | Ga0501033_0006452 | 3300049570 | Bacteria | 9178 |
| 349 | Ga0501034_0209552 | 3300049571 | Bacteria | 1904 |
| 350 | Ga0501037_0000122 | 3300049573 | Bacteria | 72764 |
| 351 | Ga0501037_0018175 | 3300049573 | Bacteria | 5179 |
| 352 | Ga0501038_0007515 | 3300049574 | Bacteria | 10047 |
| 353 | Ga0501038_0180304 | 3300049574 | Bacteria | 1704 |
| 354 | Ga0501039_0003596 | 3300049575 | Bacteria | 11622 |
| 355 | Ga0501039_0177199 | 3300049575 | Bacteria | 1676 |
| 356 | Ga0501040_0349200 | 3300049576 | Bacteria | 1059 |
| 357 | Ga0501041_0072044 | 3300049577 | Bacteria | 2122 |
| 358 | Ga0501042_0006101 | 3300049578 | Bacteria | 7808 |
| 359 | Ga0501043_0006251 | 3300049579 | Bacteria | 9562 |
| 360 | Ga0501043_0240097 | 3300049579 | Bacteria | 1397 |
| 361 | Ga0501046_0015190 | 3300049580 | Bacteria | 6474 |
| 362 | Ga0501047_0144600 | 3300049581 | Bacteria | 2255 |
| 363 | Ga0501067_0067325 | 3300049583 | Bacteria | 1982 |
| 364 | Ga0501068_0019104 | 3300049584 | Bacteria | 3973 |
| 365 | Ga0501069_0010603 | 3300049585 | Bacteria | 4883 |
| 366 | Ga0501069_0036807 | 3300049585 | Bacteria | 2700 |
| 367 | Ga0501069_0084567 | 3300049585 | Bacteria | 1790 |
| 368 | Ga0501071_0067065 | 3300049587 | Bacteria | 2609 |
| 369 | Ga0501073_0021482 | 3300049589 | Bacteria | 4653 |
| 370 | Ga0501074_0011738 | 3300049590 | Bacteria | 6368 |
| 371 | Ga0501079_0116017 | 3300049741 | Bacteria | 2081 |
| 372 | Ga0501080_0828304 | 3300049742 | Bacteria | 810 |
| 373 | Ga0501083_0058075 | 3300049744 | Bacteria | 2589 |
| 374 | Ga0501035_0005412 | 3300049822 | Bacteria | 12068 |
| 375 | Ga0501035_0027858 | 3300049822 | Bacteria | 5162 |
| 376 | Ga0501035_0394303 | 3300049822 | Bacteria | 1152 |
| 377 | Ga0501044_0046551 | 3300049823 | Bacteria | 4489 |
| 378 | Ga0501045_0130554 | 3300049824 | Bacteria | 1867 |
| 379 | nmdc:mga03683_133025_c1 | 3300050489 | Bacteria | 1114 |
| 380 | nmdc:mga03n38_341327_c1 | 3300050490 | Bacteria | 813 |
| 381 | nmdc:mga00v17_282320_c1 | 3300050491 | Bacteria | 1078 |
| 382 | nmdc:mga00v17_64217_c1 | 3300050491 | Bacteria | 2262 |
| 383 | nmdc:mga0yw44_145701_c1 | 3300050492 | Bacteria | 1542 |
| 384 | nmdc:mga0yw44_265101_c1 | 3300050492 | Bacteria | 1146 |
| 385 | nmdc:mga0k408_164316_c1 | 3300050493 | Bacteria | 1323 |
| 386 | nmdc:mga06z11_109149_c1 | 3300050494 | Bacteria | 1530 |
| 387 | nmdc:mga06z11_86588_c1 | 3300050494 | Bacteria | 1693 |
| 388 | nmdc:mga04h51_11614_c1 | 3300050495 | Bacteria | 2450 |
| 389 | nmdc:mga07m45_103282_c1 | 3300050496 | Bacteria | 1638 |
| 390 | nmdc:mga07m45_33137_c1 | 3300050496 | Bacteria | 2868 |
| 391 | Ga0495655_0006847 | 3300053083 | Bacteria | 2093 |
| 392 | Ga0495655_0026246 | 3300053083 | Bacteria | 1371 |
| 393 | Ga0495619_0084829 | 3300053085 | Bacteria | 2138 |
| 394 | Ga0500578_0099998 | 3300053086 | Bacteria | 1836 |
| 395 | Ga0500646_0152008 | 3300053090 | Bacteria | 767 |
| 396 | Ga0500583_0003444 | 3300053092 | Bacteria | 4976 |
| 397 | Ga0500651_0122415 | 3300053093 | Bacteria | 1578 |
| 398 | Ga0500651_0316684 | 3300053093 | Bacteria | 892 |
| 399 | Ga0500566_0000407 | 3300053094 | Bacteria | 23864 |
| 400 | Ga0500566_0004841 | 3300053094 | Bacteria | 8028 |
| 401 | Ga0500641_0117315 | 3300053096 | Bacteria | 1146 |
| 402 | Ga0500554_018535 | 3300053102 | Bacteria | 1881 |
| 403 | Ga0500557_000002 | 3300053105 | Bacteria | 234207 |
| 404 | Ga0500572_001046 | 3300053111 | Bacteria | 8255 |
| 405 | Ga0500594_0035845 | 3300053118 | Bacteria | 1332 |
| 406 | Ga0500595_001199 | 3300053119 | Bacteria | 14322 |
| 407 | Ga0500595_002759 | 3300053119 | Bacteria | 8464 |
| 408 | Ga0500642_0000139 | 3300053130 | Bacteria | 32335 |
| 409 | Ga0500658_0019715 | 3300053134 | Bacteria | 2540 |
| 410 | Ga0500559_0000609 | 3300053136 | Bacteria | 24325 |
| 411 | Ga0500568_0037449 | 3300053139 | Bacteria | 1968 |
| 412 | Ga0500603_007329 | 3300053150 | Bacteria | 2420 |
| 413 | Ga0500622_0113289 | 3300053156 | Bacteria | 1323 |
| 414 | Ga0500638_009875 | 3300053162 | Bacteria | 4151 |
| 415 | Ga0500639_104340 | 3300053163 | Bacteria | 1389 |
| 416 | Ga0500636_0040334 | 3300053177 | Bacteria | 2761 |
| 417 | Ga0500636_0135011 | 3300053177 | Bacteria | 1371 |
| 418 | Ga0500636_0257337 | 3300053177 | Bacteria | 886 |
| 419 | Ga0500637_0003584 | 3300053178 | Bacteria | 7202 |
| 420 | Ga0500625_030542 | 3300053729 | Bacteria | 2557 |
| 421 | Ga0500645_061130 | 3300053730 | Bacteria | 1089 |
| 422 | Ga0500596_001736 | 3300053735 | Bacteria | 4407 |
| 423 | Ga0501084_0067729 | 3300054114 | Bacteria | 2988 |
| 424 | Ga0500661_000427 | 3300055283 | Bacteria | 7780 |
| 425 | Ga0500661_008524 | 3300055283 | Bacteria | 1886 |
| 426 | Ga0530510_0176688 | 3300061734 | Bacteria | 1583 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0801852 | Ga0395899_0801852_11_568 | 178 |
| 2 | 3300048927 | Ga0496124_0405341 | Ga0496124_0405341_365_928 | 182 |
| 3 | 3300053090 | Ga0500646_0152008 | Ga0500646_0152008_17_580 | 182 |
| 4 | 3300046665 | Ga0495661_0233630 | Ga0495661_0233630_369_932 | 184 |
| 5 | 3300048915 | Ga0496112_0190074 | Ga0496112_0190074_1162_1743 | 192 |
| 6 | 3300041452 | Ga0451793_1082569 | Ga0451793_1082569_189_791 | 196 |
| 7 | 3300044842 | Ga0466957_0287156 | Ga0466957_0287156_19_609 | 196 |
| 8 | 3300048924 | Ga0496121_0097875 | Ga0496121_0097875_1237_1842 | 201 |
| 9 | 3300005436 | Ga0070713_101013794 | Ga0070713_1010137941 | 213 |
| 10 | 3300005840 | Ga0068870_10444016 | Ga0068870_104440162 | 213 |
| 11 | 3300005262 | Ga0065165_1000435 | Ga0065165_100043525 | 215 |
| 12 | 3300025302 | Ga0207426_1012187 | Ga0207426_10121871 | 215 |
| 13 | iso_pu_bacteria | 2507262055 | 2507509006 | 219 |
| 14 | iso_pu_bacteria | 2508501009 | 2508543069 | 219 |
| 15 | iso_pu_bacteria | 2508501042 | 2508691200 | 219 |
