F464744

General Info

Members Datasets Scaffolds Average Seq Length
569 373 1138 119

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0178431|Ga0436365_0178431_24_428
Length 134
Sequence MQTGMLNTARLATAALSSNPAFSVESRNGRPDFELAAALQKVSPQQQSKAQKTATDFEAMFLNSMFSQMTSGLKGDGPFGSTTGTGVWRSMLTEQYSKSFARAGGVGIASEVYRSMIMKQAKAATPQPTTQANS

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
48 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
49 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
73 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
74 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
75 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
123 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
124 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
125 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
174 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
230 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
231 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
259 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
260 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
261 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
262 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
263 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
264 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
265 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
266 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
267 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
268 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
269 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
270 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
271 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
272 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
273 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
274 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
275 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
276 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
279 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
282 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
285 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
286 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
287 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
288 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
289 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
290 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
294 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
295 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
296 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
297 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
298 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
299 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
300 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
301 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
302 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
303 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
304 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
305 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
306 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
307 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
308 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
309 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
310 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
311 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
312 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
313 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
314 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
315 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
316 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
317 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
318 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
319 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
320 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
321 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
322 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
323 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
324 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
325 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
326 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
327 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
328 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
329 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
330 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
331 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
332 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
333 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
334 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
335 2922368715
336 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
337 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
338 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
339 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
340 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
341 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
342 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
343 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
344 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
345 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
346 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
347 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
348 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
349 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
350 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
351 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
352 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
353 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
