F464672

General Info

Members Datasets Scaffolds Average Seq Length
568 265 1136 177

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0000991|Ga0501070_0000991_10625_11239
Length 204
Sequence MFLLYDPCGIKDLLFDPSGGTQQMSTIEQTAQGVPTGTFNADTVHSSIGFEVPYAVATFSGEVPQFQASLVDGTLTGSAQIAGLVTKDENLTAHLASPEFFDAERFPEVRFEGEAARREGDEIAFEGTITLKGETKPATLTGTIVGPAVDHFGATRVGLELTTVIDRTEFGINWNMPLPNGEPALANEVTLKADLTLVQAQDQA

Samples

Sample ID Description Type Environment
1 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.63
Metatranscriptomes 19.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.86
Rhizosphere 88.73
Stem 0
Stem Tuber 0
Unclassified 12.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501070_0000991 3300049586 Bacteria 25484
2 Ga0006778J45830_1029577 3300003162 Bacteria 700
3 Ga0006778J45830_1034319 3300003162 Unclassified 664
4 Ga0006778J45830_1052242 3300003162 Bacteria 616
5 Ga0006778J45830_1097030 3300003162 Bacteria 585
6 Ga0006759J45824_1007741 3300003163 Bacteria 750
7 Ga0006759J45824_1031794 3300003163 Bacteria 604
8 Ga0006758J48902_1004227 3300003300 Bacteria 625
9 Ga0006758J48902_1012181 3300003300 Bacteria 710
10 Ga0006770J48903_1004101 3300003305 Bacteria 727
11 Ga0006770J48903_1016331 3300003305 Bacteria 717
12 Ga0006777J48905_1001629 3300003308 Bacteria 625
13 Ga0006777J48905_1015432 3300003308 Bacteria 785
14 Ga0006777J48905_1025684 3300003308 Bacteria 607
15 Ga0006777J48905_1050423 3300003308 Bacteria 673
16 Ga0007417J51691_1003876 3300003544 Bacteria 629
17 Ga0007427J51700_101109 3300003559 Bacteria 680
18 Ga0007427J51700_113217 3300003559 Bacteria 612
19 Ga0007427J51700_114076 3300003559 Bacteria 673
20 Ga0006781J51513_1002549 3300003568 Bacteria 656
21 Ga0007410J51695_1002390 3300003574 Bacteria 714
22 Ga0007410J51695_1028448 3300003574 Bacteria 635
23 Ga0007410J51695_1048764 3300003574 Bacteria 590
24 Ga0007409J51694_1001971 3300003575 Bacteria 772
25 Ga0007416J51690_1003315 3300003577 Bacteria 620
26 Ga0007429J51699_1001658 3300003579 Bacteria 659
27 Ga0007429J51699_1008540 3300003579 Bacteria 837
28 Ga0007429J51699_1014966 3300003579 Bacteria 1298
29 Ga0007429J51699_1029933 3300003579 Unclassified 696
30 Ga0007429J51699_1030025 3300003579 Bacteria 604
31 Ga0007429J51699_1035861 3300003579 Bacteria 618
32 Ga0007411J51799_102389 3300003611 Bacteria 782
33 Ga0007411J51799_118237 3300003611 Unclassified 613
34 Ga0007415J51800_103420 3300003613 Bacteria 625
35 Ga0032354_1000249 3300003693 Bacteria 610
36 Ga0032354_1013848 3300003693 Bacteria 612
37 Ga0032354_1013911 3300003693 Bacteria 587
38 Ga0006780_1000066 3300003735 Bacteria 617
39 Ga0006780_1016240 3300003735 Bacteria 597
40 Ga0006780_1030091 3300003735 Bacteria 758
41 Ga0058863_10061302 3300004799 Bacteria 599
42 Ga0058863_11896675 3300004799 Bacteria 817
43 Ga0058861_12070719 3300004800 Bacteria 812
44 Ga0058862_12794553 3300004803 Bacteria 782
45 Ga0070658_10012635 3300005327 Bacteria 6773
46 Ga0070658_10085398 3300005327 Bacteria 2595
47 Ga0070683_100017112 3300005329 Bacteria 6400
48 Ga0070683_100058326 3300005329 Bacteria 3587
49 Ga0070683_100826328 3300005329 Bacteria 888
50 Ga0070680_100008991 3300005336 Bacteria 7658
51 Ga0070680_100088061 3300005336 Bacteria 2568
52 Ga0070680_100201094 3300005336 Bacteria 1680
53 Ga0068868_100276191 3300005338 Bacteria 1421
54 Ga0068868_100450733 3300005338 Bacteria 1119
55 Ga0070660_100000669 3300005339 Bacteria 22661
56 Ga0070660_100006214 3300005339 Bacteria 8268
57 Ga0070660_100134758 3300005339 Bacteria 1979
58 Ga0070660_100257710 3300005339 Bacteria 1424
59 Ga0070661_100009291 3300005344 Bacteria 6800
60 Ga0070661_100019086 3300005344 Bacteria 4882
61 Ga0070661_100048421 3300005344 Bacteria 3111
62 Ga0070661_100062419 3300005344 Bacteria 2735
63 Ga0070671_100114839 3300005355 Bacteria 2263
64 Ga0070673_100635399 3300005364 Unclassified 976
65 Ga0070673_100998585 3300005364 Bacteria 779
66 Ga0070659_100017241 3300005366 Bacteria 5430
67 Ga0070659_100041676 3300005366 Bacteria 3589
68 Ga0070659_100134836 3300005366 Bacteria 2007
69 Ga0070667_100019456 3300005367 Bacteria 5634
70 Ga0070714_100048413 3300005435 Bacteria 3615
71 Ga0070714_100051613 3300005435 Bacteria 3507
72 Ga0070714_100358382 3300005435 Bacteria 1371
73 Ga0070714_100715250 3300005435 Bacteria 967
74 Ga0070713_100187321 3300005436 Bacteria 1863
75 Ga0070713_100490589 3300005436 Bacteria 1158
76 Ga0070710_10080823 3300005437 Bacteria 1897
77 Ga0070710_10355271 3300005437 Bacteria 971
78 Ga0070711_100013492 3300005439 Bacteria 5131
79 Ga0070711_100443185 3300005439 Bacteria 1062
80 Ga0070681_10000568 3300005458 Bacteria 30431
81 Ga0070681_10008427 3300005458 Bacteria 10098
82 Ga0070681_10017750 3300005458 Bacteria 7111
83 Ga0070681_10090434 3300005458 Archaea 3011
84 Ga0070681_10122055 3300005458 Bacteria 2539
85 Ga0070681_10143787 3300005458 Bacteria 2315
86 Ga0070681_10209563 3300005458 Bacteria 1865
87 Ga0070681_10301274 3300005458 Bacteria 1513
88 Ga0070679_100007619 3300005530 Bacteria 10133
89 Ga0070679_100008920 3300005530 Bacteria 9462
90 Ga0070679_100012118 3300005530 Bacteria 8236
91 Ga0070679_100034446 3300005530 Bacteria 5018
92 Ga0070679_100044318 3300005530 Bacteria 4431
93 Ga0070679_100149585 3300005530 Bacteria 2312
94 Ga0070679_101287416 3300005530 Unclassified 677