| 16 | iso_pu_bacteria | 2511231028 | 2511394699 | 219 |
| 17 | iso_pu_bacteria | 2513237092 | 2513624369 | 219 |
| 18 | iso_pu_bacteria | 2513237095 | 2513650200 | 219 |
| 19 | iso_pu_bacteria | 2513237102 | 2513703284 | 219 |
| 20 | iso_pu_bacteria | 2513237139 | 2513872445 | 219 |
| 21 | iso_pu_bacteria | 2513237161 | 2514015995 | 219 |
| 22 | iso_pu_bacteria | 2515154112 | 2515626425 | 219 |
| 23 | iso_pu_bacteria | 2524023205 | 2524436925 | 219 |
| 24 | iso_pu_bacteria | 2617270735 | 2617348674 | 219 |
| 25 | iso_pu_bacteria | 2617270741 | 2617376133 | 219 |
| 26 | iso_pu_bacteria | 2744054633 | 2745080131 | 219 |
| 27 | iso_pu_bacteria | 2791355196 | 2793065867 | 219 |
| 28 | iso_pu_bacteria | 2802429603 | 2805917968 | 219 |
| 29 | iso_pu_bacteria | 2816332527 | 2818241276 | 219 |
| 30 | iso_pu_bacteria | 2824617872 | 2824623320 | 219 |
| 31 | iso_pu_bacteria | 2824626560 | 2824631304 | 219 |
| 32 | iso_pu_bacteria | 2824635225 | 2824638905 | 219 |
| 33 | iso_pu_bacteria | 2824644064 | 2824648933 | 219 |
| 34 | iso_pu_bacteria | 2824671348 | 2824676782 | 219 |
| 35 | iso_pu_bacteria | 2824679649 | 2824684029 | 219 |
| 36 | iso_pu_bacteria | 2824687955 | 2824693128 | 219 |
| 37 | iso_pu_bacteria | 2824696289 | 2824704324 | 219 |
| 38 | iso_pu_bacteria | 2824704595 | 2824708803 | 219 |
| 39 | iso_pu_bacteria | 2824714736 | 2824719036 | 219 |
| 40 | iso_pu_bacteria | 2824723954 | 2824732566 | 219 |
| 41 | iso_pu_bacteria | 2824732956 | 2824737009 | 219 |
| 42 | iso_pu_bacteria | 2824746037 | 2824749477 | 219 |
| 43 | iso_pu_bacteria | 2824753945 | 2824757182 | 219 |
| 44 | iso_pu_bacteria | 2824763712 | 2824766780 | 219 |
| 45 | iso_pu_bacteria | 2824773399 | 2824776455 | 219 |
| 46 | iso_pu_bacteria | 2838122688 | 2838124107 | 219 |
| 47 | iso_pu_bacteria | 2841941048 | 2841943765 | 219 |
| 48 | iso_pu_bacteria | 2841949485 | 2841950207 | 219 |
| 49 | iso_pu_bacteria | 2841966195 | 2841966600 | 219 |
| 50 | iso_pu_bacteria | 2841974524 | 2841975340 | 219 |
| 51 | iso_pu_bacteria | 2841983080 | 2841983095 | 219 |
| 52 | iso_pu_bacteria | 2842038055 | 2842039406 | 219 |
| 53 | iso_pu_bacteria | 2842045827 | 2842047648 | 219 |
| 54 | iso_pu_bacteria | 2847939898 | 2847946213 | 219 |
| 55 | iso_pu_bacteria | 2849076700 | 2849079639 | 219 |
| 56 | iso_pu_bacteria | 2857509624 | 2857513940 | 219 |
| 57 | iso_pu_bacteria | 2874590934 | 2874592666 | 219 |
| 58 | iso_pu_bacteria | 2874612657 | 2874616151 | 219 |
| 59 | iso_pu_bacteria | 2874620515 | 2874627457 | 219 |
| 60 | iso_pu_bacteria | 2874628541 | 2874629788 | 219 |
| 61 | iso_pu_bacteria | 2874645413 | 2874648297 | 219 |
| 62 | iso_pu_bacteria | 2876761206 | 2876767319 | 219 |
| 63 | iso_pu_bacteria | 2876771140 | 2876772879 | 219 |
| 64 | iso_pu_bacteria | 2876818435 | 2876820207 | 219 |
| 65 | iso_pu_bacteria | 2879074833 | 2879076710 | 219 |
| 66 | iso_pu_bacteria | 2879127579 | 2879131679 | 219 |
| 67 | iso_pu_bacteria | 2879142872 | 2879148028 | 219 |
| 68 | iso_pu_bacteria | 2881364244 | 2881371783 | 219 |
| 69 | iso_pu_bacteria | 2881665667 | 2881666416 | 219 |
| 70 | iso_pu_bacteria | 2885366525 | 2885372160 | 219 |
| 71 | iso_pu_bacteria | 2885409591 | 2885418935 | 219 |
| 72 | iso_pu_bacteria | 2888378607 | 2888383726 | 219 |
| 73 | iso_pu_bacteria | 2888388044 | 2888394250 | 219 |
| 74 | iso_pu_bacteria | 2888419890 | 2888424144 | 219 |
| 75 | iso_pu_bacteria | 2904666416 | 2904671025 | 219 |
| 76 | iso_pu_bacteria | 2904711408 | 2904720899 | 219 |
| 77 | iso_pu_bacteria | 2906626472 | 2906630039 | 219 |
| 78 | iso_pu_bacteria | 2922393267 | 2922396690 | 219 |
| 79 | iso_pu_bacteria | 2935608549 | 2935612147 | 219 |
| 80 | iso_pu_bacteria | 2935648319 | 2935649717 | 219 |
| 81 | iso_pu_bacteria | 2935656913 | 2935658768 | 219 |
| 82 | iso_pu_bacteria | 2935769743 | 2935774984 | 219 |
| 83 | iso_pu_bacteria | 2935777560 | 2935782643 | 219 |
| 84 | iso_pu_bacteria | 2935785616 | 2935791771 | 219 |
| 85 | iso_pu_bacteria | 2935793552 | 2935799997 | 219 |
| 86 | iso_pu_bacteria | 2935819856 | 2935821617 | 219 |
| 87 | iso_pu_bacteria | 2935847175 | 2935847218 | 219 |
| 88 | iso_pu_bacteria | 2935908558 | 2935914678 | 219 |
| 89 | iso_pu_bacteria | 2935916978 | 2935924855 | 219 |
| 90 | iso_pu_bacteria | 2935926038 | 2935932244 | 219 |
| 91 | iso_pu_bacteria | 2935934488 | 2935940842 | 219 |
| 92 | iso_pu_bacteria | 2935942939 | 2935948915 | 219 |
| 93 | iso_pu_bacteria | 2935951376 | 2935957473 | 219 |
| 94 | iso_pu_bacteria | 2935959822 | 2935960051 | 219 |
| 95 | iso_pu_bacteria | 2935967501 | 2935973920 | 219 |
| 96 | iso_pu_bacteria | 2935975950 | 2935977332 | 219 |
| 97 | iso_pu_bacteria | 2935984226 | 2935988525 | 219 |
| 98 | iso_pu_bacteria | 2936011229 | 2936012801 | 219 |
| 99 | iso_pu_bacteria | 2936019824 | 2936021365 | 219 |
| 100 | iso_pu_bacteria | 2936028420 | 2936030094 | 219 |
| 101 | iso_pu_bacteria | 2936046547 | 2936047559 | 219 |
| 102 | iso_pu_bacteria | 2936055302 | 2936057283 | 219 |
| 103 | iso_pu_bacteria | 3005483717 | 3005486930 | 219 |
| 104 | iso_pu_bacteria | 3005506211 | 3005510121 | 219 |
| 105 | iso_pu_bacteria | 3005587118 | 3005592465 | 219 |
| 106 | iso_pu_bacteria | 3005594810 | 3005598910 | 219 |
| 107 | iso_pu_bacteria | 3005710791 | 3005714502 | 219 |
| 108 | iso_pu_bacteria | 8016522445 | 8016530009 | 219 |
| 109 | iso_pu_bacteria | 8016530956 | 8016535245 | 219 |
| 110 | iso_pu_bacteria | 8016539877 | 8016548454 | 219 |
| 111 | iso_pu_bacteria | 8016548790 | 8016553674 | 219 |
| 112 | iso_pu_bacteria | 8016557553 | 8016562055 | 219 |
| 113 | iso_pu_bacteria | 8016575299 | 8016577712 | 219 |
| 114 | iso_pu_bacteria | 8016583857 | 8016592270 | 219 |
| 115 | iso_pu_bacteria | 8016595262 | 8016599878 | 219 |
| 116 | iso_pu_bacteria | 8016603502 | 8016610935 | 219 |