354 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
355 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
356 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
357 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
358 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
359 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
360 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
361 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
362 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
363 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
364 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
365 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
366 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
367 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
368 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
369 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
370 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
371 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
372 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
373 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.62
Metatranscriptomes 0.53
Isolates 12.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.95
Nodule 10.9
Rhizoplane 10.19
Rhizosphere 56.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0178431 3300039437 Bacteria 685
2 JGI25404J52841_10056081 3300003659 Bacteria 827
3 Ga0065165_1004783 3300005262 Bacteria 8086
4 Ga0068869_100315740 3300005334 Bacteria 1266
5 Ga0070682_100029289 3300005337 Bacteria 3314
6 Ga0070682_101436268 3300005337 Bacteria 591
7 Ga0070671_102089504 3300005355 Bacteria 504
8 Ga0070688_100248278 3300005365 Bacteria 1266
9 Ga0070659_100178020 3300005366 Bacteria 1744
10 Ga0070659_100868112 3300005366 Bacteria 787
11 Ga0070709_10055377 3300005434 Bacteria 2504
12 Ga0070709_10304938 3300005434 Bacteria 1164
13 Ga0070709_10984365 3300005434 Bacteria 670
14 Ga0070714_100232554 3300005435 Bacteria 1699
15 Ga0070714_100810716 3300005435 Bacteria 907
16 Ga0070714_101085295 3300005435 Bacteria 780
17 Ga0070713_100076827 3300005436 Bacteria 2838
18 Ga0070713_100239253 3300005436 Bacteria 1653
19 Ga0070713_100503954 3300005436 Bacteria 1142
20 Ga0070713_100856702 3300005436 Bacteria 873
21 Ga0070710_10227845 3300005437 Bacteria 1189
22 Ga0070710_10624372 3300005437 Bacteria 753
23 Ga0070711_101921296 3300005439 Bacteria 520
24 Ga0070705_100476941 3300005440 Bacteria 942
25 Ga0070708_100032417 3300005445 Bacteria 4532
26 Ga0070663_100122009 3300005455 Bacteria 1969
27 Ga0070663_100199835 3300005455 Bacteria 1559
28 Ga0070662_101789738 3300005457 Bacteria 531
29 Ga0070706_100047855 3300005467 Bacteria 3947
30 Ga0070706_100258749 3300005467 Bacteria 1625
31 Ga0070706_100427436 3300005467 Bacteria 1233
32 Ga0070707_100037262 3300005468 Bacteria 4640
33 Ga0070707_100135061 3300005468 Bacteria 2400
34 Ga0070698_100714333 3300005471 Bacteria 945
35 Ga0070699_102204550 3300005518 Bacteria 503
36 Ga0070679_101992178 3300005530 Bacteria 530
37 Ga0070684_100978085 3300005535 Bacteria 794
38 Ga0068853_100147010 3300005539 Bacteria 2119
39 Ga0068853_100454017 3300005539 Bacteria 1206
40 Ga0070672_100950855 3300005543 Bacteria 760
41 Ga0070686_101167110 3300005544 Bacteria 638
42 Ga0070693_100177620 3300005547 Bacteria 1368
43 Ga0070693_101481306 3300005547 Bacteria 530
44 Ga0070664_100459944 3300005564 Bacteria 1169
45 Ga0068857_100901521 3300005577 Bacteria 848
46 Ga0068854_100016308 3300005578 Bacteria 4949
47 Ga0068854_100314585 3300005578 Bacteria 1271
48 Ga0068854_100485112 3300005578 Bacteria 1038
49 Ga0068856_101442144 3300005614 Bacteria 703
50 Ga0070702_100179227 3300005615 Bacteria 1385
51 Ga0068852_100628347 3300005616 Bacteria 1080
52 Ga0068859_100843299 3300005617 Bacteria 1003
53 Ga0068859_101087868 3300005617 Bacteria 879
54 Ga0068864_100181960 3300005618 Bacteria 1922
55 Ga0068861_101001477 3300005719 Bacteria 798
56 Ga0068863_101435445 3300005841 Bacteria 698
57 Ga0068858_100385654 3300005842 Bacteria 1345
58 Ga0068858_100483246 3300005842 Bacteria 1196
59 Ga0081455_10004004 3300005937 Bacteria 16720
60 Ga0070717_10970392 3300006028 Bacteria 774
61 Ga0075365_10496482 3300006038 Bacteria 862
62 Ga0070716_100566887 3300006173 Bacteria 849
63 Ga0070716_100631549 3300006173 Bacteria 810
64 Ga0070712_101088240 3300006175 Bacteria 693
65 Ga0097621_100508764 3300006237 Bacteria 1092
66 Ga0068871_100364911 3300006358 Bacteria 1280
67 Ga0097620_100843180 3300006931 Bacteria 1003
68 Ga0097620_101087944 3300006931 Bacteria 879
69 Ga0099825_1064018 3300006941 Bacteria 597
70 Ga0099824_1007912 3300006942 Bacteria 13834
71 Ga0099824_1016379 3300006942 Bacteria 6734
72 Ga0099822_1010465 3300006943 Bacteria 11499
73 Ga0099822_1069866 3300006943 Bacteria 998
74 Ga0099823_1026544 3300006944 Bacteria 5108
75 Ga0099794_10127793 3300007265 Bacteria 1282
76 Ga0099795_10101170 3300007788 Bacteria 1131
77 Ga0105240_10158286 3300009093 Bacteria 2692
78 Ga0105240_10447708 3300009093 Bacteria 1446
79 Ga0105240_10464323 3300009093 Bacteria 1414
80 Ga0105240_12243939 3300009093 Bacteria 566
81 Ga0105240_12412120 3300009093 Bacteria 544
82 Ga0105241_10284237 3300009174 Bacteria 1414
83 Ga0105241_10383048 3300009174 Bacteria 1229
84 Ga0105237_10277912 3300009545 Bacteria 1677
85 Ga0105237_10437170 3300009545 Bacteria 1314
86 Ga0105237_10449852 3300009545 Bacteria 1294
87 Ga0105237_10461564 3300009545 Bacteria 1276
88 Ga0105237_10475553 3300009545 Bacteria 1256
89 Ga0105237_11177779 3300009545 Bacteria 773
90 Ga0105237_12245024 3300009545 Bacteria 555
91 Ga0105238_10021257 3300009551 Bacteria 6613
92 Ga0105238_12962311 3300009551 Bacteria 510
93 Ga0105249_10905385 3300009553 Bacteria 949
94 Ga0105239_10078072 3300010375 Bacteria 3644
95 Ga0105239_10113463 3300010375 Bacteria 3005
96 Ga0105246_10237061 3300011119 Bacteria 1440
97 Ga0105246_11192601 3300011119 Bacteria 700
98 Ga0157342_1045086 3300012507 Bacteria 603