95 Ga0070684_100026078 3300005535 Bacteria 4919
96 Ga0070684_100048145 3300005535 Bacteria 3697
97 Ga0070684_100050326 3300005535 Bacteria 3619
98 Ga0070684_101219536 3300005535 Unclassified 708
99 Ga0068853_100549621 3300005539 Bacteria 1094
100 Ga0068853_102048454 3300005539 Unclassified 555
101 Ga0070696_100018518 3300005546 Bacteria 4708
102 Ga0070665_100032747 3300005548 Bacteria 5230
103 Ga0068855_100017802 3300005563 Bacteria 8542
104 Ga0068855_100042010 3300005563 Bacteria 5418
105 Ga0068855_100181059 3300005563 Bacteria 2382
106 Ga0068855_100341989 3300005563 Bacteria 1649
107 Ga0068855_100517114 3300005563 Bacteria 1295
108 Ga0068855_100722227 3300005563 Unclassified 1064
109 Ga0068857_100075197 3300005577 Bacteria 3011
110 Ga0068854_100397920 3300005578 Bacteria 1139
111 Ga0068854_100437262 3300005578 Bacteria 1090
112 Ga0068856_100032410 3300005614 Bacteria 5115
113 Ga0068856_100234696 3300005614 Bacteria 1850
114 Ga0068852_100141323 3300005616 Bacteria 2228
115 Ga0068852_100387077 3300005616 Bacteria 1373
116 Ga0068851_10706287 3300005834 Unclassified 621
117 Ga0070717_10257655 3300006028 Bacteria 1543
118 Ga0070717_10306347 3300006028 Bacteria 1413
119 Ga0070715_10203634 3300006163 Bacteria 1007
120 Ga0070712_100168812 3300006175 Bacteria 1696
121 Ga0070712_100398504 3300006175 Bacteria 1136
122 Ga0068871_100884958 3300006358 Bacteria 827
123 Ga0075434_100134811 3300006871 Bacteria 2489
124 Ga0105240_10203858 3300009093 Bacteria 2316
125 Ga0105240_10721569 3300009093 Bacteria 1086
126 Ga0105240_10737619 3300009093 Bacteria 1072
127 Ga0105240_11064258 3300009093 Bacteria 862
128 Ga0105245_10097059 3300009098 Bacteria 2721
129 Ga0105245_10120375 3300009098 Bacteria 2452
130 Ga0105241_10483975 3300009174 Bacteria 1100
131 Ga0105241_10570474 3300009174 Unclassified 1019
132 Ga0105242_10089028 3300009176 Bacteria 2594
133 Ga0105242_10430893 3300009176 Bacteria 1238
134 Ga0105248_10254143 3300009177 Bacteria 1978
135 Ga0105237_10081046 3300009545 Bacteria 3236
136 Ga0105237_10090039 3300009545 Bacteria 3058
137 Ga0105237_10398429 3300009545 Bacteria 1381
138 Ga0105238_10086287 3300009551 Bacteria 3126
139 Ga0105238_10169779 3300009551 Bacteria 2157
140 Ga0105238_11438205 3300009551 Bacteria 717
141 Ga0105239_10507853 3300010375 Bacteria 1371
142 Ga0105239_11096794 3300010375 Bacteria 916
143 Ga0157373_10037397 3300013100 Bacteria 3479
144 Ga0157371_10649608 3300013102 Bacteria 787
145 Ga0157370_10016206 3300013104 Bacteria 7553
146 Ga0157370_10098804 3300013104 Bacteria 2736
147 Ga0157370_10206782 3300013104 Bacteria 1820
148 Ga0157369_10041287 3300013105 Bacteria 5036
149 Ga0157369_10085896 3300013105 Bacteria 3361
150 Ga0157369_10167279 3300013105 Bacteria 2318
151 Ga0157369_10176253 3300013105 Bacteria 2251
152 Ga0157369_10890472 3300013105 Bacteria 913
153 Ga0157374_10075537 3300013296 Bacteria 3184
154 Ga0157374_10234721 3300013296 Bacteria 1803
155 Ga0157374_11209100 3300013296 Bacteria 777
156 Ga0157378_10078241 3300013297 Bacteria 2983
157 Ga0157372_10093584 3300013307 Bacteria 3420
158 Ga0157372_10110133 3300013307 Bacteria 3154
159 Ga0157372_10668745 3300013307 Bacteria 1209
160 Ga0157375_10580281 3300013308 Bacteria 1281
161 Ga0182008_10031519 3300014497 Bacteria 2669
162 Ga0157376_10319387 3300014969 Bacteria 1476
163 Ga0157376_10836966 3300014969 Bacteria 935
164 Ga0197907_10124457 3300020069 Bacteria 812
165 Ga0197907_10822869 3300020069 Bacteria 1246
166 Ga0197907_11137880 3300020069 Bacteria 617
167 Ga0206356_10239123 3300020070 Bacteria 888
168 Ga0206356_10614535 3300020070 Bacteria 1604
169 Ga0206356_10751319 3300020070 Unclassified 709
170 Ga0206349_1353523 3300020075 Unclassified 1058
171 Ga0206355_1019154 3300020076 Unclassified 1182
172 Ga0206355_1019366 3300020076 Bacteria 591
173 Ga0206355_1044427 3300020076 Bacteria 598
174 Ga0206355_1171402 3300020076 Unclassified 622
175 Ga0206355_1217979 3300020076 Bacteria 722
176 Ga0206355_1489429 3300020076 Unclassified 786
177 Ga0206355_1532293 3300020076 Unclassified 946
178 Ga0206351_10201544 3300020077 Unclassified 1088
179 Ga0206351_10318354 3300020077 Bacteria 928
180 Ga0206352_11047535 3300020078 Unclassified 776
181 Ga0206350_10173317 3300020080 Bacteria 805
182 Ga0206350_10319200 3300020080 Unclassified 856
183 Ga0206350_10323542 3300020080 Unclassified 579
184 Ga0206350_10752437 3300020080 Unclassified 883
185 Ga0206354_10019764 3300020081 Bacteria 1554
186 Ga0206354_10542128 3300020081 Bacteria 1588
187 Ga0206354_11044154 3300020081 Unclassified 798
188 Ga0206354_11273910 3300020081 Unclassified 591
189 Ga0206353_10925129 3300020082 Bacteria 2384
190 Ga0206353_11348053 3300020082 Bacteria 4913
191 Ga0206353_11777701 3300020082 Unclassified 822
192 Ga0206353_11829303 3300020082 Unclassified 785
193 Ga0154015_1151559 3300020610 Unclassified 648
194 Ga0154015_1283574 3300020610 Unclassified 784
195 Ga0154015_1399456 3300020610 Bacteria 898
196 Ga0154015_1447705 3300020610 Bacteria 957
197 Ga0154015_1527896 3300020610 Bacteria 603
198 Ga0154015_1649564 3300020610 Bacteria 722
199 Ga0224712_10074943 3300022467 Bacteria 1383
200 Ga0224712_10082596 3300022467 Bacteria 1329
201 Ga0224712_10170665 3300022467 Bacteria 975
202 Ga0224712_10207236 3300022467 Unclassified 893