| 117 | iso_pu_bacteria | 8016622563 | 8016627026 | 219 |
| 118 | iso_pu_bacteria | 8016630954 | 8016640728 | 219 |
| 119 | iso_pu_bacteria | 8019530166 | 8019534997 | 219 |
| 120 | iso_pu_bacteria | 8019538911 | 8019544470 | 219 |
| 121 | iso_pu_bacteria | 8019547302 | 8019554122 | 219 |
| 122 | iso_pu_bacteria | 8019629233 | 8019634812 | 219 |
| 123 | iso_pu_bacteria | 8019638758 | 8019644888 | 219 |
| 124 | iso_pu_bacteria | 8019659431 | 8019662711 | 219 |
| 125 | iso_pu_bacteria | 8019668869 | 8019672322 | 219 |
| 126 | iso_pu_bacteria | 8019678201 | 8019683887 | 219 |
| 127 | iso_pu_bacteria | 8019687851 | 8019689627 | 219 |
| 128 | 3300053094 | Ga0500566_0004841 | Ga0500566_0004841_4911_5597 | 220 |
| 129 | 3300053102 | Ga0500554_018535 | Ga0500554_018535_478_1164 | 220 |
| 130 | 3300053119 | Ga0500595_002759 | Ga0500595_002759_3494_4180 | 220 |
| 131 | 3300053150 | Ga0500603_007329 | Ga0500603_007329_425_1111 | 220 |
| 132 | 3300053162 | Ga0500638_009875 | Ga0500638_009875_2847_3533 | 220 |
| 133 | 3300053178 | Ga0500637_0003584 | Ga0500637_0003584_4831_5517 | 220 |
| 134 | 3300055283 | Ga0500661_000427 | Ga0500661_000427_2236_2922 | 220 |
| 135 | iso_pu_bacteria | 2513237101 | 2513692186 | 221 |
| 136 | iso_pu_bacteria | 2721755755 | 2723845432 | 221 |
| 137 | iso_pu_bacteria | 8006926726 | 8006932335 | 221 |
| 138 | iso_pu_bacteria | 8006984368 | 8006993654 | 221 |
| 139 | iso_pu_bacteria | 8006994254 | 8007000138 | 221 |
| 140 | iso_pu_bacteria | 8056673599 | 8056674194 | 221 |
| 141 | 3300003215 | JGI25153J46596_10007377 | JGI25153J46596_100073774 | 223 |
| 142 | 3300003354 | JGI25160J50197_1002741 | JGI25160J50197_10027416 | 223 |
| 143 | 3300003794 | Ga0055531_10009470 | Ga0055531_100094703 | 223 |
| 144 | 3300005262 | Ga0065165_1011997 | Ga0065165_10119973 | 223 |
| 145 | 3300005327 | Ga0070658_10077697 | Ga0070658_100776972 | 223 |
| 146 | 3300005337 | Ga0070682_100085840 | Ga0070682_1000858402 | 223 |
| 147 | 3300005344 | Ga0070661_100049681 | Ga0070661_1000496812 | 223 |
| 148 | 3300005366 | Ga0070659_100407998 | Ga0070659_1004079982 | 223 |
| 149 | 3300005455 | Ga0070663_100152010 | Ga0070663_1001520102 | 223 |
| 150 | 3300005539 | Ga0068853_100384823 | Ga0068853_1003848232 | 223 |
| 151 | 3300005548 | Ga0070665_100113799 | Ga0070665_1001137992 | 223 |
| 152 | 3300005548 | Ga0070665_100266138 | Ga0070665_1002661382 | 223 |
| 153 | 3300005563 | Ga0068855_100153318 | Ga0068855_1001533182 | 223 |
| 154 | 3300005616 | Ga0068852_100196056 | Ga0068852_1001960562 | 223 |
| 155 | 3300005719 | Ga0068861_100815800 | Ga0068861_1008158001 | 223 |
| 156 | 3300005842 | Ga0068858_100179490 | Ga0068858_1001794902 | 223 |
| 157 | 3300006042 | Ga0075368_10020559 | Ga0075368_100205592 | 223 |
| 158 | 3300006051 | Ga0075364_10276958 | Ga0075364_102769582 | 223 |
| 159 | 3300006175 | Ga0070712_100420120 | Ga0070712_1004201202 | 223 |
| 160 | 3300006178 | Ga0075367_10042634 | Ga0075367_100426342 | 223 |
| 161 | 3300006195 | Ga0075366_10058309 | Ga0075366_100583092 | 223 |
| 162 | 3300006195 | Ga0075366_10222631 | Ga0075366_102226312 | 223 |
| 163 | 3300006353 | Ga0075370_10010462 | Ga0075370_100104624 | 223 |
| 164 | 3300006353 | Ga0075370_10074957 | Ga0075370_100749572 | 223 |
| 165 | 3300006942 | Ga0099824_1027854 | Ga0099824_10278542 | 223 |
| 166 | 3300009101 | Ga0105247_10132668 | Ga0105247_101326682 | 223 |
| 167 | 3300009174 | Ga0105241_10360894 | Ga0105241_103608942 | 223 |
| 168 | 3300009545 | Ga0105237_10031690 | Ga0105237_100316903 | 223 |
| 169 | 3300009551 | Ga0105238_11039658 | Ga0105238_110396581 | 223 |
| 170 | 3300010375 | Ga0105239_10351163 | Ga0105239_103511632 | 223 |
| 171 | 3300011119 | Ga0105246_10047878 | Ga0105246_100478781 | 223 |
| 172 | 3300012500 | Ga0157314_1003922 | Ga0157314_10039221 | 223 |
| 173 | 3300013306 | Ga0163162_10115535 | Ga0163162_101155352 | 223 |
| 174 | 3300014325 | Ga0163163_10088422 | Ga0163163_100884222 | 223 |
| 175 | 3300014968 | Ga0157379_10556011 | Ga0157379_105560112 | 223 |
| 176 | 3300021320 | Ga0214544_1001370 | Ga0214544_100137039 | 223 |
| 177 | 3300021321 | Ga0214542_1000153 | Ga0214542_100015315 | 223 |
| 178 | 3300021324 | Ga0214545_1000018 | Ga0214545_1000018127 | 223 |
| 179 | 3300021327 | Ga0214543_1005445 | Ga0214543_100544515 | 223 |
| 180 | 3300025253 | Ga0209677_103529 | Ga0209677_1035293 | 223 |
| 181 | 3300025261 | Ga0209233_1019951 | Ga0209233_10199512 | 223 |
| 182 | 3300025273 | Ga0209673_1018472 | Ga0209673_10184722 | 223 |
| 183 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021346 | 223 |
| 184 | 3300025297 | Ga0209758_1000211 | Ga0209758_100021150 | 223 |
| 185 | 3300025297 | Ga0209758_1006738 | Ga0209758_10067383 | 223 |
| 186 | 3300025302 | Ga0207426_1004377 | Ga0207426_10043773 | 223 |
| 187 | 3300025304 | Ga0209257_1008824 | Ga0209257_10088243 | 223 |
| 188 | 3300025304 | Ga0209257_1014097 | Ga0209257_10140972 | 223 |
| 189 | 3300025904 | Ga0207647_10002611 | Ga0207647_1000261119 | 223 |
| 190 | 3300025909 | Ga0207705_10122063 | Ga0207705_101220632 | 223 |
| 191 | 3300025919 | Ga0207657_10106111 | Ga0207657_101061112 | 223 |
| 192 | 3300025920 | Ga0207649_10080147 | Ga0207649_100801472 | 223 |
| 193 | 3300025931 | Ga0207644_10064026 | Ga0207644_100640262 | 223 |
| 194 | 3300025933 | Ga0207706_10060148 | Ga0207706_100601484 | 223 |
| 195 | 3300025935 | Ga0207709_10121510 | Ga0207709_101215102 | 223 |
| 196 | 3300025949 | Ga0207667_10580977 | Ga0207667_105809772 | 223 |
| 197 | 3300025981 | Ga0207640_10203949 | Ga0207640_102039492 | 223 |
| 198 | 3300025986 | Ga0207658_10074115 | Ga0207658_100741152 | 223 |
| 199 | 3300026035 | Ga0207703_10405533 | Ga0207703_104055332 | 223 |
| 200 | 3300026041 | Ga0207639_10611015 | Ga0207639_106110152 | 223 |
| 201 | 3300026067 | Ga0207678_10498677 | Ga0207678_104986772 | 223 |