99 Ga0157371_10200333 3300013102 Bacteria 1431
100 Ga0157370_10036629 3300013104 Bacteria 4759
101 Ga0157370_10227785 3300013104 Bacteria 1725
102 Ga0157369_10005835 3300013105 Bacteria 14316
103 Ga0157369_10029707 3300013105 Bacteria 6037
104 Ga0157374_10312709 3300013296 Bacteria 1555
105 Ga0163162_10418388 3300013306 Bacteria 1472
106 Ga0157372_10771862 3300013307 Bacteria 1117
107 Ga0157372_11314419 3300013307 Bacteria 834
108 Ga0163163_10031521 3300014325 Bacteria 5117
109 Ga0157376_11028905 3300014969 Bacteria 847
110 Ga0157376_11284001 3300014969 Bacteria 762
111 Ga0157376_11330381 3300014969 Bacteria 749
112 Ga0163161_10318469 3300017792 Bacteria 1229
113 Ga0206356_10121414 3300020070 Bacteria 838
114 Ga0206353_10186442 3300020082 Bacteria 1863
115 Ga0214544_1013327 3300021320 Bacteria 10032
116 Ga0214542_1000024 3300021321 Bacteria 191218
117 Ga0214545_1000011 3300021324 Bacteria 190550
118 Ga0214543_1000033 3300021327 Bacteria 190419
119 Ga0213874_10423489 3300021377 Bacteria 521
120 Ga0213876_10254293 3300021384 Bacteria 934
121 Ga0213875_10628235 3300021388 Bacteria 520
122 Ga0209148_1001502 3300025254 Bacteria 11558
123 Ga0209233_1003438 3300025261 Bacteria 5574
124 Ga0209758_1006897 3300025297 Bacteria 7933
125 Ga0209758_1127633 3300025297 Bacteria 677
126 Ga0207426_1002649 3300025302 Bacteria 11035
127 Ga0207692_10695985 3300025898 Bacteria 659
128 Ga0207692_10761278 3300025898 Bacteria 631
129 Ga0207692_10761870 3300025898 Bacteria 631
130 Ga0207710_10126434 3300025900 Bacteria 1225
131 Ga0207647_10296775 3300025904 Bacteria 921
132 Ga0207647_10549267 3300025904 Bacteria 641
133 Ga0207699_10278769 3300025906 Bacteria 1161
134 Ga0207699_10772135 3300025906 Bacteria 706
135 Ga0207699_11135396 3300025906 Bacteria 579
136 Ga0207643_11095656 3300025908 Bacteria 514
137 Ga0207684_10071751 3300025910 Bacteria 2942
138 Ga0207684_10175462 3300025910 Bacteria 1848
139 Ga0207684_10370601 3300025910 Bacteria 1232
140 Ga0207654_10222569 3300025911 Bacteria 1253
141 Ga0207654_11365130 3300025911 Bacteria 517
142 Ga0207707_10014355 3300025912 Bacteria 6899
143 Ga0207695_10000029 3300025913 Bacteria 548364
144 Ga0207695_10034831 3300025913 Bacteria 5469
145 Ga0207695_10420053 3300025913 Bacteria 1221
146 Ga0207695_11089023 3300025913 Bacteria 679
147 Ga0207671_10213149 3300025914 Bacteria 1511
148 Ga0207671_10353900 3300025914 Bacteria 1165
149 Ga0207671_10382277 3300025914 Bacteria 1119
150 Ga0207671_11128497 3300025914 Bacteria 615
151 Ga0207671_11440411 3300025914 Bacteria 533
152 Ga0207663_10443630 3300025916 Bacteria 1000
153 Ga0207663_11645191 3300025916 Bacteria 517
154 Ga0207660_11015927 3300025917 Bacteria 676
155 Ga0207657_10388938 3300025919 Bacteria 1097
156 Ga0207652_11034617 3300025921 Bacteria 720
157 Ga0207646_10023574 3300025922 Bacteria 5651
158 Ga0207646_10072743 3300025922 Bacteria 3070
159 Ga0207681_10504133 3300025923 Bacteria 991
160 Ga0207694_10727222 3300025924 Bacteria 837
161 Ga0207694_10760020 3300025924 Bacteria 818
162 Ga0207694_11751814 3300025924 Bacteria 522
163 Ga0207700_10043640 3300025928 Bacteria 3295
164 Ga0207700_10440454 3300025928 Bacteria 1147
165 Ga0207664_10195089 3300025929 Bacteria 1745
166 Ga0207664_10211584 3300025929 Bacteria 1678
167 Ga0207664_10332871 3300025929 Bacteria 1341
168 Ga0207664_10558457 3300025929 Bacteria 1027
169 Ga0207644_10200645 3300025931 Bacteria 1573
170 Ga0207644_11344411 3300025931 Bacteria 600
171 Ga0207686_10715968 3300025934 Bacteria 797
172 Ga0207665_10618154 3300025939 Bacteria 847
173 Ga0207665_10919519 3300025939 Bacteria 694
174 Ga0207665_10954939 3300025939 Bacteria 681
175 Ga0207691_11404058 3300025940 Bacteria 574
176 Ga0207711_10733839 3300025941 Bacteria 921
177 Ga0207689_10309290 3300025942 Bacteria 1310
178 Ga0207661_10454147 3300025944 Bacteria 1167
179 Ga0207679_10410865 3300025945 Bacteria 1193
180 Ga0207667_10314899 3300025949 Bacteria 1598
181 Ga0207667_10330438 3300025949 Bacteria 1556
182 Ga0207667_10504519 3300025949 Bacteria 1227
183 Ga0207667_10797912 3300025949 Bacteria 941
184 Ga0207640_10020845 3300025981 Bacteria 3896
185 Ga0207640_10069102 3300025981 Bacteria 2370
186 Ga0207640_10282216 3300025981 Bacteria 1305
187 Ga0207640_11427679 3300025981 Bacteria 620
188 Ga0207703_10406408 3300026035 Bacteria 1264
189 Ga0207703_10417502 3300026035 Bacteria 1248
190 Ga0207639_10091597 3300026041 Bacteria 2435
191 Ga0207678_10084297 3300026067 Bacteria 2718
192 Ga0207678_10143271 3300026067 Bacteria 2040
193 Ga0207678_11208087 3300026067 Bacteria 669
194 Ga0207702_11482170 3300026078 Bacteria 672
195 Ga0207641_12248962 3300026088 Bacteria 545
196 Ga0207641_12403016 3300026088 Bacteria 526
197 Ga0207676_10025350 3300026095 Bacteria 4400
198 Ga0207676_10426193 3300026095 Bacteria 1245
199 Ga0207674_10030360 3300026116 Bacteria 5683
200 Ga0207675_102260701 3300026118 Bacteria 558
201 Ga0207683_10167000 3300026121 Bacteria 1992
202 Ga0207698_10542196 3300026142 Bacteria 1139
203 Ga0207698_10714393 3300026142 Bacteria 998
204 Ga0207698_11658522 3300026142 Bacteria 655
205 Ga0209389_1000011 3300027296 Bacteria 223265
206 Ga0209389_1000127 3300027296 Bacteria 67209
207 Ga0209589_1000018 3300027357 Bacteria 192614
208 Ga0209589_1000243 3300027357 Bacteria 67209
209 Ga0209489_100017 3300027361 Bacteria 223265
210 Ga0209489_100026 3300027361 Bacteria 192614
211 Ga0209489_103202 3300027361 Bacteria 32241
212 Ga0209700_100027 3300027363 Bacteria 223462
213 Ga0209700_100035 3300027363 Bacteria 192614
214 Ga0268266_10022345 3300028379 Bacteria 5392
215 Ga0268264_10691164 3300028381 Bacteria 1013
216 Ga0307517_10535930 3300028786 Bacteria 588
217 Ga0265325_10055825 3300031241 Bacteria 2018
218 Ga0265339_10076575 3300031249 Bacteria 1774
219 Ga0265339_10085032 3300031249 Bacteria 1666
220 Ga0265316_10242079 3300031344 Bacteria 1326
221 Ga0307508_10119213 3300031616 Bacteria 2241
222 Ga0265314_10105211 3300031711 Bacteria 1805
223 Ga0265342_10040515 3300031712 Bacteria 2825
224 Ga0265342_10064811 3300031712 Bacteria 2143