203 Ga0224712_10241705 3300022467 Unclassified 832
204 Ga0207692_10052980 3300025898 Bacteria 2064
205 Ga0207685_10162919 3300025905 Bacteria 1020
206 Ga0207705_10053778 3300025909 Bacteria 2901
207 Ga0207705_10185079 3300025909 Bacteria 1573
208 Ga0207654_10215700 3300025911 Bacteria 1270
209 Ga0207654_10746283 3300025911 Bacteria 705
210 Ga0207707_10002704 3300025912 Bacteria 15851
211 Ga0207707_10008393 3300025912 Bacteria 8963
212 Ga0207707_10025149 3300025912 Bacteria 5207
213 Ga0207707_10082830 3300025912 Bacteria 2801
214 Ga0207707_10099569 3300025912 Archaea 2540
215 Ga0207707_10346393 3300025912 Bacteria 1280
216 Ga0207707_10703503 3300025912 Bacteria 848
217 Ga0207695_10488328 3300025913 Bacteria 1114
218 Ga0207695_11041890 3300025913 Bacteria 698
219 Ga0207671_10096614 3300025914 Bacteria 2233
220 Ga0207671_10246604 3300025914 Bacteria 1404
221 Ga0207693_10109622 3300025915 Bacteria 2165
222 Ga0207663_10045440 3300025916 Bacteria 2702
223 Ga0207663_10209691 3300025916 Bacteria 1411
224 Ga0207660_10003652 3300025917 Bacteria 10026
225 Ga0207660_10285124 3300025917 Bacteria 1312
226 Ga0207657_10005956 3300025919 Bacteria 12684
227 Ga0207657_10008575 3300025919 Bacteria 10358
228 Ga0207657_10065625 3300025919 Bacteria 3094
229 Ga0207657_10073176 3300025919 Bacteria 2897
230 Ga0207657_10097983 3300025919 Bacteria 2437
231 Ga0207649_10018306 3300025920 Bacteria 3981
232 Ga0207649_10725034 3300025920 Bacteria 772
233 Ga0207649_11057025 3300025920 Bacteria 640
234 Ga0207652_10112887 3300025921 Bacteria 2412
235 Ga0207652_10194257 3300025921 Bacteria 1826
236 Ga0207652_10988169 3300025921 Unclassified 740
237 Ga0207694_10059442 3300025924 Bacteria 2973
238 Ga0207694_10416170 3300025924 Bacteria 1119
239 Ga0207664_10158727 3300025929 Bacteria 1927
240 Ga0207664_10291284 3300025929 Bacteria 1434
241 Ga0207664_10426499 3300025929 Bacteria 1182
242 Ga0207664_10866683 3300025929 Bacteria 811
243 Ga0207644_10811292 3300025931 Bacteria 783
244 Ga0207690_10011284 3300025932 Bacteria 5338
245 Ga0207690_10079925 3300025932 Bacteria 2280
246 Ga0207690_10501522 3300025932 Bacteria 982
247 Ga0207686_10170266 3300025934 Bacteria 1535
248 Ga0207665_10242219 3300025939 Bacteria 1329
249 Ga0207661_10042594 3300025944 Bacteria 3580
250 Ga0207661_10148079 3300025944 Bacteria 2027
251 Ga0207667_10024384 3300025949 Bacteria 6642
252 Ga0207667_10130447 3300025949 Bacteria 2589
253 Ga0207667_10259301 3300025949 Bacteria 1778
254 Ga0207667_10517724 3300025949 Archaea 1209
255 Ga0207640_10535370 3300025981 Bacteria 981
256 Ga0207640_10678911 3300025981 Bacteria 881
257 Ga0207640_11365347 3300025981 Unclassified 634
258 Ga0207658_10013186 3300025986 Bacteria 5644
259 Ga0207703_10404734 3300026035 Bacteria 1267
260 Ga0207678_10104109 3300026067 Bacteria 2422
261 Ga0207702_10063825 3300026078 Bacteria 3151
262 Ga0207702_10683921 3300026078 Bacteria 1010
263 Ga0207674_10042327 3300026116 Bacteria 4705
264 Ga0207674_10900537 3300026116 Unclassified 853
265 Ga0207683_10367620 3300026121 Unclassified 1321
266 Ga0207698_10145791 3300026142 Bacteria 2047
267 Ga0268266_10101339 3300028379 Bacteria 2538
268 Ga0265334_10004790 3300028573 Bacteria 5945
269 Ga0265318_10058998 3300028577 Bacteria 1431
270 Ga0265322_10102665 3300028654 Bacteria 813
271 Ga0265338_10004366 3300028800 Bacteria 19136
272 Ga0265338_10147961 3300028800 Bacteria 1829
273 Ga0265330_10331264 3300031235 Bacteria 643
274 Ga0265332_10270922 3300031238 Unclassified 702
275 Ga0265320_10092478 3300031240 Unclassified 1400
276 Ga0265320_10147164 3300031240 Bacteria 1065
277 Ga0265325_10088280 3300031241 Bacteria 1532
278 Ga0265340_10065329 3300031247 Bacteria 1733
279 Ga0265340_10106459 3300031247 Bacteria 1299
280 Ga0265327_10081435 3300031251 Bacteria 1598
281 Ga0265316_10097072 3300031344 Bacteria 2243
282 Ga0265313_10003308 3300031595 Bacteria 13195
283 Ga0265313_10158773 3300031595 Bacteria 962
284 Ga0265314_10308790 3300031711 Bacteria 884
285 Ga0265342_10070669 3300031712 Bacteria 2036
286 Ga0265342_10421742 3300031712 Bacteria 687
287 Ga0307415_100129866 3300032126 Bacteria 1905
288 Ga0373936_0143072 3300035113 Bacteria 1033
289 Ga0373945_0028470 3300035116 Bacteria 1957
290 Ga0373945_0088641 3300035116 Bacteria 1195
291 Ga0373956_0111573 3300035119 Bacteria 1273
292 Ga0373943_0004315 3300035170 Bacteria 6448
293 Ga0373943_0064718 3300035170 Bacteria 1836
294 Ga0373946_0026197 3300035171 Bacteria 2298
295 Ga0373946_0045808 3300035171 Bacteria 1811
296 Ga0373955_0185191 3300035172 Bacteria 1236
297 Ga0373935_0035145 3300035692 Bacteria 3127
298 Ga0373947_0001819 3300035725 Bacteria 13046
299 Ga0373947_0051929 3300035725 Bacteria 2468
300 Ga0373937_0098663 3300036401 Bacteria 2709
301 Ga0373925_0001681 3300037068 Bacteria 18616
302 Ga0373925_0369679 3300037068 Bacteria 1166
303 Ga0395899_0180380 3300037312 Bacteria 1483
304 Ga0395899_0351841 3300037312 Bacteria 985
305 Ga0395899_0364906 3300037312 Bacteria 963
306 Ga0395900_0035739 3300037418 Bacteria 5119
307 Ga0395900_0074239 3300037418 Bacteria 3497
308 Ga0395900_0094345 3300037418 Bacteria 3073
309 Ga0395900_0196029 3300037418 Bacteria 2046
310 Ga0395900_0364299 3300037418 Bacteria 1416
311 Ga0395900_0403638 3300037418 Unclassified 1330
312 Ga0395900_0421414 3300037418 Unclassified 1296