| 202 | 3300026118 | Ga0207675_100940720 | Ga0207675_1009407202 | 223 |
| 203 | 3300026142 | Ga0207698_10659110 | Ga0207698_106591102 | 223 |
| 204 | 3300027296 | Ga0209389_1000495 | Ga0209389_100049511 | 223 |
| 205 | 3300027357 | Ga0209589_1000072 | Ga0209589_100007211 | 223 |
| 206 | 3300027361 | Ga0209489_100031 | Ga0209489_100031101 | 223 |
| 207 | 3300027866 | Ga0209813_10040665 | Ga0209813_100406652 | 223 |
| 208 | 3300028379 | Ga0268266_10126801 | Ga0268266_101268012 | 223 |
| 209 | 3300028380 | Ga0268265_10530671 | Ga0268265_105306712 | 223 |
| 210 | 3300037471 | Ga0395905_0040435 | Ga0395905_0040435_1981_2667 | 223 |
| 211 | 3300038443 | Ga0395901_0173823 | Ga0395901_0173823_1045_1737 | 223 |
| 212 | 3300041452 | Ga0451793_1166649 | Ga0451793_1166649_1797_2483 | 223 |
| 213 | 3300041458 | Ga0451798_0180606 | Ga0451798_0180606_256_942 | 223 |
| 214 | 3300042005 | Ga0439448_0105831 | Ga0439448_0105831_16_702 | 223 |
| 215 | 3300044658 | Ga0466972_0000188 | Ga0466972_0000188_10531_11217 | 223 |
| 216 | 3300044658 | Ga0466972_0001486 | Ga0466972_0001486_10377_11063 | 223 |
| 217 | 3300044658 | Ga0466972_0053744 | Ga0466972_0053744_678_1364 | 223 |
| 218 | 3300044658 | Ga0466972_0188089 | Ga0466972_0188089_109_795 | 223 |
| 219 | 3300044735 | Ga0466968_0008336 | Ga0466968_0008336_2692_3378 | 223 |
| 220 | 3300044765 | Ga0466970_0125112 | Ga0466970_0125112_107_793 | 223 |
| 221 | 3300044901 | Ga0466960_0017846 | Ga0466960_0017846_2101_2787 | 223 |
| 222 | 3300044901 | Ga0466960_0106207 | Ga0466960_0106207_61_747 | 223 |
| 223 | 3300046454 | Ga0495592_0139834 | Ga0495592_0139834_580_1266 | 223 |
| 224 | 3300046462 | Ga0495651_0010063 | Ga0495651_0010063_4809_5495 | 223 |
| 225 | 3300046463 | Ga0495653_0072411 | Ga0495653_0072411_341_1027 | 223 |
| 226 | 3300046476 | Ga0495662_0104931 | Ga0495662_0104931_523_1209 | 223 |
| 227 | 3300046477 | Ga0495664_0036827 | Ga0495664_0036827_885_1571 | 223 |
| 228 | 3300046507 | Ga0495606_0236335 | Ga0495606_0236335_300_986 | 223 |
| 229 | 3300046507 | Ga0495606_0357268 | Ga0495606_0357268_49_735 | 223 |
| 230 | 3300046511 | Ga0495608_0087971 | Ga0495608_0087971_673_1359 | 223 |
| 231 | 3300046512 | Ga0495610_0048264 | Ga0495610_0048264_1346_2032 | 223 |
| 232 | 3300046516 | Ga0495628_0166273 | Ga0495628_0166273_396_1082 | 223 |
| 233 | 3300046522 | Ga0495643_0027359 | Ga0495643_0027359_324_1010 | 223 |
| 234 | 3300046528 | Ga0495642_0099958 | Ga0495642_0099958_85_771 | 223 |
| 235 | 3300046533 | Ga0495640_0036750 | Ga0495640_0036750_69_755 | 223 |
| 236 | 3300046542 | Ga0495597_0045794 | Ga0495597_0045794_252_938 | 223 |
| 237 | 3300046543 | Ga0495645_0159849 | Ga0495645_0159849_435_1121 | 223 |
| 238 | 3300046642 | Ga0495634_0081679 | Ga0495634_0081679_754_1440 | 223 |
| 239 | 3300046675 | Ga0495657_0002141 | Ga0495657_0002141_14415_15101 | 223 |
| 240 | 3300046679 | Ga0495623_0007037 | Ga0495623_0007037_1953_2639 | 223 |
| 241 | 3300046689 | Ga0495613_0090928 | Ga0495613_0090928_1078_1764 | 223 |
| 242 | 3300047317 | Ga0495604_0004398 | Ga0495604_0004398_8287_8973 | 223 |
| 243 | 3300047319 | Ga0495674_0041024 | Ga0495674_0041024_2279_2965 | 223 |
| 244 | 3300047322 | Ga0495680_0007089 | Ga0495680_0007089_7219_7905 | 223 |
| 245 | 3300047443 | Ga0495687_032219 | Ga0495687_032219_1026_1712 | 223 |
| 246 | 3300047444 | Ga0495675_0007985 | Ga0495675_0007985_4359_5045 | 223 |
| 247 | 3300048088 | Ga0495602_0019341 | Ga0495602_0019341_3660_4346 | 223 |
| 248 | 3300048904 | Ga0496101_0048646 | Ga0496101_0048646_1793_2485 | 223 |
| 249 | 3300048905 | Ga0496102_0014768 | Ga0496102_0014768_3547_4233 | 223 |
| 250 | 3300048905 | Ga0496102_0451342 | Ga0496102_0451342_390_1082 | 223 |
| 251 | 3300048906 | Ga0496103_0010689 | Ga0496103_0010689_385_1071 | 223 |
| 252 | 3300048907 | Ga0496104_0059024 | Ga0496104_0059024_2297_2983 | 223 |
| 253 | 3300048907 | Ga0496104_0096243 | Ga0496104_0096243_1933_2625 | 223 |
| 254 | 3300048908 | Ga0496105_0106873 | Ga0496105_0106873_1224_1910 | 223 |
| 255 | 3300048908 | Ga0496105_0230021 | Ga0496105_0230021_188_880 | 223 |
| 256 | 3300048909 | Ga0496106_0014945 | Ga0496106_0014945_630_1322 | 223 |
| 257 | 3300048909 | Ga0496106_0343202 | Ga0496106_0343202_31_717 | 223 |
| 258 | 3300048910 | Ga0496107_0091489 | Ga0496107_0091489_1140_1832 | 223 |
| 259 | 3300048911 | Ga0496108_0028358 | Ga0496108_0028358_2052_2744 | 223 |
| 260 | 3300048911 | Ga0496108_0030420 | Ga0496108_0030420_2771_3457 | 223 |
| 261 | 3300048912 | Ga0496109_0011290 | Ga0496109_0011290_2288_2980 | 223 |
| 262 | 3300048912 | Ga0496109_0115702 | Ga0496109_0115702_400_1086 | 223 |
| 263 | 3300048913 | Ga0496110_0096823 | Ga0496110_0096823_415_1107 | 223 |
| 264 | 3300048914 | Ga0496111_0125393 | Ga0496111_0125393_966_1658 | 223 |
| 265 | 3300048914 | Ga0496111_0266991 | Ga0496111_0266991_254_940 | 223 |
| 266 | 3300048915 | Ga0496112_0025787 | Ga0496112_0025787_3073_3765 | 223 |
| 267 | 3300048915 | Ga0496112_0363285 | Ga0496112_0363285_361_1047 | 223 |
| 268 | 3300048916 | Ga0496113_0220170 | Ga0496113_0220170_586_1272 | 223 |
| 269 | 3300048918 | Ga0496115_0145521 | Ga0496115_0145521_855_1541 | 223 |
| 270 | 3300048920 | Ga0496117_0113420 | Ga0496117_0113420_595_1281 | 223 |
| 271 | 3300048920 | Ga0496117_0164358 | Ga0496117_0164358_518_1204 | 223 |
| 272 | 3300048921 | Ga0496118_0030011 | Ga0496118_0030011_2811_3497 | 223 |
| 273 | 3300048922 | Ga0496119_0177963 | Ga0496119_0177963_211_897 | 223 |
| 274 | 3300048923 | Ga0496120_0056663 | Ga0496120_0056663_1058_1744 | 223 |
| 275 | 3300048923 | Ga0496120_0219524 | Ga0496120_0219524_185_871 | 223 |
| 276 | 3300048927 | Ga0496124_0149140 | Ga0496124_0149140_882_1568 | 223 |
| 277 | 3300048929 | Ga0496126_0344721 | Ga0496126_0344721_463_1149 | 223 |