225 Ga0265342_10393269 3300031712 Bacteria 717
226 Ga0373926_0023390 3300035083 Bacteria 2146
227 Ga0373934_0018969 3300035086 Bacteria 2636
228 Ga0373944_0064439 3300035089 Bacteria 1182
229 Ga0373936_0057613 3300035113 Bacteria 1580
230 Ga0373945_0040656 3300035116 Bacteria 1679
231 Ga0373953_0045918 3300035117 Bacteria 1752
232 Ga0373953_0344254 3300035117 Bacteria 653
233 Ga0373956_0358340 3300035119 Bacteria 695
234 Ga0373957_0050704 3300035120 Bacteria 1587
235 Ga0373943_0013846 3300035170 Bacteria 3647
236 Ga0373946_0010454 3300035171 Bacteria 3435
237 Ga0373955_0008262 3300035172 Bacteria 4827
238 Ga0373924_0041228 3300035410 Bacteria 1891
239 Ga0373924_0383663 3300035410 Bacteria 627
240 Ga0373935_0064733 3300035692 Bacteria 2345
241 Ga0373927_0278782 3300035695 Bacteria 1099
242 Ga0373927_0347072 3300035695 Bacteria 978
243 Ga0373947_0009853 3300035725 Bacteria 5484
244 Ga0373937_0236202 3300036401 Bacteria 1722
245 Ga0372808_003329 3300036459 Bacteria 1959
246 Ga0373925_0017147 3300037068 Bacteria 5243
247 Ga0373925_0725222 3300037068 Bacteria 819
248 Ga0395899_0334384 3300037312 Bacteria 1017
249 Ga0395899_0821442 3300037312 Bacteria 573
250 Ga0395900_0075859 3300037418 Bacteria 3456
251 Ga0395900_0366915 3300037418 Bacteria 1410
252 Ga0395900_0411266 3300037418 Bacteria 1315
253 Ga0395900_0451608 3300037418 Bacteria 1241
254 Ga0395900_1633563 3300037418 Bacteria 556
255 Ga0395898_0124215 3300037466 Bacteria 2473
256 Ga0395898_0224446 3300037466 Bacteria 1792
257 Ga0395898_0794481 3300037466 Bacteria 887
258 Ga0395905_0019972 3300037471 Bacteria 6349
259 Ga0436364_1450619 3300037853 Bacteria 1275
260 Ga0395901_0105975 3300038443 Bacteria 2950
261 Ga0395901_0154437 3300038443 Bacteria 2411
262 Ga0395901_0212945 3300038443 Bacteria 2022
263 Ga0395901_1021112 3300038443 Bacteria 802
264 Ga0395901_1629430 3300038443 Bacteria 598
265 Ga0436365_0494736 3300039437 Bacteria 1598
266 Ga0436365_1050405 3300039437 Bacteria 1663
267 Ga0436365_1463292 3300039437 Bacteria 691
268 Ga0436363_0031148 3300039450 Bacteria 793
269 Ga0436363_0083491 3300039450 Bacteria 2312
270 Ga0436363_0231197 3300039450 Bacteria 780
271 Ga0436363_0664146 3300039450 Bacteria 834
272 Ga0466969_0082814 3300044656 Bacteria 1528
273 Ga0466972_0340380 3300044658 Bacteria 701
274 Ga0466966_0001672 3300044684 Bacteria 14305
275 Ga0466966_0401296 3300044684 Bacteria 824
276 Ga0466961_0001529 3300044693 Bacteria 14321
277 Ga0466961_0095574 3300044693 Bacteria 1874
278 Ga0466963_0008396 3300044694 Bacteria 6187
279 Ga0466963_0584878 3300044694 Bacteria 788
280 Ga0466963_0992438 3300044694 Bacteria 591
281 Ga0466964_0024340 3300044706 Bacteria 2360
282 Ga0466968_0066780 3300044735 Bacteria 1558
283 Ga0466968_0199323 3300044735 Bacteria 937
284 Ga0466960_0097520 3300044901 Bacteria 1508
285 Ga0466959_0007544 3300045049 Bacteria 7643
286 Ga0466959_0478988 3300045049 Bacteria 842
287 Ga0466958_0551298 3300045836 Bacteria 749
288 Ga0466967_0067579 3300045976 Bacteria 3188
289 Ga0466967_0607048 3300045976 Bacteria 1080
290 Ga0495617_107701 3300046452 Bacteria 903
291 Ga0495592_0122617 3300046454 Bacteria 1826
292 Ga0495603_0066734 3300046455 Bacteria 2119
293 Ga0495590_0188267 3300046457 Bacteria 756
294 Ga0495638_0018259 3300046460 Bacteria 4661
295 Ga0495641_0057861 3300046461 Bacteria 1756
296 Ga0495580_0085185 3300046472 Bacteria 2201
297 Ga0495605_0100811 3300046474 Bacteria 1328
298 Ga0495639_0008079 3300046475 Bacteria 4517
299 Ga0495662_0035313 3300046476 Bacteria 2412
300 Ga0495596_0256864 3300046500 Bacteria 678
301 Ga0495606_0190266 3300046507 Bacteria 1177
302 Ga0495608_0226018 3300046511 Bacteria 1173
303 Ga0495610_0139345 3300046512 Bacteria 1045
304 Ga0495618_0042690 3300046514 Bacteria 2859
305 Ga0495620_0151201 3300046515 Bacteria 905
306 Ga0495628_0069242 3300046516 Bacteria 2752
307 Ga0495628_1005855 3300046516 Bacteria 573
308 Ga0495630_0308011 3300046517 Bacteria 1210
309 Ga0495648_0079112 3300046524 Bacteria 1878
310 Ga0495652_0186049 3300046529 Bacteria 1589
311 Ga0495652_0194351 3300046529 Bacteria 1546
312 Ga0495665_0093964 3300046531 Bacteria 1575
313 Ga0495640_0060893 3300046533 Bacteria 2566
314 Ga0495586_0019649 3300046535 Bacteria 3598
315 Ga0495634_0037343 3300046642 Bacteria 3319
316 Ga0495611_0081580 3300046648 Bacteria 1488
317 Ga0495625_0307664 3300046660 Bacteria 1012
318 Ga0495635_0031038 3300046663 Bacteria 3712
319 Ga0495588_0108138 3300046674 Bacteria 1464
320 Ga0495657_0203499 3300046675 Bacteria 1206
321 Ga0495599_0087252 3300046678 Bacteria 1948
322 Ga0495646_0040062 3300046680 Bacteria 2887
323 Ga0495624_0021179 3300046690 Bacteria 4315
324 Ga0495649_0038311 3300046694 Bacteria 2631
325 Ga0495649_0235352 3300046694 Bacteria 944
326 Ga0495600_0086850 3300046809 Bacteria 2041
327 Ga0495660_0218466 3300046810 Bacteria 900
328 Ga0495674_0446577 3300047319 Bacteria 1039
329 Ga0495672_0298583 3300047320 Bacteria 764
330 Ga0495687_118453 3300047443 Bacteria 960
331 Ga0495673_0240838 3300047469 Bacteria 663
332 Ga0495684_0030174 3300047471 Bacteria 4162
333 Ga0495686_0103182 3300047472 Bacteria 1718
334 Ga0495593_0060648 3300047673 Bacteria 1980
335 Ga0495593_0426203 3300047673 Bacteria 664
336 Ga0496100_0039218 3300048903 Bacteria 3007
337 Ga0496100_0098524 3300048903 Bacteria 2010
338 Ga0496100_0115010 3300048903 Bacteria 1875
339 Ga0496101_0011635 3300048904 Bacteria 5845
340 Ga0496101_0279741 3300048904 Bacteria 1304
341 Ga0496101_1019795 3300048904 Bacteria 651
342 Ga0496102_0039706 3300048905 Bacteria 4254
343 Ga0496102_0053475 3300048905 Bacteria 3680
344 Ga0496102_0148630 3300048905 Bacteria 2200
345 Ga0496102_0164551 3300048905 Bacteria 2087
346 Ga0496103_0045723 3300048906 Bacteria 2701
347 Ga0496103_0388914 3300048906 Bacteria 896
348 Ga0496104_0031460 3300048907 Bacteria 4935
349 Ga0496104_0065636 3300048907 Bacteria 3444
350 Ga0496104_0151202 3300048907 Bacteria 2228
351 Ga0496105_0200636 3300048908 Bacteria 1628