313 Ga0395900_0443598 3300037418 Bacteria 1255
314 Ga0395898_0012883 3300037466 Bacteria 8626
315 Ga0395898_0017618 3300037466 Bacteria 7292
316 Ga0395898_0031630 3300037466 Bacteria 5285
317 Ga0395898_0093584 3300037466 Bacteria 2888
318 Ga0395898_0292183 3300037466 Bacteria 1555
319 Ga0395898_0303175 3300037466 Unclassified 1524
320 Ga0395905_0005182 3300037471 Bacteria 13365
321 Ga0395905_0018508 3300037471 Bacteria 6612
322 Ga0395901_0012594 3300038443 Bacteria 8583
323 Ga0395901_0018054 3300038443 Bacteria 7200
324 Ga0395901_0030242 3300038443 Bacteria 5580
325 Ga0395901_0095090 3300038443 Bacteria 3122
326 Ga0395901_0157467 3300038443 Bacteria 2385
327 Ga0395901_0505107 3300038443 Bacteria 1230
328 Ga0436365_1264898 3300039437 Bacteria 3131
329 Ga0436363_1237697 3300039450 Bacteria 1359
330 Ga0451787_812475 3300041441 Bacteria 893
331 Ga0451789_0006679 3300041443 Bacteria 2613
332 Ga0451789_0403536 3300041443 Bacteria 838
333 Ga0451789_1073289 3300041443 Bacteria 644
334 Ga0451793_0144453 3300041452 Bacteria 4173
335 Ga0451795_0602478 3300041456 Bacteria 1456
336 Ga0451800_0844296 3300041459 Bacteria 2707
337 Ga0451802_0376730 3300041460 Bacteria 724
338 Ga0451807_1470074 3300041486 Bacteria 861
339 Ga0451839_1241726 3300041496 Bacteria 3763
340 Ga0451847_0739562 3300041503 Bacteria 1950
341 Ga0451849_1195338 3300041505 Bacteria 1150
342 Ga0451851_0629208 3300041507 Bacteria 878
343 Ga0451855_1067049 3300041511 Bacteria 3242
344 Ga0451853_2506285 3300041512 Bacteria 1316
345 Ga0466969_0039500 3300044656 Bacteria 2369
346 Ga0466969_0364457 3300044656 Bacteria 655
347 Ga0466972_0316602 3300044658 Unclassified 729
348 Ga0466965_0298327 3300044683 Bacteria 874
349 Ga0466966_0000736 3300044684 Bacteria 20837
350 Ga0466966_0154490 3300044684 Bacteria 1398
351 Ga0466966_0280392 3300044684 Bacteria 1002
352 Ga0466966_0330982 3300044684 Bacteria 915
353 Ga0466961_0009677 3300044693 Bacteria 6136
354 Ga0466961_0135140 3300044693 Bacteria 1545
355 Ga0466961_0171537 3300044693 Bacteria 1349
356 Ga0466961_0201446 3300044693 Bacteria 1231
357 Ga0466961_0274698 3300044693 Bacteria 1032
358 Ga0466963_0005180 3300044694 Bacteria 7611
359 Ga0466963_0059478 3300044694 Bacteria 2550
360 Ga0466963_0060913 3300044694 Bacteria 2521
361 Ga0466963_0074655 3300044694 Bacteria 2287
362 Ga0466963_0096747 3300044694 Bacteria 2016
363 Ga0466963_0120084 3300044694 Bacteria 1808
364 Ga0466963_0377046 3300044694 Bacteria 1000
365 Ga0466964_0004548 3300044706 Bacteria 5127
366 Ga0466964_0412285 3300044706 Bacteria 708
367 Ga0466971_0018753 3300044719 Bacteria 3067
368 Ga0466971_0022057 3300044719 Bacteria 2835
369 Ga0466968_0039253 3300044735 Bacteria 1992
370 Ga0466970_0043048 3300044765 Bacteria 2402
371 Ga0466970_0193687 3300044765 Bacteria 1130
372 Ga0466957_0012641 3300044842 Bacteria 4889
373 Ga0466957_0076146 3300044842 Bacteria 2083
374 Ga0466960_0350475 3300044901 Unclassified 842
375 Ga0466959_0029404 3300045049 Bacteria 4071
376 Ga0466959_0072820 3300045049 Bacteria 2486
377 Ga0466959_0086992 3300045049 Bacteria 2248
378 Ga0466959_0503548 3300045049 Unclassified 818
379 Ga0466958_0006945 3300045836 Bacteria 6193
380 Ga0466958_0210633 3300045836 Bacteria 1238
381 Ga0466967_0013039 3300045976 Bacteria 6397
382 Ga0466967_0018045 3300045976 Bacteria 5627
383 Ga0466967_0027110 3300045976 Bacteria 4761
384 Ga0466967_0070664 3300045976 Bacteria 3123
385 Ga0466967_0118862 3300045976 Bacteria 2439
386 Ga0466967_0144043 3300045976 Bacteria 2222
387 Ga0466967_0319305 3300045976 Bacteria 1497
388 Ga0466967_0328927 3300045976 Unclassified 1475
389 Ga0466967_0352603 3300045976 Bacteria 1424
390 Ga0466967_0484875 3300045976 Bacteria 1211
391 Ga0466967_1720761 3300045976 Unclassified 624
392 Ga0495592_0120195 3300046454 Bacteria 1849
393 Ga0495592_0147333 3300046454 Bacteria 1631
394 Ga0495629_0001451 3300046459 Bacteria 18698
395 Ga0495641_0000455 3300046461 Bacteria 34086
396 Ga0495641_0289960 3300046461 Bacteria 737
397 Ga0495651_0004556 3300046462 Bacteria 10594
398 Ga0495651_0087385 3300046462 Bacteria 2344
399 Ga0495653_0034754 3300046463 Bacteria 3982
400 Ga0495653_0215874 3300046463 Bacteria 1292
401 Ga0495580_0259828 3300046472 Bacteria 1188
402 Ga0495582_0000050 3300046473 Bacteria 59164
403 Ga0495582_0222922 3300046473 Bacteria 1079
404 Ga0495582_0368833 3300046473 Bacteria 827
405 Ga0495639_0001239 3300046475 Bacteria 11505
406 Ga0495662_0000824 3300046476 Bacteria 15070
407 Ga0495664_0019310 3300046477 Bacteria 3917
408 Ga0495664_0216876 3300046477 Bacteria 1159
409 Ga0495608_0004830 3300046511 Bacteria 9635
410 Ga0495608_0032318 3300046511 Bacteria 3537
411 Ga0495608_0156421 3300046511 Bacteria 1451
412 Ga0495618_0116500 3300046514 Bacteria 1711
413 Ga0495628_0316886 3300046516 Unclassified 1151
414 Ga0495630_0004424 3300046517 Bacteria 9859
415 Ga0495630_0086484 3300046517 Bacteria 2367
416 Ga0495630_0330682 3300046517 Bacteria 1165
417 Ga0495666_0051825 3300046526 Bacteria 1971
418 Ga0495666_0059648 3300046526 Bacteria 1825
419 Ga0495665_0001699 3300046531 Bacteria 11799
420 Ga0495640_0020546 3300046533 Bacteria 4858
421 Ga0495640_0092111 3300046533 Bacteria 1999
422 Ga0495640_0229419 3300046533 Bacteria 1168
423 Ga0495587_0031889 3300046536 Bacteria 3188
424 Ga0495645_0184070 3300046543 Bacteria 1428