| 278 | 3300050489 | nmdc:mga03683_133025_c1 | nmdc:mga03683_133025_c1_243_929 | 223 |
| 279 | 3300050490 | nmdc:mga03n38_341327_c1 | nmdc:mga03n38_341327_c1_62_748 | 223 |
| 280 | 3300050491 | nmdc:mga00v17_282320_c1 | nmdc:mga00v17_282320_c1_186_872 | 223 |
| 281 | 3300050492 | nmdc:mga0yw44_145701_c1 | nmdc:mga0yw44_145701_c1_725_1411 | 223 |
| 282 | 3300050492 | nmdc:mga0yw44_265101_c1 | nmdc:mga0yw44_265101_c1_398_1084 | 223 |
| 283 | 3300050493 | nmdc:mga0k408_164316_c1 | nmdc:mga0k408_164316_c1_194_880 | 223 |
| 284 | 3300050494 | nmdc:mga06z11_86588_c1 | nmdc:mga06z11_86588_c1_624_1310 | 223 |
| 285 | 3300050495 | nmdc:mga04h51_11614_c1 | nmdc:mga04h51_11614_c1_258_944 | 223 |
| 286 | 3300050496 | nmdc:mga07m45_103282_c1 | nmdc:mga07m45_103282_c1_478_1164 | 223 |
| 287 | 3300053083 | Ga0495655_0026246 | Ga0495655_0026246_450_1136 | 223 |
| 288 | 3300053085 | Ga0495619_0084829 | Ga0495619_0084829_727_1413 | 223 |
| 289 | 3300053086 | Ga0500578_0099998 | Ga0500578_0099998_430_1116 | 223 |
| 290 | 3300053093 | Ga0500651_0316684 | Ga0500651_0316684_10_696 | 223 |
| 291 | 3300053094 | Ga0500566_0000407 | Ga0500566_0000407_13381_14067 | 223 |
| 292 | 3300053105 | Ga0500557_000002 | Ga0500557_000002_47371_48057 | 223 |
| 293 | 3300053130 | Ga0500642_0000139 | Ga0500642_0000139_19508_20194 | 223 |
| 294 | 3300053177 | Ga0500636_0135011 | Ga0500636_0135011_77_763 | 223 |
| 295 | 3300053729 | Ga0500625_030542 | Ga0500625_030542_1431_2117 | 223 |
| 296 | 3300055283 | Ga0500661_008524 | Ga0500661_008524_851_1537 | 223 |
| 297 | 3300003320 | rootH2_10026632 | rootH2_100266322 | 224 |
| 298 | 3300005614 | Ga0068856_100020962 | Ga0068856_1000209626 | 224 |
| 299 | 3300005616 | Ga0068852_100052999 | Ga0068852_1000529993 | 224 |
| 300 | 3300005985 | Ga0081539_10064174 | Ga0081539_100641742 | 224 |
| 301 | 3300026078 | Ga0207702_10302804 | Ga0207702_103028042 | 224 |
| 302 | 3300026142 | Ga0207698_10348895 | Ga0207698_103488952 | 224 |
| 303 | 3300031731 | Ga0307405_10460782 | Ga0307405_104607822 | 224 |
| 304 | 3300031852 | Ga0307410_10780919 | Ga0307410_107809192 | 224 |
| 305 | 3300048904 | Ga0496101_0468943 | Ga0496101_0468943_107_781 | 224 |
| 306 | 3300048909 | Ga0496106_0736687 | Ga0496106_0736687_75_749 | 224 |
| 307 | 3300048913 | Ga0496110_0787130 | Ga0496110_0787130_91_765 | 224 |
| 308 | 3300049585 | Ga0501069_0036807 | Ga0501069_0036807_1207_1890 | 224 |
| 309 | 3300053730 | Ga0500645_061130 | Ga0500645_061130_107_790 | 224 |
| 310 | iso_pu_bacteria | 2513237096 | 2513654373 | 224 |
| 311 | iso_pu_bacteria | 2513237137 | 2513859170 | 224 |
| 312 | iso_pu_bacteria | 2513237145 | 2513915448 | 224 |
| 313 | iso_pu_bacteria | 2517572143 | 2517892781 | 224 |
| 314 | iso_pu_bacteria | 2667528175 | 2671117493 | 224 |
| 315 | iso_pu_bacteria | 2885374607 | 2885381194 | 224 |
| 316 | iso_pu_bacteria | 2903748898 | 2903750493 | 224 |
| 317 | iso_pu_bacteria | 2904699407 | 2904702928 | 224 |
| 318 | iso_pu_bacteria | 2906610324 | 2906618209 | 224 |
| 319 | iso_pu_bacteria | 2906635258 | 2906642543 | 224 |
| 320 | iso_pu_bacteria | 2906660503 | 2906664311 | 224 |
| 321 | iso_pu_bacteria | 2908739725 | 2908743116 | 224 |
| 322 | iso_pu_bacteria | 2922425934 | 2922429849 | 224 |
| 323 | iso_pu_bacteria | 2935630451 | 2935633501 | 224 |
| 324 | iso_pu_bacteria | 2941507105 | 2941510392 | 224 |
| 325 | iso_pu_bacteria | 2941515067 | 2941517871 | 224 |
| 326 | iso_pu_bacteria | 2941523033 | 2941525887 | 224 |
| 327 | iso_pu_bacteria | 3005474847 | 3005479804 | 224 |
| 328 | iso_pu_bacteria | 8019555841 | 8019557206 | 224 |
| 329 | iso_pu_bacteria | 8019565922 | 8019568095 | 224 |
| 330 | 3300005328 | Ga0070676_10025156 | Ga0070676_100251563 | 225 |
| 331 | 3300005331 | Ga0070670_100458234 | Ga0070670_1004582342 | 225 |
| 332 | 3300005335 | Ga0070666_10364212 | Ga0070666_103642122 | 225 |
| 333 | 3300005343 | Ga0070687_100274155 | Ga0070687_1002741552 | 225 |
| 334 | 3300005354 | Ga0070675_100171626 | Ga0070675_1001716262 | 225 |
| 335 | 3300005435 | Ga0070714_100431734 | Ga0070714_1004317342 | 225 |
| 336 | 3300005455 | Ga0070663_100412267 | Ga0070663_1004122672 | 225 |
| 337 | 3300005456 | Ga0070678_100678398 | Ga0070678_1006783981 | 225 |
| 338 | 3300005539 | Ga0068853_100217134 | Ga0068853_1002171342 | 225 |
| 339 | 3300005548 | Ga0070665_100293077 | Ga0070665_1002930772 | 225 |
| 340 | 3300005548 | Ga0070665_100432897 | Ga0070665_1004328972 | 225 |
| 341 | 3300005564 | Ga0070664_100483579 | Ga0070664_1004835792 | 225 |
| 342 | 3300005577 | Ga0068857_100088782 | Ga0068857_1000887823 | 225 |
| 343 | 3300005719 | Ga0068861_100147185 | Ga0068861_1001471852 | 225 |
| 344 | 3300005841 | Ga0068863_100321690 | Ga0068863_1003216902 | 225 |
| 345 | 3300005842 | Ga0068858_100202284 | Ga0068858_1002022841 | 225 |
| 346 | 3300005844 | Ga0068862_100164855 | Ga0068862_1001648552 | 225 |
| 347 | 3300005983 | Ga0081540_1002798 | Ga0081540_100279811 | 225 |
| 348 | 3300005985 | Ga0081539_10030484 | Ga0081539_100304842 | 225 |
| 349 | 3300006038 | Ga0075365_10107920 | Ga0075365_101079202 | 225 |
| 350 | 3300006173 | Ga0070716_100250218 | Ga0070716_1002502182 | 225 |
| 351 | 3300006195 | Ga0075366_10206750 | Ga0075366_102067501 | 225 |
| 352 | 3300006353 | Ga0075370_10060841 | Ga0075370_100608412 | 225 |
| 353 | 3300009093 | Ga0105240_10376054 | Ga0105240_103760542 | 225 |
| 354 | 3300009101 | Ga0105247_10110304 | Ga0105247_101103042 | 225 |
| 355 | 3300009177 | Ga0105248_10234747 | Ga0105248_102347472 | 225 |
| 356 | 3300009177 | Ga0105248_10840445 | Ga0105248_108404452 | 225 |
| 357 | 3300009545 | Ga0105237_10478088 | Ga0105237_104780882 | 225 |
| 358 | 3300010375 | Ga0105239_10405002 | Ga0105239_104050022 | 225 |
| 359 | 3300013297 | Ga0157378_10070844 | Ga0157378_100708443 | 225 |