352 Ga0496105_0269539 3300048908 Bacteria 1375
353 Ga0496106_0024665 3300048909 Bacteria 4472
354 Ga0496106_0246562 3300048909 Bacteria 1427
355 Ga0496106_0571612 3300048909 Bacteria 906
356 Ga0496107_0006233 3300048910 Bacteria 8199
357 Ga0496107_0049952 3300048910 Bacteria 3014
358 Ga0496107_0314916 3300048910 Bacteria 1165
359 Ga0496107_0483298 3300048910 Bacteria 919
360 Ga0496107_0886510 3300048910 Bacteria 651
361 Ga0496108_0000380 3300048911 Bacteria 36881
362 Ga0496108_0041868 3300048911 Bacteria 3824
363 Ga0496108_0080099 3300048911 Bacteria 2766
364 Ga0496108_0208089 3300048911 Bacteria 1698
365 Ga0496109_0000887 3300048912 Bacteria 25028
366 Ga0496109_0022786 3300048912 Bacteria 5550
367 Ga0496109_0024908 3300048912 Bacteria 5326
368 Ga0496109_0284068 3300048912 Bacteria 1560
369 Ga0496110_0010433 3300048913 Bacteria 7554
370 Ga0496110_0025529 3300048913 Bacteria 5050
371 Ga0496110_0115895 3300048913 Bacteria 2412
372 Ga0496110_0216822 3300048913 Bacteria 1740
373 Ga0496110_0449424 3300048913 Bacteria 1174
374 Ga0496111_0039485 3300048914 Bacteria 3384
375 Ga0496111_0042845 3300048914 Bacteria 3251
376 Ga0496111_0133299 3300048914 Bacteria 1839
377 Ga0496112_0009949 3300048915 Bacteria 8603
378 Ga0496112_0019653 3300048915 Bacteria 6381
379 Ga0496112_0083541 3300048915 Bacteria 3158
380 Ga0496112_0095617 3300048915 Bacteria 2941
381 Ga0496113_0059578 3300048916 Bacteria 2876
382 Ga0496113_0064959 3300048916 Bacteria 2761
383 Ga0496113_0171478 3300048916 Bacteria 1718
384 Ga0496113_0206522 3300048916 Bacteria 1562
385 Ga0496114_0060321 3300048917 Bacteria 3170
386 Ga0496114_0209482 3300048917 Bacteria 1709
387 Ga0496114_0253413 3300048917 Bacteria 1549
388 Ga0496114_0346372 3300048917 Bacteria 1314
389 Ga0496114_0894159 3300048917 Bacteria 769
390 Ga0496115_0006328 3300048918 Bacteria 8667
391 Ga0496115_0053394 3300048918 Bacteria 3243
392 Ga0496115_0214553 3300048918 Bacteria 1589
393 Ga0496115_0557227 3300048918 Bacteria 915
394 Ga0496117_0212303 3300048920 Bacteria 1084
395 Ga0496118_0130367 3300048921 Bacteria 1616
396 Ga0496118_0176158 3300048921 Bacteria 1299
397 Ga0496119_0065627 3300048922 Bacteria 2149
398 Ga0496121_0056398 3300048924 Bacteria 3263
399 Ga0496121_0069168 3300048924 Bacteria 2851
400 Ga0496121_0175576 3300048924 Bacteria 1551
401 Ga0496121_0238088 3300048924 Bacteria 1270
402 Ga0496125_0180813 3300048928 Bacteria 1405
403 Ga0496126_0017928 3300048929 Bacteria 7041
404 Ga0496126_0049595 3300048929 Bacteria 3832
405 Ga0496126_0544859 3300048929 Bacteria 921
406 Ga0496126_0549413 3300048929 Bacteria 917
407 Ga0501032_0156737 3300049569 Bacteria 1495
408 Ga0501033_0012530 3300049570 Bacteria 6470
409 Ga0501034_0356662 3300049571 Bacteria 1390
410 Ga0501037_0081042 3300049573 Bacteria 2353
411 Ga0501038_0031101 3300049574 Bacteria 4719
412 Ga0501039_0090864 3300049575 Bacteria 2379
413 Ga0501039_0214241 3300049575 Bacteria 1514
414 Ga0501042_0037122 3300049578 Bacteria 3457
415 Ga0501043_0007643 3300049579 Bacteria 8565
416 Ga0501046_0007671 3300049580 Bacteria 9466
417 Ga0501046_0088319 3300049580 Bacteria 2387
418 Ga0501046_0160467 3300049580 Bacteria 1691
419 Ga0501047_0388384 3300049581 Bacteria 1229
420 Ga0501047_0693341 3300049581 Bacteria 836
421 Ga0501069_0028417 3300049585 Bacteria 3066
422 Ga0501070_0186893 3300049586 Bacteria 1704
423 Ga0501073_0162419 3300049589 Bacteria 1547
424 Ga0501073_0588816 3300049589 Bacteria 768
425 Ga0501074_0121206 3300049590 Bacteria 1870
426 Ga0501077_0084712 3300049593 Bacteria 2009
427 Ga0501080_0153252 3300049742 Bacteria 2129
428 Ga0501035_0001734 3300049822 Bacteria 22041
429 Ga0501035_0144003 3300049822 Bacteria 2071
430 Ga0501044_0007234 3300049823 Bacteria 12202
431 Ga0501044_0189777 3300049823 Bacteria 2018
432 nmdc:mga0yw44_19644_c1 3300050492 Bacteria 3730
433 nmdc:mga06z11_648049_c1 3300050494 Bacteria 643
434 nmdc:mga07m45_429704_c1 3300050496 Bacteria 766
435 Ga0495601_0081832 3300053077 Bacteria 2072
436 Ga0495612_0013853 3300053078 Bacteria 3249
437 Ga0500610_0035040 3300053079 Bacteria 2572
438 Ga0500635_0016152 3300053080 Bacteria 2215
439 Ga0500635_0161502 3300053080 Bacteria 859
440 Ga0495655_0146563 3300053083 Bacteria 739
441 Ga0500578_0296843 3300053086 Bacteria 959
442 Ga0500578_0748342 3300053086 Bacteria 521
443 Ga0500643_000019 3300053087 Bacteria 294301
444 Ga0500646_0029150 3300053090 Bacteria 1510
445 Ga0500583_0018689 3300053092 Bacteria 2823
446 Ga0500651_0211557 3300053093 Bacteria 1140
447 Ga0500566_0000268 3300053094 Bacteria 27976
448 Ga0500566_0001603 3300053094 Bacteria 13315
449 Ga0500566_0139603 3300053094 Bacteria 1287
450 Ga0500640_017117 3300053095 Bacteria 3070
451 Ga0500640_083424 3300053095 Bacteria 1351
452 Ga0500554_006947 3300053102 Bacteria 2575
453 Ga0500555_001655 3300053103 Bacteria 6728
454 Ga0500556_0002493 3300053104 Bacteria 5875
455 Ga0500562_054526 3300053108 Bacteria 1071
456 Ga0500569_003137 3300053109 Bacteria 3341
457 Ga0500569_164011 3300053109 Bacteria 752
458 Ga0500595_005882 3300053119 Bacteria 5284
459 Ga0500595_035212 3300053119 Bacteria 1650
460 Ga0500608_018938 3300053122 Bacteria 3149
461 Ga0500608_133933 3300053122 Bacteria 1108
462 Ga0500614_024975 3300053123 Bacteria 1416
463 Ga0500614_026731 3300053123 Bacteria 1381
464 Ga0500614_079511 3300053123 Bacteria 915
465 Ga0500655_011006 3300053133 Bacteria 1636
466 Ga0500658_0339090 3300053134 Bacteria 690
467 Ga0500658_0376246 3300053134 Bacteria 651
468 Ga0500559_0018048 3300053136 Bacteria 2982
469 Ga0500559_0401408 3300053136 Bacteria 637
470 Ga0500564_093688 3300053138 Bacteria 1334
471 Ga0500568_0004911 3300053139 Bacteria 7040
472 Ga0500577_0037907 3300053142 Bacteria 1737
473 Ga0500585_128701 3300053144 Bacteria 898
474 Ga0500590_129153 3300053148 Bacteria 1172
475 Ga0500603_080015 3300053150 Bacteria 945
476 Ga0500620_038316 3300053155 Bacteria 1560
477 Ga0500622_0031007 3300053156 Bacteria 2804
478 Ga0500627_0093672 3300053158 Bacteria 1345
479 Ga0500633_0078279 3300053160 Bacteria 1192