425 Ga0495645_0242158 3300046543 Bacteria 1203
426 Ga0495667_0018641 3300046559 Bacteria 4686
427 Ga0495667_0030787 3300046559 Bacteria 3605
428 Ga0495667_0434281 3300046559 Bacteria 826
429 Ga0495634_0353530 3300046642 Unclassified 879
430 Ga0495635_0025414 3300046663 Bacteria 4125
431 Ga0495635_0059813 3300046663 Bacteria 2620
432 Ga0495635_0288609 3300046663 Bacteria 1101
433 Ga0495657_0032770 3300046675 Bacteria 3623
434 Ga0495657_0252051 3300046675 Bacteria 1062
435 Ga0495599_0207306 3300046678 Bacteria 1203
436 Ga0495623_0208905 3300046679 Bacteria 1118
437 Ga0495623_0423450 3300046679 Bacteria 713
438 Ga0495646_0122962 3300046680 Bacteria 1467
439 Ga0495646_0152139 3300046680 Bacteria 1286
440 Ga0495647_0035127 3300046681 Bacteria 1880
441 Ga0495658_0000020 3300046683 Bacteria 87200
442 Ga0495658_0076998 3300046683 Bacteria 1950
443 Ga0495613_0002778 3300046689 Bacteria 13142
444 Ga0495613_0073241 3300046689 Bacteria 2496
445 Ga0495613_0268259 3300046689 Bacteria 1188
446 Ga0495624_0344906 3300046690 Unclassified 896
447 Ga0495600_0216671 3300046809 Bacteria 1225
448 Ga0495581_0001354 3300047315 Bacteria 13552
449 Ga0495581_0351543 3300047315 Bacteria 860
450 Ga0495604_0046344 3300047317 Bacteria 3389
451 Ga0495674_0004130 3300047319 Bacteria 14020
452 Ga0495674_0027119 3300047319 Bacteria 5239
453 Ga0495674_0071783 3300047319 Bacteria 2987
454 Ga0495676_0000506 3300047321 Bacteria 31895
455 Ga0495680_0013214 3300047322 Bacteria 7213
456 Ga0495680_0068671 3300047322 Bacteria 2706
457 Ga0495680_0080107 3300047322 Bacteria 2468
458 Ga0495675_0149308 3300047444 Bacteria 1444
459 Ga0495684_0009491 3300047471 Bacteria 7505
460 Ga0495684_0019791 3300047471 Bacteria 5186
461 Ga0495684_0196588 3300047471 Bacteria 1488
462 Ga0495593_0028022 3300047673 Bacteria 3096
463 Ga0495602_0009681 3300048088 Bacteria 10013
464 Ga0495602_0317358 3300048088 Bacteria 1135
465 Ga0495614_0006253 3300048089 Bacteria 5351
466 Ga0496100_0010749 3300048903 Bacteria 5190
467 Ga0496100_0016633 3300048903 Bacteria 4324
468 Ga0496100_0017700 3300048903 Bacteria 4212
469 Ga0496100_0373036 3300048903 Bacteria 1082
470 Ga0496101_0001960 3300048904 Bacteria 12465
471 Ga0496101_0007236 3300048904 Bacteria 7181
472 Ga0496101_0009459 3300048904 Bacteria 6407
473 Ga0496101_0034833 3300048904 Bacteria 3559
474 Ga0496101_0094969 3300048904 Unclassified 2223
475 Ga0496102_0006741 3300048905 Bacteria 9806
476 Ga0496102_0046243 3300048905 Bacteria 3952
477 Ga0496102_0611789 3300048905 Bacteria 1013
478 Ga0496103_0040394 3300048906 Bacteria 2866
479 Ga0496104_0006783 3300048907 Bacteria 10085
480 Ga0496104_0237955 3300048907 Bacteria 1733
481 Ga0496104_0247649 3300048907 Bacteria 1695
482 Ga0496105_0010110 3300048908 Bacteria 7410
483 Ga0496105_0079447 3300048908 Bacteria 2709
484 Ga0496105_0114339 3300048908 Bacteria 2226
485 Ga0496106_0030495 3300048909 Bacteria 4020
486 Ga0496106_0055215 3300048909 Bacteria 3001
487 Ga0496106_0105516 3300048909 Bacteria 2189
488 Ga0496106_0695908 3300048909 Bacteria 810
489 Ga0496107_0001045 3300048910 Bacteria 16564
490 Ga0496107_0002865 3300048910 Bacteria 11403
491 Ga0496107_0019550 3300048910 Bacteria 4778
492 Ga0496107_0375037 3300048910 Bacteria 1058
493 Ga0496108_0107242 3300048911 Bacteria 2385
494 Ga0496109_0002312 3300048912 Bacteria 15869
495 Ga0496109_0381114 3300048912 Bacteria 1332
496 Ga0496110_0008212 3300048913 Bacteria 8391
497 Ga0496110_0081611 3300048913 Bacteria 2883
498 Ga0496110_0218776 3300048913 Bacteria 1732
499 Ga0496111_0153091 3300048914 Bacteria 1711
500 Ga0496111_0173924 3300048914 Bacteria 1600
501 Ga0496112_0222573 3300048915 Bacteria 1843
502 Ga0496112_0334046 3300048915 Bacteria 1459
503 Ga0496113_0037553 3300048916 Bacteria 3556
504 Ga0496113_0403823 3300048916 Bacteria 1097
505 Ga0496114_0002969 3300048917 Bacteria 12999
506 Ga0496114_0006733 3300048917 Bacteria 9054
507 Ga0496114_0049195 3300048917 Bacteria 3507
508 Ga0496114_0059297 3300048917 Bacteria 3197
509 Ga0496115_0000879 3300048918 Bacteria 21839
510 Ga0496115_0012115 3300048918 Bacteria 6483
511 Ga0496115_0127961 3300048918 Bacteria 2093
512 Ga0496115_0146066 3300048918 Bacteria 1952
513 Ga0501306_034631 3300049127 Unclassified 763
514 Ga0501309_056752 3300049129 Unclassified 624
515 Ga0501305_040266 3300049161 Unclassified 758
516 Ga0501311_032457 3300049527 Unclassified 762
517 Ga0501312_036195 3300049528 Unclassified 792
518 Ga0501315_036464 3300049531 Unclassified 729
519 Ga0501316_052399 3300049532 Unclassified 590
520 Ga0501317_023111 3300049533 Bacteria 856
521 Ga0501318_021268 3300049534 Bacteria 823
522 Ga0501320_032528 3300049536 Unclassified 655
523 Ga0501321_024488 3300049537 Unclassified 772
524 Ga0501323_050236 3300049539 Unclassified 631
525 Ga0501325_014217 3300049541 Unclassified 772
526 Ga0501034_0407571 3300049571 Bacteria 1282
527 Ga0501038_0750476 3300049574 Bacteria 728
528 Ga0501046_0359503 3300049580 Bacteria 1056
529 Ga0501046_0578206 3300049580 Bacteria 799
530 Ga0501047_0092670 3300049581 Bacteria 2900
531 Ga0501047_0126725 3300049581 Bacteria 2433
532 Ga0501047_0150116 3300049581 Bacteria 2207
533 Ga0501067_0015494 3300049583 Bacteria 4219
534 Ga0501067_0155340 3300049583 Bacteria 1275
535 Ga0501067_0227186 3300049583 Bacteria 1039