| 360 | 3300013297 | Ga0157378_10198845 | Ga0157378_101988452 | 225 |
| 361 | 3300013307 | Ga0157372_10914876 | Ga0157372_109148762 | 225 |
| 362 | 3300014325 | Ga0163163_10755278 | Ga0163163_107552782 | 225 |
| 363 | 3300017792 | Ga0163161_10261546 | Ga0163161_102615462 | 225 |
| 364 | 3300025297 | Ga0209758_1019966 | Ga0209758_10199663 | 225 |
| 365 | 3300025914 | Ga0207671_10163325 | Ga0207671_101633252 | 225 |
| 366 | 3300025918 | Ga0207662_10186695 | Ga0207662_101866951 | 225 |
| 367 | 3300025926 | Ga0207659_10305961 | Ga0207659_103059612 | 225 |
| 368 | 3300025929 | Ga0207664_10288779 | Ga0207664_102887792 | 225 |
| 369 | 3300026035 | Ga0207703_10207725 | Ga0207703_102077252 | 225 |
| 370 | 3300026067 | Ga0207678_10040313 | Ga0207678_100403132 | 225 |
| 371 | 3300026118 | Ga0207675_100380325 | Ga0207675_1003803252 | 225 |
| 372 | 3300028379 | Ga0268266_10016444 | Ga0268266_100164446 | 225 |
| 373 | 3300028379 | Ga0268266_10224646 | Ga0268266_102246462 | 225 |
| 374 | 3300028379 | Ga0268266_10322331 | Ga0268266_103223312 | 225 |
| 375 | 3300028379 | Ga0268266_10419759 | Ga0268266_104197592 | 225 |
| 376 | 3300028380 | Ga0268265_10730839 | Ga0268265_107308392 | 225 |
| 377 | 3300028381 | Ga0268264_11215916 | Ga0268264_112159161 | 225 |
| 378 | 3300031456 | Ga0307513_10345631 | Ga0307513_103456312 | 225 |
| 379 | 3300031730 | Ga0307516_10436186 | Ga0307516_104361862 | 225 |
| 380 | 3300031824 | Ga0307413_10103301 | Ga0307413_101033012 | 225 |
| 381 | 3300031995 | Ga0307409_100282604 | Ga0307409_1002826042 | 225 |
| 382 | 3300031995 | Ga0307409_100466353 | Ga0307409_1004663532 | 225 |
| 383 | 3300032005 | Ga0307411_10533915 | Ga0307411_105339152 | 225 |
| 384 | 3300032126 | Ga0307415_100240509 | Ga0307415_1002405092 | 225 |
| 385 | 3300033180 | Ga0307510_10042971 | Ga0307510_100429712 | 225 |
| 386 | 3300035113 | Ga0373936_0141525 | Ga0373936_0141525_201_887 | 225 |
| 387 | 3300035695 | Ga0373927_0201066 | Ga0373927_0201066_361_1047 | 225 |
| 388 | 3300044719 | Ga0466971_0265095 | Ga0466971_0265095_63_740 | 225 |
| 389 | 3300044765 | Ga0466970_0053067 | Ga0466970_0053067_350_1027 | 225 |
| 390 | 3300046455 | Ga0495603_0008023 | Ga0495603_0008023_2395_3081 | 225 |
| 391 | 3300046455 | Ga0495603_0019910 | Ga0495603_0019910_1624_2310 | 225 |
| 392 | 3300046455 | Ga0495603_0310753 | Ga0495603_0310753_31_717 | 225 |
| 393 | 3300046457 | Ga0495590_0036012 | Ga0495590_0036012_861_1547 | 225 |
| 394 | 3300046472 | Ga0495580_0165291 | Ga0495580_0165291_13_690 | 225 |
| 395 | 3300046473 | Ga0495582_0296021 | Ga0495582_0296021_29_715 | 225 |
| 396 | 3300046474 | Ga0495605_0057604 | Ga0495605_0057604_934_1620 | 225 |
| 397 | 3300046477 | Ga0495664_0120328 | Ga0495664_0120328_687_1373 | 225 |
| 398 | 3300046492 | Ga0495585_0069735 | Ga0495585_0069735_49_735 | 225 |
| 399 | 3300046492 | Ga0495585_0079428 | Ga0495585_0079428_455_1141 | 225 |
| 400 | 3300046492 | Ga0495585_0092686 | Ga0495585_0092686_30_716 | 225 |
| 401 | 3300046513 | Ga0495616_0040710 | Ga0495616_0040710_1318_2004 | 225 |
| 402 | 3300046519 | Ga0495632_0047252 | Ga0495632_0047252_1270_1956 | 225 |
| 403 | 3300046522 | Ga0495643_0233088 | Ga0495643_0233088_81_767 | 225 |
| 404 | 3300046523 | Ga0495644_0122832 | Ga0495644_0122832_230_916 | 225 |
| 405 | 3300046524 | Ga0495648_0124268 | Ga0495648_0124268_53_739 | 225 |
| 406 | 3300046528 | Ga0495642_0049692 | Ga0495642_0049692_925_1611 | 225 |
| 407 | 3300046529 | Ga0495652_0208197 | Ga0495652_0208197_348_1034 | 225 |
| 408 | 3300046530 | Ga0495654_0074481 | Ga0495654_0074481_348_1034 | 225 |
| 409 | 3300046537 | Ga0495598_0013678 | Ga0495598_0013678_966_1652 | 225 |
| 410 | 3300046537 | Ga0495598_0047481 | Ga0495598_0047481_20_706 | 225 |
| 411 | 3300046538 | Ga0495609_0020159 | Ga0495609_0020159_1648_2334 | 225 |
| 412 | 3300046557 | Ga0495622_0059705 | Ga0495622_0059705_26_712 | 225 |
| 413 | 3300046558 | Ga0495633_0055335 | Ga0495633_0055335_503_1189 | 225 |
| 414 | 3300046615 | Ga0495656_0025218 | Ga0495656_0025218_493_1179 | 225 |
| 415 | 3300046674 | Ga0495588_0005942 | Ga0495588_0005942_326_1012 | 225 |
| 416 | 3300046684 | Ga0495669_0056752 | Ga0495669_0056752_414_1100 | 225 |
| 417 | 3300046684 | Ga0495669_0157432 | Ga0495669_0157432_20_706 | 225 |
| 418 | 3300046794 | Ga0495589_0162725 | Ga0495589_0162725_172_858 | 225 |
| 419 | 3300046794 | Ga0495589_0162766 | Ga0495589_0162766_135_821 | 225 |
| 420 | 3300047315 | Ga0495581_0273387 | Ga0495581_0273387_234_920 | 225 |
| 421 | 3300047317 | Ga0495604_0139204 | Ga0495604_0139204_523_1209 | 225 |
| 422 | 3300047320 | Ga0495672_0078633 | Ga0495672_0078633_93_779 | 225 |
| 423 | 3300048088 | Ga0495602_0298318 | Ga0495602_0298318_431_1117 | 225 |
| 424 | 3300048091 | Ga0495626_0067469 | Ga0495626_0067469_330_1016 | 225 |
| 425 | 3300048905 | Ga0496102_0109224 | Ga0496102_0109224_1488_2174 | 225 |
| 426 | 3300048906 | Ga0496103_0350139 | Ga0496103_0350139_44_730 | 225 |
| 427 | 3300048907 | Ga0496104_0901843 | Ga0496104_0901843_18_704 | 225 |
| 428 | 3300048909 | Ga0496106_0194903 | Ga0496106_0194903_390_1076 | 225 |
| 429 | 3300048912 | Ga0496109_0718516 | Ga0496109_0718516_200_886 | 225 |
| 430 | 3300048915 | Ga0496112_0091026 | Ga0496112_0091026_2261_2947 | 225 |
| 431 | 3300048916 | Ga0496113_0121356 | Ga0496113_0121356_862_1548 | 225 |
| 432 | 3300048921 | Ga0496118_0219241 | Ga0496118_0219241_328_1014 | 225 |
| 433 | 3300048922 | Ga0496119_0135252 | Ga0496119_0135252_253_942 | 225 |
| 434 | 3300048924 | Ga0496121_0221479 | Ga0496121_0221479_196_882 | 225 |
| 435 | 3300048929 | Ga0496126_0006548 | Ga0496126_0006548_10081_10767 | 225 |
| 436 | 3300049459 | Ga0495678_047912 | Ga0495678_047912_365_1051 | 225 |
| 437 | 3300049460 | Ga0495682_0052111 | Ga0495682_0052111_423_1109 | 225 |
| 438 | 3300050491 | nmdc:mga00v17_64217_c1 | nmdc:mga00v17_64217_c1_1149_1835 | 225 |