480 Ga0500638_003446 3300053162 Bacteria 5853
481 Ga0500638_030691 3300053162 Bacteria 2588
482 Ga0500638_106612 3300053162 Bacteria 1299
483 Ga0500639_091516 3300053163 Bacteria 1514
484 Ga0500636_0001013 3300053177 Bacteria 15052
485 Ga0500637_0000107 3300053178 Bacteria 29902
486 Ga0500637_0056919 3300053178 Bacteria 2234
487 Ga0500637_0288333 3300053178 Bacteria 900
488 Ga0500567_159874 3300053723 Bacteria 827
489 Ga0500576_212442 3300053725 Bacteria 644
490 Ga0500611_031717 3300053727 Bacteria 1100
491 Ga0500609_001086 3300053731 Bacteria 4063
492 Ga0500599_000690 3300053736 Bacteria 3643
493 Ga0500601_000516 3300053737 Bacteria 5883
494 Ga0500661_017697 3300055283 Bacteria 1272
495 Ga0500661_056711 3300055283 Bacteria 704
496 2511400049 2511231028 Bacteria 8046582
497 2513627587 2513237092 Bacteria 8341956
498 2513643907 2513237094 Bacteria 8789602
499 2513648819 2513237095 Bacteria 8976980
500 2528850907 2528768022 Bacteria 10457665
501 2617379122 2617270741 Bacteria 8201522
502 2818241777 2816332527 Bacteria 8933356
503 2824608268 2824600985 Bacteria 8488197
504 2824616967 2824609381 Bacteria 8672835
505 2824659866 2824653114 Bacteria 8493680
506 2824665016 2824661429 Bacteria 9877870
507 2824684122 2824679649 Bacteria 8248951
508 2824708315 2824704595 Bacteria 9667483
509 2824739409 2824732956 Bacteria 7810675
510 2824752257 2824746037 Bacteria 7911610
511 2824761046 2824753945 Bacteria 9787441
512 2824771759 2824763712 Bacteria 9792355
513 2844317561 2844315083 Bacteria 8138177
514 2847934352 2847930680 Bacteria 9342022
515 2857509782 2857509624 Bacteria 7472071
516 2874618047 2874612657 Bacteria 8252029
517 2874636222 2874628541 Bacteria 8630250
518 2879085629 2879083081 Bacteria 8587928
519 2879110008 2879099564 Bacteria 10442239
520 2881367580 2881364244 Bacteria 7710352
521 2881669900 2881665667 Bacteria 8175609
522 2885379135 2885374607 Bacteria 8927485
523 2885411479 2885409591 Bacteria 9235467
524 2888422864 2888419890 Bacteria 7857137
525 2903735247 2903727486 Bacteria 8281579
526 2904718649 2904711408 Bacteria 9771557
527 2906608842 2906602504 Bacteria 8295279
528 2906634618 2906626472 Bacteria 8826946
529 2906651006 2906643746 Bacteria 8722424
530 2908778539 2908775508 Bacteria 8092255
531 2922375752
532 2922394804 2922393267 Bacteria 8285685
533 2929616457 2929615660 Bacteria 9193770
534 2929625201 2929624759 Bacteria 9339455
535 2932786876 2932784394 Bacteria 9704911
536 2932811077 2932809354 Bacteria 9135765
537 2932825931 2932818245 Bacteria 9955613
538 2933578260 2933577622 Bacteria 9116884
539 2935619238 2935616580 Bacteria 9032984
540 2935645377 2935638405 Bacteria 10015038
541 2935671475 2935665750 Bacteria 9571747
542 2935677288 2935675223 Bacteria 9928132
543 2935695185 2935694250 Bacteria 9291695
544 2935708112 2935703347 Bacteria 10242284
545 2935761459 2935760218 Bacteria 9817913
546 2935805155 2935801545 Bacteria 9301974
547 2935812224 2935810662 Bacteria 9401221
548 2935834780 2935827899 Bacteria 10038562
549 2935839007 2935837841 Bacteria 9454360
550 2935857603 2935855204 Bacteria 9035059
551 2935865157 2935864058 Bacteria 9784707
552 2935881607 2935873716 Bacteria 9632195
553 2935997367 2935992306 Bacteria 9802711
554 2936005150 2936002035 Bacteria 9362176
555 2936038818 2936037263 Bacteria 9446081
556 2941539697 2941538514 Bacteria 9402094
557 3005487764 3005483717 Bacteria 7877331
558 3005589275 3005587118 Bacteria 7794411
559 3005597299 3005594810 Bacteria 8716512
560 3005720682 3005718088 Bacteria 8283608
561 8006942848 8006933436 Bacteria 10410654
562 8006982567 8006973647 Bacteria 10679141
563 8016590662 8016583857 Bacteria 10421953
564 8019580594 8019576017 Bacteria 10049540
565 8019588314 8019586578 Bacteria 10212056
566 8019603023 8019597564 Bacteria 10041141
567 8019615524 8019608314 Bacteria 10042931
568 8055748103 8055742211 Bacteria 9226248
569 8056969358 8056967851 Bacteria 9038162
570 Ga0436365_0178431
571 JGI25404J52841_10056081
572 Ga0065165_1004783
573 Ga0068869_100315740
574 Ga0070682_100029289
575 Ga0070682_101436268
576 Ga0070671_102089504
577 Ga0070688_100248278
578 Ga0070659_100178020
579 Ga0070659_100868112
580 Ga0070709_10055377
581 Ga0070709_10304938
582 Ga0070709_10984365
583 Ga0070714_100232554
584 Ga0070714_100810716
585 Ga0070714_101085295
586 Ga0070713_100076827
587 Ga0070713_100239253
588 Ga0070713_100503954
589 Ga0070713_100856702
590 Ga0070710_10227845
591 Ga0070710_10624372
592 Ga0070711_101921296
593 Ga0070705_100476941
594 Ga0070708_100032417
595 Ga0070663_100122009
596 Ga0070663_100199835
597 Ga0070662_101789738
598 Ga0070706_100047855
599 Ga0070706_100258749
600 Ga0070706_100427436
601 Ga0070707_100037262
602 Ga0070707_100135061
603 Ga0070698_100714333
604 Ga0070699_102204550
605 Ga0070679_101992178
606 Ga0070684_100978085
607 Ga0068853_100147010
608 Ga0068853_100454017
609 Ga0070672_100950855
610 Ga0070686_101167110
611 Ga0070693_100177620
612 Ga0070693_101481306
613 Ga0070664_100459944
614 Ga0068857_100901521
615 Ga0068854_100016308
616 Ga0068854_100314585
617 Ga0068854_100485112
618 Ga0068856_101442144
619 Ga0070702_100179227
620 Ga0068852_100628347
621 Ga0068859_100843299
622 Ga0068859_101087868
623 Ga0068864_100181960
624 Ga0068861_101001477
625 Ga0068863_101435445
626 Ga0068858_100385654
627 Ga0068858_100483246
628 Ga0081455_10004004
629 Ga0070717_10970392
630 Ga0075365_10496482
631 Ga0070716_100566887
632 Ga0070716_100631549
633 Ga0070712_101088240
634 Ga0097621_100508764
635 Ga0068871_100364911
636 Ga0097620_100843180
637 Ga0097620_101087944
638 Ga0099825_1064018
639 Ga0099824_1007912
640 Ga0099824_1016379
641 Ga0099822_1010465
642 Ga0099822_1069866
643 Ga0099823_1026544
644 Ga0099794_10127793
645 Ga0099795_10101170
646 Ga0105240_10158286
647 Ga0105240_10447708
648 Ga0105240_10464323
649 Ga0105240_12243939
650 Ga0105240_12412120
651 Ga0105241_10284237
652 Ga0105241_10383048
653 Ga0105237_10277912
654 Ga0105237_10437170
655 Ga0105237_10449852
656 Ga0105237_10461564