536 Ga0501067_0374519 3300049583 Bacteria 794
537 Ga0501069_0001978 3300049585 Bacteria 10248
538 Ga0501069_0173746 3300049585 Bacteria 1244
539 Ga0501070_0182303 3300049586 Bacteria 1728
540 Ga0501070_0326675 3300049586 Bacteria 1247
541 Ga0501070_0370900 3300049586 Bacteria 1160
542 Ga0501070_0662433 3300049586 Unclassified 828
543 Ga0501074_0129619 3300049590 Bacteria 1805
544 Ga0501080_0229331 3300049742 Bacteria 1698
545 Ga0501080_0234413 3300049742 Bacteria 1677
546 Ga0501080_0411077 3300049742 Bacteria 1217
547 Ga0501080_0943999 3300049742 Bacteria 750
548 nmdc:mga0rr50_751407_c1 3300050513 Unclassified 832
549 Ga0495601_0089903 3300053077 Bacteria 1975
550 Ga0495601_0173865 3300053077 Bacteria 1408
551 Ga0495619_0002661 3300053085 Bacteria 11686
552 Ga0495619_0022861 3300053085 Bacteria 4004
553 Ga0587080_042762 3300059503 Bacteria 831
554 Ga0587083_0051624 3300059505 Unclassified 898
555 Ga0587083_0076922 3300059505 Unclassified 787
556 Ga0587085_026639 3300059506 Bacteria 922
557 Ga0587088_097158 3300059508 Bacteria 653
558 Ga0587091_099515 3300059511 Unclassified 680
559 Ga0587092_091768 3300059512 Unclassified 614
560 Ga0587106_081892 3300059605 Viruses 630
561 Ga0587099_013650 3300059622 Unclassified 848
562 Ga0587067_028906 3300059640 Unclassified 1010
563 Ga0587076_028861 3300059645 Bacteria 970
564 Ga0587102_011500 3300059649 Unclassified 890
565 Ga0587107_068949 3300059652 Unclassified 641
566 Ga0587114_019514 3300059655 Unclassified 941
567 Ga0466962_0006058 3300061719 Bacteria 5815
568 Ga0466962_0257137 3300061719 Unclassified 859
569 Ga0501070_0000991
570 Ga0006778J45830_1029577
571 Ga0006778J45830_1034319
572 Ga0006778J45830_1052242
573 Ga0006778J45830_1097030
574 Ga0006759J45824_1007741
575 Ga0006759J45824_1031794
576 Ga0006758J48902_1004227
577 Ga0006758J48902_1012181
578 Ga0006770J48903_1004101
579 Ga0006770J48903_1016331
580 Ga0006777J48905_1001629
581 Ga0006777J48905_1015432
582 Ga0006777J48905_1025684
583 Ga0006777J48905_1050423
584 Ga0007417J51691_1003876
585 Ga0007427J51700_101109
586 Ga0007427J51700_113217
587 Ga0007427J51700_114076
588 Ga0006781J51513_1002549
589 Ga0007410J51695_1002390
590 Ga0007410J51695_1028448
591 Ga0007410J51695_1048764
592 Ga0007409J51694_1001971
593 Ga0007416J51690_1003315
594 Ga0007429J51699_1001658
595 Ga0007429J51699_1008540
596 Ga0007429J51699_1014966
597 Ga0007429J51699_1029933
598 Ga0007429J51699_1030025
599 Ga0007429J51699_1035861
600 Ga0007411J51799_102389
601 Ga0007411J51799_118237
602 Ga0007415J51800_103420
603 Ga0032354_1000249
604 Ga0032354_1013848
605 Ga0032354_1013911
606 Ga0006780_1000066
607 Ga0006780_1016240
608 Ga0006780_1030091
609 Ga0058863_10061302
610 Ga0058863_11896675
611 Ga0058861_12070719
612 Ga0058862_12794553
613 Ga0070658_10012635
614 Ga0070658_10085398
615 Ga0070683_100017112
616 Ga0070683_100058326
617 Ga0070683_100826328
618 Ga0070680_100008991
619 Ga0070680_100088061
620 Ga0070680_100201094
621 Ga0068868_100276191
622 Ga0068868_100450733
623 Ga0070660_100000669
624 Ga0070660_100006214
625 Ga0070660_100134758
626 Ga0070660_100257710
627 Ga0070661_100009291
628 Ga0070661_100019086
629 Ga0070661_100048421
630 Ga0070661_100062419
631 Ga0070671_100114839
632 Ga0070673_100635399
633 Ga0070673_100998585
634 Ga0070659_100017241
635 Ga0070659_100041676
636 Ga0070659_100134836
637 Ga0070667_100019456
638 Ga0070714_100048413
639 Ga0070714_100051613
640 Ga0070714_100358382
641 Ga0070714_100715250
642 Ga0070713_100187321
643 Ga0070713_100490589
644 Ga0070710_10080823
645 Ga0070710_10355271
646 Ga0070711_100013492
647 Ga0070711_100443185
648 Ga0070681_10000568
649 Ga0070681_10008427
650 Ga0070681_10017750
651 Ga0070681_10090434
652 Ga0070681_10122055
653 Ga0070681_10143787
654 Ga0070681_10209563
655 Ga0070681_10301274
656 Ga0070679_100007619
657 Ga0070679_100008920
658 Ga0070679_100012118
659 Ga0070679_100034446
660 Ga0070679_100044318
661 Ga0070679_100149585
662 Ga0070679_101287416
663 Ga0070684_100026078
664 Ga0070684_100048145
665 Ga0070684_100050326
666 Ga0070684_101219536
667 Ga0068853_100549621
668 Ga0068853_102048454
669 Ga0070696_100018518
670 Ga0070665_100032747
671 Ga0068855_100017802
672 Ga0068855_100042010
673 Ga0068855_100181059
674 Ga0068855_100341989
675 Ga0068855_100517114
676 Ga0068855_100722227
677 Ga0068857_100075197
678 Ga0068854_100397920
679 Ga0068854_100437262
680 Ga0068856_100032410
681 Ga0068856_100234696
682 Ga0068852_100141323
683 Ga0068852_100387077
684 Ga0068851_10706287
685 Ga0070717_10257655
686 Ga0070717_10306347
687 Ga0070715_10203634
688 Ga0070712_100168812
689 Ga0070712_100398504
690 Ga0068871_100884958
691 Ga0075434_100134811
692 Ga0105240_10203858
693 Ga0105240_10721569
694 Ga0105240_10737619
695 Ga0105240_11064258
696 Ga0105245_10097059
697 Ga0105245_10120375
698 Ga0105241_10483975
699 Ga0105241_10570474
700 Ga0105242_10089028
701 Ga0105242_10430893
702 Ga0105248_10254143
703 Ga0105237_10081046
704 Ga0105237_10090039
705 Ga0105237_10398429
706 Ga0105238_10086287
707 Ga0105238_10169779
708 Ga0105238_11438205
709 Ga0105239_10507853
710 Ga0105239_11096794
711 Ga0157373_10037397
712 Ga0157371_10649608
713 Ga0157370_10016206
714 Ga0157370_10098804
715 Ga0157370_10206782
716 Ga0157369_10041287
717 Ga0157369_10085896
718 Ga0157369_10167279
719 Ga0157369_10176253
720 Ga0157369_10890472