| 439 | 3300050494 | nmdc:mga06z11_109149_c1 | nmdc:mga06z11_109149_c1_175_861 | 225 |
| 440 | 3300050496 | nmdc:mga07m45_33137_c1 | nmdc:mga07m45_33137_c1_1306_1992 | 225 |
| 441 | 3300053083 | Ga0495655_0006847 | Ga0495655_0006847_1365_2051 | 225 |
| 442 | 3300053092 | Ga0500583_0003444 | Ga0500583_0003444_1629_2315 | 225 |
| 443 | 3300053093 | Ga0500651_0122415 | Ga0500651_0122415_46_732 | 225 |
| 444 | 3300053096 | Ga0500641_0117315 | Ga0500641_0117315_448_1134 | 225 |
| 445 | 3300053118 | Ga0500594_0035845 | Ga0500594_0035845_454_1140 | 225 |
| 446 | 3300053119 | Ga0500595_001199 | Ga0500595_001199_4817_5503 | 225 |
| 447 | 3300053134 | Ga0500658_0019715 | Ga0500658_0019715_1498_2184 | 225 |
| 448 | 3300053139 | Ga0500568_0037449 | Ga0500568_0037449_1020_1706 | 225 |
| 449 | 3300053156 | Ga0500622_0113289 | Ga0500622_0113289_467_1153 | 225 |
| 450 | 3300053177 | Ga0500636_0257337 | Ga0500636_0257337_155_844 | 225 |
| 451 | iso_pu_bacteria | 2508501128 | 2509151733 | 225 |
| 452 | 3300005841 | Ga0068863_100593115 | Ga0068863_1005931152 | 226 |
| 453 | 3300009101 | Ga0105247_10039053 | Ga0105247_100390533 | 226 |
| 454 | 3300009545 | Ga0105237_10107116 | Ga0105237_101071162 | 226 |
| 455 | 3300009551 | Ga0105238_10056315 | Ga0105238_100563153 | 226 |
| 456 | 3300010375 | Ga0105239_10075990 | Ga0105239_100759902 | 226 |
| 457 | 3300025914 | Ga0207671_10260732 | Ga0207671_102607322 | 226 |
| 458 | 3300025924 | Ga0207694_10565215 | Ga0207694_105652151 | 226 |
| 459 | 3300026088 | Ga0207641_10646000 | Ga0207641_106460002 | 226 |
| 460 | 3300028379 | Ga0268266_10418050 | Ga0268266_104180502 | 226 |
| 461 | 3300041441 | Ga0451787_239584 | Ga0451787_239584_118_798 | 226 |
| 462 | 3300048927 | Ga0496124_0016895 | Ga0496124_0016895_1050_1730 | 226 |
| 463 | 3300048928 | Ga0496125_0033268 | Ga0496125_0033268_1298_1978 | 226 |
| 464 | iso_pu_bacteria | 2513237141 | 2513894291 | 226 |
| 465 | 3300048919 | Ga0496116_0148110 | Ga0496116_0148110_139_822 | 227 |
| 466 | 3300048924 | Ga0496121_0359811 | Ga0496121_0359811_105_788 | 227 |
| 467 | 3300048929 | Ga0496126_0060317 | Ga0496126_0060317_892_1575 | 227 |
| 468 | 3300053111 | Ga0500572_001046 | Ga0500572_001046_339_1022 | 227 |
| 469 | 3300053136 | Ga0500559_0000609 | Ga0500559_0000609_20178_20861 | 227 |
| 470 | 3300053163 | Ga0500639_104340 | Ga0500639_104340_399_1082 | 227 |
| 471 | 3300053177 | Ga0500636_0040334 | Ga0500636_0040334_1066_1749 | 227 |
| 472 | 3300053735 | Ga0500596_001736 | Ga0500596_001736_2368_3051 | 227 |
| 473 | 3300009545 | Ga0105237_10007285 | Ga0105237_1000728510 | 228 |
| 474 | 3300025261 | Ga0209233_1003425 | Ga0209233_10034252 | 228 |
| 475 | 3300025914 | Ga0207671_10022626 | Ga0207671_100226264 | 228 |
| 476 | 3300033442 | Ga0315911_1000001 | Ga0315911_1000001777 | 228 |
| 477 | 3300046507 | Ga0495606_0002525 | Ga0495606_0002525_16675_17361 | 228 |
| 478 | 3300047470 | Ga0495681_0071270 | Ga0495681_0071270_616_1302 | 228 |
| 479 | 3300048915 | Ga0496112_0000009 | Ga0496112_0000009_262241_262927 | 228 |
| 480 | 3300048924 | Ga0496121_0117109 | Ga0496121_0117109_1027_1725 | 228 |
| 481 | 3300049585 | Ga0501069_0084567 | Ga0501069_0084567_511_1197 | 228 |
| 482 | 3300003203 | JGI25406J46586_10000004 | JGI25406J46586_1000000476 | 230 |
| 483 | 3300005436 | Ga0070713_100005205 | Ga0070713_1000052052 | 230 |
| 484 | 3300005437 | Ga0070710_10004671 | Ga0070710_100046713 | 230 |
| 485 | 3300005471 | Ga0070698_100336952 | Ga0070698_1003369522 | 230 |
| 486 | 3300005985 | Ga0081539_10000080 | Ga0081539_1000008051 | 230 |
| 487 | 3300006028 | Ga0070717_10094917 | Ga0070717_100949172 | 230 |
| 488 | 3300006163 | Ga0070715_10007314 | Ga0070715_100073142 | 230 |
| 489 | 3300006173 | Ga0070716_100015184 | Ga0070716_1000151843 | 230 |
| 490 | 3300006175 | Ga0070712_100007796 | Ga0070712_1000077962 | 230 |
| 491 | 3300025898 | Ga0207692_10011132 | Ga0207692_100111323 | 230 |
| 492 | 3300025905 | Ga0207685_10017068 | Ga0207685_100170682 | 230 |
| 493 | 3300025906 | Ga0207699_10012020 | Ga0207699_100120202 | 230 |
| 494 | 3300025909 | Ga0207705_10057685 | Ga0207705_100576852 | 230 |
| 495 | 3300025915 | Ga0207693_10002655 | Ga0207693_100026557 | 230 |
| 496 | 3300025916 | Ga0207663_10002699 | Ga0207663_100026993 | 230 |
| 497 | 3300025928 | Ga0207700_10025335 | Ga0207700_100253352 | 230 |
| 498 | 3300025929 | Ga0207664_10020349 | Ga0207664_100203495 | 230 |
| 499 | 3300025939 | Ga0207665_10001529 | Ga0207665_100015298 | 230 |
| 500 | 3300035113 | Ga0373936_0006070 | Ga0373936_0006070_1631_2323 | 230 |
| 501 | 3300035116 | Ga0373945_0015147 | Ga0373945_0015147_11_703 | 230 |
| 502 | 3300035118 | Ga0373954_0024565 | Ga0373954_0024565_1319_2011 | 230 |
| 503 | 3300035692 | Ga0373935_0009202 | Ga0373935_0009202_4584_5276 | 230 |
| 504 | 3300036401 | Ga0373937_0049573 | Ga0373937_0049573_1170_1862 | 230 |
| 505 | 3300037068 | Ga0373925_0006309 | Ga0373925_0006309_4590_5282 | 230 |
| 506 | 3300046454 | Ga0495592_0276179 | Ga0495592_0276179_358_1050 | 230 |
| 507 | 3300046455 | Ga0495603_0000160 | Ga0495603_0000160_24987_25679 | 230 |
| 508 | 3300046459 | Ga0495629_0000155 | Ga0495629_0000155_54483_55175 | 230 |
| 509 | 3300046461 | Ga0495641_0007890 | Ga0495641_0007890_2954_3646 | 230 |
| 510 | 3300046472 | Ga0495580_0009027 | Ga0495580_0009027_2007_2699 | 230 |
| 511 | 3300046473 | Ga0495582_0000866 | Ga0495582_0000866_4571_5263 | 230 |
| 512 | 3300046477 | Ga0495664_0006573 | Ga0495664_0006573_3905_4597 | 230 |
| 513 | 3300046499 | Ga0495594_0000042 | Ga0495594_0000042_4821_5513 | 230 |
| 514 | 3300046514 | Ga0495618_0176302 | Ga0495618_0176302_293_985 | 230 |
| 515 | 3300046529 | Ga0495652_0050583 | Ga0495652_0050583_1590_2282 | 230 |