657 Ga0105237_10475553
658 Ga0105237_11177779
659 Ga0105237_12245024
660 Ga0105238_10021257
661 Ga0105238_12962311
662 Ga0105249_10905385
663 Ga0105239_10078072
664 Ga0105239_10113463
665 Ga0105246_10237061
666 Ga0105246_11192601
667 Ga0157342_1045086
668 Ga0157371_10200333
669 Ga0157370_10036629
670 Ga0157370_10227785
671 Ga0157369_10005835
672 Ga0157369_10029707
673 Ga0157374_10312709
674 Ga0163162_10418388
675 Ga0157372_10771862
676 Ga0157372_11314419
677 Ga0163163_10031521
678 Ga0157376_11028905
679 Ga0157376_11284001
680 Ga0157376_11330381
681 Ga0163161_10318469
682 Ga0206356_10121414
683 Ga0206353_10186442
684 Ga0214544_1013327
685 Ga0214542_1000024
686 Ga0214545_1000011
687 Ga0214543_1000033
688 Ga0213874_10423489
689 Ga0213876_10254293
690 Ga0213875_10628235
691 Ga0209148_1001502
692 Ga0209233_1003438
693 Ga0209758_1006897
694 Ga0209758_1127633
695 Ga0207426_1002649
696 Ga0207692_10695985
697 Ga0207692_10761278
698 Ga0207692_10761870
699 Ga0207710_10126434
700 Ga0207647_10296775
701 Ga0207647_10549267
702 Ga0207699_10278769
703 Ga0207699_10772135
704 Ga0207699_11135396
705 Ga0207643_11095656
706 Ga0207684_10071751
707 Ga0207684_10175462
708 Ga0207684_10370601
709 Ga0207654_10222569
710 Ga0207654_11365130
711 Ga0207707_10014355
712 Ga0207695_10000029
713 Ga0207695_10034831
714 Ga0207695_10420053
715 Ga0207695_11089023
716 Ga0207671_10213149
717 Ga0207671_10353900
718 Ga0207671_10382277
719 Ga0207671_11128497
720 Ga0207671_11440411
721 Ga0207663_10443630
722 Ga0207663_11645191
723 Ga0207660_11015927
724 Ga0207657_10388938
725 Ga0207652_11034617
726 Ga0207646_10023574
727 Ga0207646_10072743
728 Ga0207681_10504133
729 Ga0207694_10727222
730 Ga0207694_10760020
731 Ga0207694_11751814
732 Ga0207700_10043640
733 Ga0207700_10440454
734 Ga0207664_10195089
735 Ga0207664_10211584
736 Ga0207664_10332871
737 Ga0207664_10558457
738 Ga0207644_10200645
739 Ga0207644_11344411
740 Ga0207686_10715968
741 Ga0207665_10618154
742 Ga0207665_10919519
743 Ga0207665_10954939
744 Ga0207691_11404058
745 Ga0207711_10733839
746 Ga0207689_10309290
747 Ga0207661_10454147
748 Ga0207679_10410865
749 Ga0207667_10314899
750 Ga0207667_10330438
751 Ga0207667_10504519
752 Ga0207667_10797912
753 Ga0207640_10020845
754 Ga0207640_10069102
755 Ga0207640_10282216
756 Ga0207640_11427679
757 Ga0207703_10406408
758 Ga0207703_10417502
759 Ga0207639_10091597
760 Ga0207678_10084297
761 Ga0207678_10143271
762 Ga0207678_11208087
763 Ga0207702_11482170
764 Ga0207641_12248962
765 Ga0207641_12403016
766 Ga0207676_10025350
767 Ga0207676_10426193
768 Ga0207674_10030360
769 Ga0207675_102260701
770 Ga0207683_10167000
771 Ga0207698_10542196
772 Ga0207698_10714393
773 Ga0207698_11658522
774 Ga0209389_1000011
775 Ga0209389_1000127
776 Ga0209589_1000018
777 Ga0209589_1000243
778 Ga0209489_100017
779 Ga0209489_100026
780 Ga0209489_103202
781 Ga0209700_100027
782 Ga0209700_100035
783 Ga0268266_10022345
784 Ga0268264_10691164
785 Ga0307517_10535930
786 Ga0265325_10055825
787 Ga0265339_10076575
788 Ga0265339_10085032
789 Ga0265316_10242079
790 Ga0307508_10119213
791 Ga0265314_10105211
792 Ga0265342_10040515
793 Ga0265342_10064811
794 Ga0265342_10393269
795 Ga0373926_0023390
796 Ga0373934_0018969
797 Ga0373944_0064439
798 Ga0373936_0057613
799 Ga0373945_0040656
800 Ga0373953_0045918
801 Ga0373953_0344254
802 Ga0373956_0358340
803 Ga0373957_0050704
804 Ga0373943_0013846
805 Ga0373946_0010454
806 Ga0373955_0008262
807 Ga0373924_0041228
808 Ga0373924_0383663
809 Ga0373935_0064733
810 Ga0373927_0278782
811 Ga0373927_0347072
812 Ga0373947_0009853
813 Ga0373937_0236202
814 Ga0372808_003329
815 Ga0373925_0017147
816 Ga0373925_0725222
817 Ga0395899_0334384
818 Ga0395899_0821442
819 Ga0395900_0075859
820 Ga0395900_0366915
821 Ga0395900_0411266
822 Ga0395900_0451608
823 Ga0395900_1633563
824 Ga0395898_0124215
825 Ga0395898_0224446
826 Ga0395898_0794481
827 Ga0395905_0019972
828 Ga0436364_1450619
829 Ga0395901_0105975
830 Ga0395901_0154437
831 Ga0395901_0212945
832 Ga0395901_1021112
833 Ga0395901_1629430
834 Ga0436365_0494736
835 Ga0436365_1050405
836 Ga0436365_1463292
837 Ga0436363_0031148
838 Ga0436363_0083491
839 Ga0436363_0231197
840 Ga0436363_0664146
841 Ga0466969_0082814
842 Ga0466972_0340380
843 Ga0466966_0001672
844 Ga0466966_0401296
845 Ga0466961_0001529
846 Ga0466961_0095574
847 Ga0466963_0008396
848 Ga0466963_0584878
849 Ga0466963_0992438
850 Ga0466964_0024340
851 Ga0466968_0066780
852 Ga0466968_0199323
853 Ga0466960_0097520
854 Ga0466959_0007544
855 Ga0466959_0478988
856 Ga0466958_0551298
857 Ga0466967_0067579
858 Ga0466967_0607048
859 Ga0495617_107701
860 Ga0495592_0122617
861 Ga0495603_0066734
862 Ga0495590_0188267
863 Ga0495638_0018259
864 Ga0495641_0057861
865 Ga0495580_0085185
866 Ga0495605_0100811
867 Ga0495639_0008079
868 Ga0495662_0035313
869 Ga0495596_0256864
870 Ga0495606_0190266
871 Ga0495608_0226018
872 Ga0495610_0139345
873 Ga0495618_0042690
874 Ga0495620_0151201
875 Ga0495628_0069242
876 Ga0495628_1005855
877 Ga0495630_0308011
878 Ga0495648_0079112
879 Ga0495652_0186049
880 Ga0495652_0194351
881 Ga0495665_0093964
882 Ga0495640_0060893
883 Ga0495586_0019649
884 Ga0495634_0037343
885 Ga0495611_0081580
886 Ga0495625_0307664
887 Ga0495635_0031038
888 Ga0495588_0108138
889 Ga0495657_0203499
890 Ga0495599_0087252
891 Ga0495646_0040062
892 Ga0495624_0021179
893 Ga0495649_0038311
894 Ga0495649_0235352
895 Ga0495600_0086850
896 Ga0495660_0218466
897 Ga0495674_0446577
898 Ga0495672_0298583
899 Ga0495687_118453
900 Ga0495673_0240838
901 Ga0495684_0030174
902 Ga0495686_0103182
903 Ga0495593_0060648
904 Ga0495593_0426203
905 Ga0496100_0039218
906 Ga0496100_0098524
907 Ga0496100_0115010
908 Ga0496101_0011635
909 Ga0496101_0279741
910 Ga0496101_1019795
911 Ga0496102_0039706
912 Ga0496102_0053475
913 Ga0496102_0148630
914 Ga0496102_0164551
915 Ga0496103_0045723
916 Ga0496103_0388914
917 Ga0496104_0031460
918 Ga0496104_0065636
919 Ga0496104_0151202
920 Ga0496105_0200636
921 Ga0496105_0269539
922 Ga0496106_0024665
923 Ga0496106_0246562
924 Ga0496106_0571612
925 Ga0496107_0006233
926 Ga0496107_0049952
927 Ga0496107_0314916
928 Ga0496107_0483298
929 Ga0496107_0886510
930 Ga0496108_0000380
931 Ga0496108_0041868
932 Ga0496108_0080099
933 Ga0496108_0208089
934 Ga0496109_0000887
935 Ga0496109_0022786
936 Ga0496109_0024908
937 Ga0496109_0284068
938 Ga0496110_0010433
939 Ga0496110_0025529
940 Ga0496110_0115895
941 Ga0496110_0216822
942 Ga0496110_0449424
943 Ga0496111_0039485
944 Ga0496111_0042845
945 Ga0496111_0133299
946 Ga0496112_0009949
947 Ga0496112_0019653
948 Ga0496112_0083541
949 Ga0496112_0095617
950 Ga0496113_0059578
951 Ga0496113_0064959
952 Ga0496113_0171478
953 Ga0496113_0206522
954 Ga0496114_0060321
955 Ga0496114_0209482
956 Ga0496114_0253413
957 Ga0496114_0346372
958 Ga0496114_0894159
959 Ga0496115_0006328
960 Ga0496115_0053394
961 Ga0496115_0214553
962 Ga0496115_0557227
963 Ga0496117_0212303
964 Ga0496118_0130367
965 Ga0496118_0176158
966 Ga0496119_0065627
967 Ga0496121_0056398
968 Ga0496121_0069168
969 Ga0496121_0175576
970 Ga0496121_0238088
971 Ga0496125_0180813
972 Ga0496126_0017928
973 Ga0496126_0049595
974 Ga0496126_0544859
975 Ga0496126_0549413
976 Ga0501032_0156737
977 Ga0501033_0012530
978 Ga0501034_0356662
979 Ga0501037_0081042
980 Ga0501038_0031101
981 Ga0501039_0090864
982 Ga0501039_0214241
983 Ga0501042_0037122
984 Ga0501043_0007643
985 Ga0501046_0007671
986 Ga0501046_0088319
987 Ga0501046_0160467
988 Ga0501047_0388384
989 Ga0501047_0693341
990 Ga0501069_0028417
991 Ga0501070_0186893
992 Ga0501073_0162419
993 Ga0501073_0588816
994 Ga0501074_0121206
995 Ga0501077_0084712
996 Ga0501080_0153252
997 Ga0501035_0001734
998 Ga0501035_0144003
999 Ga0501044_0007234
1000 Ga0501044_0189777
1001 nmdc:mga0yw44_19644_c1
1002 nmdc:mga06z11_648049_c1
1003 nmdc:mga07m45_429704_c1
1004 Ga0495601_0081832
1005 Ga0495612_0013853
1006 Ga0500610_0035040
1007 Ga0500635_0016152
1008 Ga0500635_0161502
1009 Ga0495655_0146563
1010 Ga0500578_0296843
1011 Ga0500578_0748342
1012 Ga0500643_000019
1013 Ga0500646_0029150
1014 Ga0500583_0018689
1015 Ga0500651_0211557
1016 Ga0500566_0000268
1017 Ga0500566_0001603
1018 Ga0500566_0139603
1019 Ga0500640_017117
1020 Ga0500640_083424
1021 Ga0500554_006947
1022 Ga0500555_001655
1023 Ga0500556_0002493
1024 Ga0500562_054526
1025 Ga0500569_003137
1026 Ga0500569_164011
1027 Ga0500595_005882
1028 Ga0500595_035212
1029 Ga0500608_018938
1030 Ga0500608_133933
1031 Ga0500614_024975
1032 Ga0500614_026731
1033 Ga0500614_079511
1034 Ga0500655_011006
1035 Ga0500658_0339090
1036 Ga0500658_0376246
1037 Ga0500559_0018048
1038 Ga0500559_0401408
1039 Ga0500564_093688
1040 Ga0500568_0004911
1041 Ga0500577_0037907
1042 Ga0500585_128701
1043 Ga0500590_129153
1044 Ga0500603_080015
1045 Ga0500620_038316
1046 Ga0500622_0031007
1047 Ga0500627_0093672
1048 Ga0500633_0078279
1049 Ga0500638_003446
1050 Ga0500638_030691
1051 Ga0500638_106612
1052 Ga0500639_091516
1053 Ga0500636_0001013
1054 Ga0500637_0000107
1055 Ga0500637_0056919
1056 Ga0500637_0288333
1057 Ga0500567_159874
1058 Ga0500576_212442
1059 Ga0500611_031717
1060 Ga0500609_001086
1061 Ga0500599_000690
1062 Ga0500601_000516
1063 Ga0500661_017697
1064 Ga0500661_056711
1065 2511400049
1066 2513627587
1067 2513643907
1068 2513648819
1069 2528850907
1070 2617379122
1071 2818241777
1072 2824608268
1073 2824616967
1074 2824659866
1075 2824665016
1076 2824684122
1077 2824708315
1078 2824739409
1079 2824752257
1080 2824761046
1081 2824771759
1082 2844317561
1083 2847934352
1084 2857509782
1085 2874618047
1086 2874636222
1087 2879085629
1088 2879110008
1089 2881367580
1090 2881669900
1091 2885379135
1092 2885411479
1093 2888422864
1094 2903735247
1095 2904718649
1096 2906608842
1097 2906634618
1098 2906651006
1099 2908778539
1100 2922375752
1101 2922394804
1102 2929616457
1103 2929625201
1104 2932786876
1105 2932811077
1106 2932825931
1107 2933578260
1108 2935619238
1109 2935645377
1110 2935671475
1111 2935677288
1112 2935695185
1113 2935708112
1114 2935761459
1115 2935805155
1116 2935812224
1117 2935834780
1118 2935839007
1119 2935857603
1120 2935865157
1121 2935881607
1122 2935997367
1123 2936005150
1124 2936038818
1125 2941539697
1126 3005487764
1127 3005589275
1128 3005597299
1129 3005720682
1130 8006942848
1131 8006982567
1132 8016590662
1133 8019580594
1134 8019588314
1135 8019603023
1136 8019615524
1137 8055748103
1138 8056969358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10135

Rod-binding

Rod binding protein

63

114

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kif-assembly1.cif.gz_K structure of cyanobacterial photosystem i-isia-flavodoxin supercomplex 0.4349 36 109
6kif-assembly1.cif.gz_K structure of cyanobacterial photosystem i-isia-flavodoxin supercomplex 0.3893 36 109
4zva-assembly1.cif.gz_B crystal structure of globin domain of the e. coli dosc - form i (ferric) 0.3581 27 105
7nhk-assembly1.cif.gz_0 lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.3401 27 116
5hgl-assembly1.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.3345 36 118
ID Description Score Start End Superfamily
af_F6NGW9_276_452_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3464 27 120 1.20.1270.60
af_I1JXB6_1_188_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3262 27 118 1.10.287.1490
af_P75952_81_208_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.3249 12 121 1.10.357.10
af_P0AA89_6_154_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3066 27 119 1.10.490.10
af_P75952_81_208_1.10.357.10 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.2928 12 121 1.10.357.10
ID Description Score Start End GO Terms
AF-A0A2M7T1G5-F1-model_v4 Rod-binding protein 0.7789 36 119
AF-A0A560BYL4-F1-model_v4 Rod binding protein 0.7777 40 121
AF-A0A2E2QB11-F1-model_v4 Flagellar protein FlgJ N-terminal domain-containing protein 0.7752 26 121
AF-A0A2A4XYQ5-F1-model_v4 Flagellar protein FlgJ N-terminal domain-containing protein 0.7742 34 116
AF-A0A6I2SQI0-F1-model_v4 Rod-binding protein 0.7737 36 120

Map