721 Ga0157374_10075537
722 Ga0157374_10234721
723 Ga0157374_11209100
724 Ga0157378_10078241
725 Ga0157372_10093584
726 Ga0157372_10110133
727 Ga0157372_10668745
728 Ga0157375_10580281
729 Ga0182008_10031519
730 Ga0157376_10319387
731 Ga0157376_10836966
732 Ga0197907_10124457
733 Ga0197907_10822869
734 Ga0197907_11137880
735 Ga0206356_10239123
736 Ga0206356_10614535
737 Ga0206356_10751319
738 Ga0206349_1353523
739 Ga0206355_1019154
740 Ga0206355_1019366
741 Ga0206355_1044427
742 Ga0206355_1171402
743 Ga0206355_1217979
744 Ga0206355_1489429
745 Ga0206355_1532293
746 Ga0206351_10201544
747 Ga0206351_10318354
748 Ga0206352_11047535
749 Ga0206350_10173317
750 Ga0206350_10319200
751 Ga0206350_10323542
752 Ga0206350_10752437
753 Ga0206354_10019764
754 Ga0206354_10542128
755 Ga0206354_11044154
756 Ga0206354_11273910
757 Ga0206353_10925129
758 Ga0206353_11348053
759 Ga0206353_11777701
760 Ga0206353_11829303
761 Ga0154015_1151559
762 Ga0154015_1283574
763 Ga0154015_1399456
764 Ga0154015_1447705
765 Ga0154015_1527896
766 Ga0154015_1649564
767 Ga0224712_10074943
768 Ga0224712_10082596
769 Ga0224712_10170665
770 Ga0224712_10207236
771 Ga0224712_10241705
772 Ga0207692_10052980
773 Ga0207685_10162919
774 Ga0207705_10053778
775 Ga0207705_10185079
776 Ga0207654_10215700
777 Ga0207654_10746283
778 Ga0207707_10002704
779 Ga0207707_10008393
780 Ga0207707_10025149
781 Ga0207707_10082830
782 Ga0207707_10099569
783 Ga0207707_10346393
784 Ga0207707_10703503
785 Ga0207695_10488328
786 Ga0207695_11041890
787 Ga0207671_10096614
788 Ga0207671_10246604
789 Ga0207693_10109622
790 Ga0207663_10045440
791 Ga0207663_10209691
792 Ga0207660_10003652
793 Ga0207660_10285124
794 Ga0207657_10005956
795 Ga0207657_10008575
796 Ga0207657_10065625
797 Ga0207657_10073176
798 Ga0207657_10097983
799 Ga0207649_10018306
800 Ga0207649_10725034
801 Ga0207649_11057025
802 Ga0207652_10112887
803 Ga0207652_10194257
804 Ga0207652_10988169
805 Ga0207694_10059442
806 Ga0207694_10416170
807 Ga0207664_10158727
808 Ga0207664_10291284
809 Ga0207664_10426499
810 Ga0207664_10866683
811 Ga0207644_10811292
812 Ga0207690_10011284
813 Ga0207690_10079925
814 Ga0207690_10501522
815 Ga0207686_10170266
816 Ga0207665_10242219
817 Ga0207661_10042594
818 Ga0207661_10148079
819 Ga0207667_10024384
820 Ga0207667_10130447
821 Ga0207667_10259301
822 Ga0207667_10517724
823 Ga0207640_10535370
824 Ga0207640_10678911
825 Ga0207640_11365347
826 Ga0207658_10013186
827 Ga0207703_10404734
828 Ga0207678_10104109
829 Ga0207702_10063825
830 Ga0207702_10683921
831 Ga0207674_10042327
832 Ga0207674_10900537
833 Ga0207683_10367620
834 Ga0207698_10145791
835 Ga0268266_10101339
836 Ga0265334_10004790
837 Ga0265318_10058998
838 Ga0265322_10102665
839 Ga0265338_10004366
840 Ga0265338_10147961
841 Ga0265330_10331264
842 Ga0265332_10270922
843 Ga0265320_10092478
844 Ga0265320_10147164
845 Ga0265325_10088280
846 Ga0265340_10065329
847 Ga0265340_10106459
848 Ga0265327_10081435
849 Ga0265316_10097072
850 Ga0265313_10003308
851 Ga0265313_10158773
852 Ga0265314_10308790
853 Ga0265342_10070669
854 Ga0265342_10421742
855 Ga0307415_100129866
856 Ga0373936_0143072
857 Ga0373945_0028470
858 Ga0373945_0088641
859 Ga0373956_0111573
860 Ga0373943_0004315
861 Ga0373943_0064718
862 Ga0373946_0026197
863 Ga0373946_0045808
864 Ga0373955_0185191
865 Ga0373935_0035145
866 Ga0373947_0001819
867 Ga0373947_0051929
868 Ga0373937_0098663
869 Ga0373925_0001681
870 Ga0373925_0369679
871 Ga0395899_0180380
872 Ga0395899_0351841
873 Ga0395899_0364906
874 Ga0395900_0035739
875 Ga0395900_0074239
876 Ga0395900_0094345
877 Ga0395900_0196029
878 Ga0395900_0364299
879 Ga0395900_0403638
880 Ga0395900_0421414
881 Ga0395900_0443598
882 Ga0395898_0012883
883 Ga0395898_0017618
884 Ga0395898_0031630
885 Ga0395898_0093584
886 Ga0395898_0292183
887 Ga0395898_0303175
888 Ga0395905_0005182
889 Ga0395905_0018508
890 Ga0395901_0012594
891 Ga0395901_0018054
892 Ga0395901_0030242
893 Ga0395901_0095090
894 Ga0395901_0157467
895 Ga0395901_0505107
896 Ga0436365_1264898
897 Ga0436363_1237697
898 Ga0451787_812475
899 Ga0451789_0006679
900 Ga0451789_0403536
901 Ga0451789_1073289
902 Ga0451793_0144453
903 Ga0451795_0602478
904 Ga0451800_0844296
905 Ga0451802_0376730
906 Ga0451807_1470074
907 Ga0451839_1241726
908 Ga0451847_0739562
909 Ga0451849_1195338
910 Ga0451851_0629208
911 Ga0451855_1067049
912 Ga0451853_2506285
913 Ga0466969_0039500
914 Ga0466969_0364457
915 Ga0466972_0316602
916 Ga0466965_0298327
917 Ga0466966_0000736
918 Ga0466966_0154490
919 Ga0466966_0280392
920 Ga0466966_0330982
921 Ga0466961_0009677
922 Ga0466961_0135140
923 Ga0466961_0171537
924 Ga0466961_0201446
925 Ga0466961_0274698
926 Ga0466963_0005180
927 Ga0466963_0059478
928 Ga0466963_0060913
929 Ga0466963_0074655
930 Ga0466963_0096747
931 Ga0466963_0120084
932 Ga0466963_0377046
933 Ga0466964_0004548
934 Ga0466964_0412285
935 Ga0466971_0018753
936 Ga0466971_0022057
937 Ga0466968_0039253
938 Ga0466970_0043048
939 Ga0466970_0193687
940 Ga0466957_0012641
941 Ga0466957_0076146
942 Ga0466960_0350475
943 Ga0466959_0029404
944 Ga0466959_0072820
945 Ga0466959_0086992
946 Ga0466959_0503548
947 Ga0466958_0006945
948 Ga0466958_0210633
949 Ga0466967_0013039
950 Ga0466967_0018045
951 Ga0466967_0027110
952 Ga0466967_0070664
953 Ga0466967_0118862
954 Ga0466967_0144043
955 Ga0466967_0319305
956 Ga0466967_0328927
957 Ga0466967_0352603
958 Ga0466967_0484875
959 Ga0466967_1720761
960 Ga0495592_0120195
961 Ga0495592_0147333
962 Ga0495629_0001451
963 Ga0495641_0000455
964 Ga0495641_0289960
965 Ga0495651_0004556
966 Ga0495651_0087385
967 Ga0495653_0034754
968 Ga0495653_0215874
969 Ga0495580_0259828
970 Ga0495582_0000050
971 Ga0495582_0222922
972 Ga0495582_0368833
973 Ga0495639_0001239
974 Ga0495662_0000824
975 Ga0495664_0019310
976 Ga0495664_0216876
977 Ga0495608_0004830
978 Ga0495608_0032318
979 Ga0495608_0156421
980 Ga0495618_0116500
981 Ga0495628_0316886
982 Ga0495630_0004424
983 Ga0495630_0086484
984 Ga0495630_0330682
985 Ga0495666_0051825
986 Ga0495666_0059648
987 Ga0495665_0001699
988 Ga0495640_0020546
989 Ga0495640_0092111
990 Ga0495640_0229419
991 Ga0495587_0031889
992 Ga0495645_0184070
993 Ga0495645_0242158
994 Ga0495667_0018641
995 Ga0495667_0030787
996 Ga0495667_0434281
997 Ga0495634_0353530
998 Ga0495635_0025414
999 Ga0495635_0059813
1000 Ga0495635_0288609
1001 Ga0495657_0032770
1002 Ga0495657_0252051
1003 Ga0495599_0207306
1004 Ga0495623_0208905
1005 Ga0495623_0423450
1006 Ga0495646_0122962
1007 Ga0495646_0152139
1008 Ga0495647_0035127
1009 Ga0495658_0000020
1010 Ga0495658_0076998
1011 Ga0495613_0002778
1012 Ga0495613_0073241
1013 Ga0495613_0268259
1014 Ga0495624_0344906
1015 Ga0495600_0216671
1016 Ga0495581_0001354
1017 Ga0495581_0351543
1018 Ga0495604_0046344
1019 Ga0495674_0004130
1020 Ga0495674_0027119
1021 Ga0495674_0071783
1022 Ga0495676_0000506
1023 Ga0495680_0013214
1024 Ga0495680_0068671
1025 Ga0495680_0080107
1026 Ga0495675_0149308
1027 Ga0495684_0009491
1028 Ga0495684_0019791
1029 Ga0495684_0196588
1030 Ga0495593_0028022
1031 Ga0495602_0009681
1032 Ga0495602_0317358
1033 Ga0495614_0006253
1034 Ga0496100_0010749
1035 Ga0496100_0016633
1036 Ga0496100_0017700
1037 Ga0496100_0373036
1038 Ga0496101_0001960
1039 Ga0496101_0007236
1040 Ga0496101_0009459
1041 Ga0496101_0034833
1042 Ga0496101_0094969
1043 Ga0496102_0006741
1044 Ga0496102_0046243
1045 Ga0496102_0611789
1046 Ga0496103_0040394
1047 Ga0496104_0006783
1048 Ga0496104_0237955
1049 Ga0496104_0247649
1050 Ga0496105_0010110
1051 Ga0496105_0079447
1052 Ga0496105_0114339
1053 Ga0496106_0030495
1054 Ga0496106_0055215
1055 Ga0496106_0105516
1056 Ga0496106_0695908
1057 Ga0496107_0001045
1058 Ga0496107_0002865
1059 Ga0496107_0019550
1060 Ga0496107_0375037
1061 Ga0496108_0107242
1062 Ga0496109_0002312
1063 Ga0496109_0381114
1064 Ga0496110_0008212
1065 Ga0496110_0081611
1066 Ga0496110_0218776
1067 Ga0496111_0153091
1068 Ga0496111_0173924
1069 Ga0496112_0222573
1070 Ga0496112_0334046
1071 Ga0496113_0037553
1072 Ga0496113_0403823
1073 Ga0496114_0002969
1074 Ga0496114_0006733
1075 Ga0496114_0049195
1076 Ga0496114_0059297
1077 Ga0496115_0000879
1078 Ga0496115_0012115
1079 Ga0496115_0127961
1080 Ga0496115_0146066
1081 Ga0501306_034631
1082 Ga0501309_056752
1083 Ga0501305_040266
1084 Ga0501311_032457
1085 Ga0501312_036195
1086 Ga0501315_036464
1087 Ga0501316_052399
1088 Ga0501317_023111
1089 Ga0501318_021268
1090 Ga0501320_032528
1091 Ga0501321_024488
1092 Ga0501323_050236
1093 Ga0501325_014217
1094 Ga0501034_0407571
1095 Ga0501038_0750476
1096 Ga0501046_0359503
1097 Ga0501046_0578206
1098 Ga0501047_0092670
1099 Ga0501047_0126725
1100 Ga0501047_0150116
1101 Ga0501067_0015494
1102 Ga0501067_0155340
1103 Ga0501067_0227186
1104 Ga0501067_0374519
1105 Ga0501069_0001978
1106 Ga0501069_0173746
1107 Ga0501070_0182303
1108 Ga0501070_0326675
1109 Ga0501070_0370900
1110 Ga0501070_0662433
1111 Ga0501074_0129619
1112 Ga0501080_0229331
1113 Ga0501080_0234413
1114 Ga0501080_0411077
1115 Ga0501080_0943999
1116 nmdc:mga0rr50_751407_c1
1117 Ga0495601_0089903
1118 Ga0495601_0173865
1119 Ga0495619_0002661
1120 Ga0495619_0022861
1121 Ga0587080_042762
1122 Ga0587083_0051624
1123 Ga0587083_0076922
1124 Ga0587085_026639
1125 Ga0587088_097158
1126 Ga0587091_099515
1127 Ga0587092_091768
1128 Ga0587106_081892
1129 Ga0587099_013650
1130 Ga0587067_028906
1131 Ga0587076_028861
1132 Ga0587102_011500
1133 Ga0587107_068949
1134 Ga0587114_019514
1135 Ga0466962_0006058
1136 Ga0466962_0257137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

39

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9137 15 176
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8871 14 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8838 14 177
3hpe-assembly1.cif.gz_B crystal structure of ycei (hp1286) from helicobacter pylori 0.8665 15 176
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8589 14 177
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9153 18 173 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9137 15 176 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8947 14 177 2.40.128.110
3hpeB00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8665 15 176 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8643 14 177 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7V8XES3-F1-model_v4 YceI family protein 0.9837 62 176
AF-A0A7Y6CTS2-F1-model_v4 YceI family protein 0.9778 1 177
AF-A0A1Q7UH52-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9764 6 177
AF-A0A7V9P4G3-F1-model_v4 YceI family protein 0.9724 1 176
AF-A0A6I2VFF5-F1-model_v4 Polyisoprenoid-binding protein 0.9707 84 176

Map