| 516 | 3300046531 | Ga0495665_0002439 | Ga0495665_0002439_8175_8867 | 230 |
| 517 | 3300046533 | Ga0495640_0007997 | Ga0495640_0007997_1022_1714 | 230 |
| 518 | 3300046557 | Ga0495622_0003165 | Ga0495622_0003165_3956_4648 | 230 |
| 519 | 3300046559 | Ga0495667_0007085 | Ga0495667_0007085_2516_3208 | 230 |
| 520 | 3300046642 | Ga0495634_0000798 | Ga0495634_0000798_24859_25551 | 230 |
| 521 | 3300046663 | Ga0495635_0003922 | Ga0495635_0003922_5944_6636 | 230 |
| 522 | 3300046674 | Ga0495588_0075666 | Ga0495588_0075666_903_1595 | 230 |
| 523 | 3300046681 | Ga0495647_0000396 | Ga0495647_0000396_4527_5219 | 230 |
| 524 | 3300046683 | Ga0495658_0000434 | Ga0495658_0000434_18159_18851 | 230 |
| 525 | 3300046689 | Ga0495613_0428972 | Ga0495613_0428972_139_831 | 230 |
| 526 | 3300046690 | Ga0495624_0002112 | Ga0495624_0002112_3873_4565 | 230 |
| 527 | 3300047315 | Ga0495581_0000239 | Ga0495581_0000239_5246_5938 | 230 |
| 528 | 3300047319 | Ga0495674_0001352 | Ga0495674_0001352_5307_5999 | 230 |
| 529 | 3300047321 | Ga0495676_0054226 | Ga0495676_0054226_461_1153 | 230 |
| 530 | 3300047471 | Ga0495684_0001910 | Ga0495684_0001910_14241_14933 | 230 |
| 531 | 3300047673 | Ga0495593_0000013 | Ga0495593_0000013_5244_5936 | 230 |
| 532 | 3300048905 | Ga0496102_0327161 | Ga0496102_0327161_716_1411 | 230 |
| 533 | 3300048915 | Ga0496112_0829878 | Ga0496112_0829878_93_785 | 230 |
| 534 | 3300048917 | Ga0496114_0079575 | Ga0496114_0079575_325_1020 | 230 |
| 535 | 3300048918 | Ga0496115_0086316 | Ga0496115_0086316_213_908 | 230 |
| 536 | 3300048929 | Ga0496126_0055001 | Ga0496126_0055001_650_1345 | 230 |
| 537 | 3300049568 | Ga0501031_0000775 | Ga0501031_0000775_2507_3199 | 230 |
| 538 | 3300049570 | Ga0501033_0000408 | Ga0501033_0000408_29218_29910 | 230 |
| 539 | 3300049570 | Ga0501033_0006452 | Ga0501033_0006452_5484_6176 | 230 |
| 540 | 3300049571 | Ga0501034_0209552 | Ga0501034_0209552_189_881 | 230 |
| 541 | 3300049573 | Ga0501037_0000122 | Ga0501037_0000122_58445_59137 | 230 |
| 542 | 3300049573 | Ga0501037_0018175 | Ga0501037_0018175_195_887 | 230 |
| 543 | 3300049574 | Ga0501038_0007515 | Ga0501038_0007515_5354_6046 | 230 |
| 544 | 3300049574 | Ga0501038_0180304 | Ga0501038_0180304_607_1299 | 230 |
| 545 | 3300049575 | Ga0501039_0003596 | Ga0501039_0003596_179_871 | 230 |
| 546 | 3300049575 | Ga0501039_0177199 | Ga0501039_0177199_836_1528 | 230 |
| 547 | 3300049576 | Ga0501040_0349200 | Ga0501040_0349200_166_858 | 230 |
| 548 | 3300049577 | Ga0501041_0072044 | Ga0501041_0072044_876_1568 | 230 |
| 549 | 3300049578 | Ga0501042_0006101 | Ga0501042_0006101_5577_6269 | 230 |
| 550 | 3300049579 | Ga0501043_0006251 | Ga0501043_0006251_6528_7220 | 230 |
| 551 | 3300049579 | Ga0501043_0240097 | Ga0501043_0240097_631_1323 | 230 |
| 552 | 3300049580 | Ga0501046_0015190 | Ga0501046_0015190_958_1650 | 230 |
| 553 | 3300049581 | Ga0501047_0144600 | Ga0501047_0144600_1021_1713 | 230 |
| 554 | 3300049583 | Ga0501067_0067325 | Ga0501067_0067325_195_887 | 230 |
| 555 | 3300049584 | Ga0501068_0019104 | Ga0501068_0019104_3177_3869 | 230 |
| 556 | 3300049585 | Ga0501069_0010603 | Ga0501069_0010603_3339_4031 | 230 |
| 557 | 3300049587 | Ga0501071_0067065 | Ga0501071_0067065_887_1579 | 230 |
| 558 | 3300049589 | Ga0501073_0021482 | Ga0501073_0021482_3766_4458 | 230 |
| 559 | 3300049590 | Ga0501074_0011738 | Ga0501074_0011738_4343_5035 | 230 |
| 560 | 3300049741 | Ga0501079_0116017 | Ga0501079_0116017_769_1461 | 230 |
| 561 | 3300049742 | Ga0501080_0828304 | Ga0501080_0828304_98_790 | 230 |
| 562 | 3300049744 | Ga0501083_0058075 | Ga0501083_0058075_136_828 | 230 |
| 563 | 3300049822 | Ga0501035_0005412 | Ga0501035_0005412_11198_11890 | 230 |
| 564 | 3300049822 | Ga0501035_0027858 | Ga0501035_0027858_1024_1716 | 230 |
| 565 | 3300049822 | Ga0501035_0394303 | Ga0501035_0394303_282_974 | 230 |
| 566 | 3300049823 | Ga0501044_0046551 | Ga0501044_0046551_3167_3859 | 230 |
| 567 | 3300049824 | Ga0501045_0130554 | Ga0501045_0130554_765_1457 | 230 |
| 568 | 3300054114 | Ga0501084_0067729 | Ga0501084_0067729_837_1529 | 230 |
| 569 | 3300061734 | Ga0530510_0176688 | Ga0530510_0176688_439_1131 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x8d-assembly1.cif.gz_B | d90l mutant of thermus thermophilus hb8 thymidylate kinase | 0.9554 | 13 | 216 |
| 5zb4-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with adp and tmp from thermus thermophilus hb8 | 0.9545 | 13 | 216 |
| 5zb0-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with adp and tdp from thermus thermophilus hb8 | 0.9539 | 13 | 216 |
| 5xal-assembly1.cif.gz_A | y99f mutant of thermus thermophilus hb8 thymidylate kinase | 0.9497 | 13 | 216 |
| 5xal-assembly1.cif.gz_B | y99f mutant of thermus thermophilus hb8 thymidylate kinase | 0.9495 | 13 | 216 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pbrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9366 | 15 | 216 | 3.40.50.300 |
| 3uwoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9205 | 13 | 216 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9149 | 13 | 216 | 3.40.50.300 |
| 3lv8A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9111 | 13 | 222 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9109 | 15 | 212 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D7QRC1-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9714 | 11 | 218 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A327KXA9-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.97 | 12 | 218 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A529TX53-F1-model_v4 | deleted | 0.969 | 11 | 208 |
|
| AF-A0A4Q2U9M2-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9687 | 12 | 218 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A7Z8LVG8-F1-model_v4 | deleted | 0.9687 | 12 | 223 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar