F464636

General Info

Members Datasets Scaffolds Average Seq Length
568 284 548 316

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10038436|Ga0207688_100384362
Length 360
Sequence MDDYLVGVLSNIGVVSFIALSAYLLLLTGEISFGQQAFFAIGAYAAGIATALWGWQLSHAQAYPAKPIRYIVPVAAGGGNDMIARVVTERWGRLIGQQFVVENQSGGGGVIACQTTARSAPDGYTLMQGYVATHGTTPATRNVSYDAVKDFTPIGMIGGTPNVLVVNSALPVKTLADFIDYARKNPGKINYGSAGPGSLTHLTMELFKQEIGAFMLHIPYRGIAPAFTDLLGGQTQAMFPGLAAALPHLRSGRARALAVTGRLRSDQLKDVPTLEEAGFKGFDAMQWYGSVGPAGMSADVVKRLNETQVAVLKDPELRERLAVEAVEPMPMSPEQFGQYIRDDIQRWTVLAKARKIQLDG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2738543013 Variovorax sp. BT01 Isolate Unclassified
8 2831864461 Roseateles noduli HZ7 Isolate Nodule
9 2842733646 Variovorax sp. R-72446 Isolate Unclassified
10 2855730933 Achromobacter sp. HZ28 Isolate Nodule
11 2855767633 Achromobacter sp. HZ34 Isolate Nodule
12 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
13 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
14 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
15 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
16 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
17 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
18 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
255 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
259 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
260 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
261 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
264 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
265 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
269 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
270 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
271 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
272 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
273 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
281 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
284 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 0
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.03
Nodule 0.53
Rhizoplane 5.11
Rhizosphere 74.3
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000744 3300003187 Bacteria 26653
2 JGI25153J46596_10001547 3300003215 Bacteria 13664
3 Ga0055530_10006422 3300003791 Bacteria 5259
4 Ga0055543_1003908 3300004625 Bacteria 4214
5 Ga0065165_1000070 3300005262 Bacteria 168230
6 Ga0065714_10108763 3300005288 Bacteria 1510
7 Ga0065712_10139313 3300005290 Bacteria 1465
8 Ga0070676_10001100 3300005328 Bacteria 13511
9 Ga0070676_10028439 3300005328 Bacteria 3175
10 Ga0070676_10148311 3300005328 Bacteria 1499
11 Ga0070683_100249374 3300005329 Bacteria 1689
12 Ga0070690_100010503 3300005330 Bacteria 5392
13 Ga0070690_100024190 3300005330 Bacteria 3734
14 Ga0070670_100005394 3300005331 Bacteria 10793
15 Ga0070670_100017564 3300005331 Bacteria 6138
16 Ga0070670_100189194 3300005331 Bacteria 1788
17 Ga0070677_10001133 3300005333 Bacteria 8587
18 Ga0070677_10008202 3300005333 Bacteria 3509
19 Ga0070677_10011658 3300005333 Bacteria 3037
20 Ga0068869_100007139 3300005334 Bacteria 7118
21 Ga0068869_100008622 3300005334 Bacteria 6583
22 Ga0070666_10002696 3300005335 Bacteria 10713
23 Ga0070666_10040956 3300005335 Bacteria 3094
24 Ga0070680_100011705 3300005336 Bacteria 6798
25 Ga0068868_100017855 3300005338 Bacteria 5293
26 Ga0068868_100036397 3300005338 Bacteria 3810
27 Ga0070660_100008436 3300005339 Bacteria 7204
28 Ga0070660_100224418 3300005339 Bacteria 1527
29 Ga0070687_100019087 3300005343 Bacteria 3185
30 Ga0070661_100134284 3300005344 Bacteria 1861
31 Ga0070668_100009623 3300005347 Bacteria 7171
32 Ga0070669_100005697 3300005353 Bacteria 8984
33 Ga0070669_100031641 3300005353 Bacteria 3822
34 Ga0070675_100000052 3300005354 Bacteria 71092
35 Ga0070675_100004610 3300005354 Bacteria 10523
36 Ga0070675_100007049 3300005354 Bacteria 8644
37 Ga0070675_100007219 3300005354 Bacteria 8564
38 Ga0070675_100127137 3300005354 Bacteria 2169
39 Ga0070675_100151866 3300005354 Bacteria 1986
40 Ga0070671_100002160 3300005355 Bacteria 15168
41 Ga0070671_100004178 3300005355 Bacteria 11417
42 Ga0070671_100009192 3300005355 Bacteria 7936
43 Ga0070671_100099197 3300005355 Bacteria 2443
44 Ga0070671_100150253 3300005355 Bacteria 1967
45 Ga0070671_100178409 3300005355 Bacteria 1798
46 Ga0070671_100232551 3300005355 Bacteria 1564
47 Ga0070674_100002594 3300005356 Bacteria 10004
48 Ga0070674_100109765 3300005356 Bacteria 2023
49 Ga0070673_100001378 3300005364 Bacteria 14199
50 Ga0070673_100002903 3300005364 Bacteria 10556
51 Ga0070673_100050820 3300005364 Bacteria 3243
52 Ga0070673_100128665 3300005364 Bacteria 2122
53 Ga0070688_100095018 3300005365 Bacteria 1955
54 Ga0070667_100003367 3300005367 Bacteria 13647
55 Ga0070667_100008684 3300005367 Bacteria 8420
56 Ga0070667_100019766 3300005367 Bacteria 5588
57 Ga0070667_100150437 3300005367 Bacteria 2045
58 Ga0070667_100162888 3300005367 Bacteria 1965
59 Ga0070700_100019974 3300005441 Bacteria 3874
60 Ga0070708_100507906 3300005445 Unclassified 1137
61 Ga0070663_100062855 3300005455 Bacteria 2678
62 Ga0070678_100001959 3300005456 Bacteria 11116
63 Ga0070678_100014203 3300005456 Bacteria 5016
64 Ga0070678_100023602 3300005456 Bacteria 4101
65 Ga0070678_100093749 3300005456 Bacteria 2310
66 Ga0070678_100300660 3300005456 Bacteria 1363
67 Ga0070678_100323485 3300005456 Bacteria 1318
68 Ga0070662_100001879 3300005457 Bacteria 12870
69 Ga0070662_100226577 3300005457 Bacteria 1494
70 Ga0070681_10002957 3300005458 Bacteria 15770
71 Ga0070681_10230677 3300005458 Bacteria 1766
72 Ga0068867_100008289 3300005459 Bacteria 7334
73 Ga0068867_100047149 3300005459 Bacteria 3167
74 Ga0068867_100072743 3300005459 Bacteria 2574
75 Ga0068867_100113534 3300005459 Bacteria 2084
76 Ga0070685_10082185 3300005466 Bacteria 1933
77 Ga0070679_100084851 3300005530 Bacteria 3154
78 Ga0070684_100086430 3300005535 Bacteria 2783
79 Ga0068853_100340886 3300005539 Bacteria 1393
80 Ga0070672_100001669 3300005543 Bacteria 13824
81 Ga0070672_100002067 3300005543 Bacteria 12636
82 Ga0070672_100003805 3300005543 Bacteria 9826
83 Ga0070672_100014317 3300005543 Bacteria 5620
84 Ga0070672_100069623 3300005543 Bacteria 2794
85 Ga0070672_100122405 3300005543 Bacteria 2131
86 Ga0070672_100129652 3300005543 Bacteria 2072
87 Ga0070672_100147165 3300005543 Bacteria 1947
88 Ga0070672_100216648 3300005543 Bacteria 1605
89 Ga0070693_100140778 3300005547 Bacteria 1518
90 Ga0070665_100085386 3300005548 Bacteria 3162
91 Ga0068855_100030776 3300005563 Bacteria 6417
92 Ga0070664_100029143 3300005564 Bacteria 4600
93 Ga0070664_100239913 3300005564 Bacteria 1627
94 Ga0070664_100292148 3300005564 Bacteria 1472
95 Ga0070664_100370049 3300005564 Bacteria 1306
96 Ga0068857_100034210 3300005577 Bacteria 4495
97 Ga0068854_100016120 3300005578 Bacteria 4971
98 Ga0068852_100007695 3300005616 Bacteria 7879
99 Ga0068852_100032837 3300005616 Bacteria 4302
100 Ga0068852_100059698 3300005616 Bacteria 3308
101 Ga0068852_100117712 3300005616 Bacteria 2427
102 Ga0068852_100229343 3300005616 Bacteria 1770
103 Ga0068859_100003350 3300005617 Bacteria 16303
104 Ga0068859_100050225 3300005617 Bacteria 4190
105 Ga0068859_100105470 3300005617 Bacteria 2878
106 Ga0068859_100148497 3300005617 Bacteria 2419
107 Ga0068864_100001554 3300005618 Bacteria 18908
108 Ga0068864_100017092 3300005618 Bacteria 6048
109 Ga0068864_100058425 3300005618 Bacteria 3333
110 Ga0068864_100115767 3300005618 Bacteria 2391
111 Ga0068866_10003255 3300005718 Bacteria 6690
112 Ga0068866_10030347 3300005718 Bacteria 2594
113 Ga0068861_100002753 3300005719 Bacteria 11528
114 Ga0068861_100006744 3300005719 Bacteria 7846
115 Ga0068861_100191067 3300005719 Bacteria 1712
116 Ga0068861_100456696 3300005719 Bacteria 1146
117 Ga0068851_10005859 3300005834 Bacteria 5596
118 Ga0068851_10015300 3300005834 Bacteria 3654
119 Ga0068870_10043939 3300005840 Bacteria 2332
120 Ga0068863_100003466 3300005841 Bacteria 15562
121 Ga0068863_100022688 3300005841 Bacteria 5994
122 Ga0068863_100049857 3300005841 Bacteria 3970
123 Ga0068863_100051894 3300005841 Bacteria 3887
124 Ga0068863_100119647 3300005841 Bacteria 2510
125 Ga0068863_100336395 3300005841 Bacteria 1468
126 Ga0068858_100000312 3300005842 Bacteria 51731
127 Ga0068858_100004094 3300005842 Bacteria 14366
128 Ga0068858_100232829 3300005842 Bacteria 1746
129 Ga0068860_100005109 3300005843 Bacteria 13347
130 Ga0068860_100052432 3300005843 Bacteria 3880
131 Ga0068860_100078220 3300005843 Bacteria 3146
132 Ga0068860_100146699 3300005843 Bacteria 2270
133 Ga0068862_100163476 3300005844 Bacteria 1988
134 Ga0081455_10000315 3300005937 Bacteria 63290
135 Ga0081455_10326388 3300005937 Unclassified 1091
136 Ga0075365_10080650 3300006038 Bacteria 2203
137 Ga0075364_10010318 3300006051 Bacteria 5638
138 Ga0075362_10008110 3300006177 Bacteria 4006
139 Ga0075366_10001959 3300006195 Bacteria 10418
140 Ga0075366_10006197 3300006195 Bacteria 6528
141 Ga0075366_10054714 3300006195 Bacteria 2370
142 Ga0097621_100008733 3300006237 Bacteria 7320
143 Ga0097621_100019133 3300006237 Bacteria 5249
144 Ga0097621_100021399 3300006237 Bacteria 5002
145 Ga0097621_100034586 3300006237 Bacteria 4032
146 Ga0097621_100475561 3300006237 Bacteria 1129
147 Ga0075370_10010052 3300006353 Bacteria 4936
148 Ga0075370_10081549 3300006353 Bacteria 1860
149 Ga0068871_100009035 3300006358 Bacteria 7197
150 Ga0068871_100018365 3300006358 Bacteria 5313
151 Ga0068871_100033503 3300006358 Bacteria 4068
152 Ga0068871_100085884 3300006358 Bacteria 2614
153 Ga0068871_100103369 3300006358 Bacteria 2389
154 Ga0075434_100309121 3300006871 Bacteria 1601
155 Ga0068865_100005211 3300006881 Bacteria 7861
156 Ga0068865_100145248 3300006881 Bacteria 1793
157 Ga0097620_100003350 3300006931 Bacteria 16303
158 Ga0097620_100050225 3300006931 Bacteria 4190
159 Ga0097620_100105471 3300006931 Bacteria 2878
160 Ga0097620_100148496 3300006931 Bacteria 2419
161 Ga0105247_10072160 3300009101 Bacteria 2161
162 Ga0105243_10001253 3300009148 Bacteria 22813
163 Ga0105243_10142115 3300009148 Bacteria 2049
164 Ga0105248_10001312 3300009177 Bacteria 27697
165 Ga0105248_10027348 3300009177 Bacteria 6349
166 Ga0105248_10030539 3300009177 Bacteria 6018
167 Ga0105248_10032838 3300009177 Bacteria 5799
168 Ga0105248_10156414 3300009177 Bacteria 2572
169 Ga0105237_10044555 3300009545 Bacteria 4468
170 Ga0105238_10405521 3300009551 Bacteria 1357
171 Ga0105249_10027766 3300009553 Bacteria 5107
172 Ga0105249_10113456 3300009553 Bacteria 2564
173 Ga0105249_10218057 3300009553 Bacteria 1876
174 Ga0105249_10253417 3300009553 Bacteria 1746
175 Ga0105249_10360728 3300009553 Bacteria 1475
176 Ga0105249_10432899 3300009553 Bacteria 1351
177 Ga0157373_10013249 3300013100 Bacteria 6053
178 Ga0157374_10059809 3300013296 Bacteria 3564
179 Ga0157374_10064321 3300013296 Bacteria 3442
180 Ga0157378_10128940 3300013297 Bacteria 2339
181 Ga0163162_10006102 3300013306 Bacteria 11667
182 Ga0163162_10007108 3300013306 Bacteria 10861
183 Ga0163162_10062486 3300013306 Bacteria 3764
184 Ga0163162_10075932 3300013306 Bacteria 3421
185 Ga0163162_10123729 3300013306 Bacteria 2692
186 Ga0163162_10172528 3300013306 Bacteria 2287
187 Ga0163162_10388776 3300013306 Bacteria 1528
188 Ga0163162_10452391 3300013306 Bacteria 1416
189 Ga0157372_10037621 3300013307 Bacteria 5339
190 Ga0157375_10015559 3300013308 Bacteria 6814
191 Ga0157375_10098773 3300013308 Bacteria 2997
192 Ga0157375_10128421 3300013308 Bacteria 2653
193 Ga0157375_10156756 3300013308 Bacteria 2416
194 Ga0157375_10158241 3300013308 Bacteria 2406
195 Ga0163163_10001116 3300014325 Bacteria 22834
196 Ga0163163_10383571 3300014325 Bacteria 1463
197 Ga0157380_10059099 3300014326 Bacteria 3058
198 Ga0157380_10153291 3300014326 Bacteria 1995
199 Ga0157377_10002466 3300014745 Bacteria 8189
200 Ga0157379_10001049 3300014968 Bacteria 22458
201 Ga0157379_10010284 3300014968 Bacteria 8147
202 Ga0157379_10016380 3300014968 Bacteria 6520
203 Ga0157379_10022517 3300014968 Bacteria 5581
204 Ga0157379_10025743 3300014968 Bacteria 5230
205 Ga0157376_10027453 3300014969 Bacteria 4512
206 Ga0157376_10225779 3300014969 Bacteria 1737
207 Ga0157376_10468482 3300014969 Bacteria 1232
208 Ga0163161_10006928 3300017792 Bacteria 7838
209 Ga0163161_10074296 3300017792 Bacteria 2493
210 Ga0163161_10138744 3300017792 Bacteria 1840
211 Ga0213876_10017580 3300021384 Bacteria 3774
212 Ga0213876_10095183 3300021384 Bacteria 1578
213 Ga0209675_1003637 3300025291 Bacteria 7230
214 Ga0209676_1029548 3300025292 Bacteria 1691
215 Ga0209025_1000019 3300025294 Bacteria 631548
216 Ga0209025_1000029 3300025294 Bacteria 488571
217 Ga0209758_1000268 3300025297 Bacteria 103231
218 Ga0209050_1002737 3300025298 Bacteria 14217
219 Ga0209257_1029423 3300025304 Bacteria 1790
220 Ga0207697_10030149 3300025315 Bacteria 2220
221 Ga0207682_10003776 3300025893 Bacteria 6502
222 Ga0207682_10005689 3300025893 Bacteria 5058
223 Ga0207682_10013152 3300025893 Bacteria 3227
224 Ga0207682_10014181 3300025893 Bacteria 3106
225 Ga0207682_10026651 3300025893 Bacteria 2299
226 Ga0207642_10002603 3300025899 Bacteria 5619
227 Ga0207688_10038436 3300025901 Bacteria 2656
228 Ga0207680_10007400 3300025903 Bacteria 5348
229 Ga0207680_10030035 3300025903 Bacteria 3060
230 Ga0207680_10083952 3300025903 Bacteria 2008
231 Ga0207680_10149642 3300025903 Bacteria 1555
232 Ga0207645_10002674 3300025907 Bacteria 13885
233 Ga0207645_10003737 3300025907 Bacteria 11446
234 Ga0207645_10019302 3300025907 Bacteria 4470
235 Ga0207645_10032065 3300025907 Bacteria 3378
236 Ga0207643_10172821 3300025908 Bacteria 1305
237 Ga0207707_10009961 3300025912 Bacteria 8241
238 Ga0207660_10013763 3300025917 Bacteria 5309
239 Ga0207660_10137283 3300025917 Unclassified 1867
240 Ga0207649_10002899 3300025920 Bacteria 9437
241 Ga0207649_10023906 3300025920 Bacteria 3545
242 Ga0207649_10208916 3300025920 Bacteria 1384
243 Ga0207652_10282898 3300025921 Bacteria 1496
244 Ga0207681_10000340 3300025923 Bacteria 33613
245 Ga0207681_10004540 3300025923 Bacteria 8548
246 Ga0207681_10006022 3300025923 Bacteria 7439
247 Ga0207681_10205214 3300025923 Bacteria 1515
248 Ga0207694_10030870 3300025924 Bacteria 4092
249 Ga0207650_10000607 3300025925 Bacteria 28697
250 Ga0207650_10070045 3300025925 Bacteria 2635
251 Ga0207650_10138658 3300025925 Bacteria 1910
252 Ga0207650_10355201 3300025925 Bacteria 1206
253 Ga0207659_10001135 3300025926 Bacteria 15806
254 Ga0207659_10004405 3300025926 Bacteria 8510
255 Ga0207659_10010197 3300025926 Bacteria 5891
256 Ga0207659_10020280 3300025926 Bacteria 4392
257 Ga0207659_10047166 3300025926 Bacteria 3047
258 Ga0207659_10078383 3300025926 Bacteria 2434
259 Ga0207659_10226018 3300025926 Bacteria 1507
260 Ga0207659_10337391 3300025926 Bacteria 1247
261 Ga0207644_10000068 3300025931 Bacteria 76090
262 Ga0207644_10006212 3300025931 Bacteria 7789
263 Ga0207644_10011943 3300025931 Bacteria 5759
264 Ga0207644_10015138 3300025931 Bacteria 5174
265 Ga0207644_10081292 3300025931 Bacteria 2394
266 Ga0207644_10132774 3300025931 Bacteria 1908
267 Ga0207644_10223476 3300025931 Bacteria 1494
268 Ga0207706_10001650 3300025933 Bacteria 22092
269 Ga0207706_10110606 3300025933 Bacteria 2417
270 Ga0207686_10048515 3300025934 Bacteria 2631
271 Ga0207709_10016368 3300025935 Bacteria 4122
272 Ga0207709_10096362 3300025935 Bacteria 1946
273 Ga0207669_10007987 3300025937 Bacteria 4939
274 Ga0207669_10024078 3300025937 Bacteria 3266
275 Ga0207704_10009638 3300025938 Bacteria 4670
276 Ga0207704_10013736 3300025938 Bacteria 4065
277 Ga0207704_10023154 3300025938 Bacteria 3342
278 Ga0207691_10006845 3300025940 Bacteria 11002
279 Ga0207691_10016137 3300025940 Bacteria 7095
280 Ga0207691_10016503 3300025940 Bacteria 7011
281 Ga0207691_10025240 3300025940 Bacteria 5580
282 Ga0207691_10027921 3300025940 Bacteria 5287
283 Ga0207691_10038231 3300025940 Bacteria 4440
284 Ga0207691_10094816 3300025940 Bacteria 2670
285 Ga0207691_10120204 3300025940 Bacteria 2329
286 Ga0207691_10153017 3300025940 Bacteria 2027
287 Ga0207711_10001139 3300025941 Bacteria 25374
288 Ga0207711_10004798 3300025941 Bacteria 11476
289 Ga0207711_10021411 3300025941 Bacteria 5401
290 Ga0207711_10022560 3300025941 Bacteria 5265
291 Ga0207711_10025564 3300025941 Bacteria 4952
292 Ga0207711_10057777 3300025941 Bacteria 3335
293 Ga0207689_10002276 3300025942 Bacteria 17981
294 Ga0207689_10002816 3300025942 Bacteria 16063
295 Ga0207689_10009709 3300025942 Bacteria 8290
296 Ga0207661_10018318 3300025944 Bacteria 5202
297 Ga0207661_10096517 3300025944 Bacteria 2473
298 Ga0207679_10229330 3300025945 Bacteria 1567
299 Ga0207679_10331027 3300025945 Bacteria 1322
300 Ga0207651_10002585 3300025960 Bacteria 8647
301 Ga0207651_10121929 3300025960 Bacteria 1978
302 Ga0207651_10224723 3300025960 Bacteria 1520
303 Ga0207712_10006317 3300025961 Bacteria 7475
304 Ga0207712_10041969 3300025961 Bacteria 3148
305 Ga0207712_10312324 3300025961 Bacteria 1294
306 Ga0207712_10389578 3300025961 Bacteria 1168
307 Ga0207668_10000501 3300025972 Bacteria 24522
308 Ga0207640_10209366 3300025981 Bacteria 1484
309 Ga0207658_10000756 3300025986 Bacteria 27753
310 Ga0207658_10001976 3300025986 Bacteria 15297
311 Ga0207658_10010568 3300025986 Bacteria 6272
312 Ga0207658_10038948 3300025986 Bacteria 3428
313 Ga0207658_10067375 3300025986 Bacteria 2696
314 Ga0207677_10009225 3300026023 Bacteria 5541
315 Ga0207677_10010049 3300026023 Bacteria 5342
316 Ga0207677_10025004 3300026023 Bacteria 3719
317 Ga0207677_10110132 3300026023 Bacteria 2049
318 Ga0207703_10001098 3300026035 Bacteria 25703
319 Ga0207703_10018800 3300026035 Bacteria 5395
320 Ga0207639_10046628 3300026041 Bacteria 3271
321 Ga0207678_10049995 3300026067 Bacteria 3612
322 Ga0207678_10276783 3300026067 Bacteria 1440
323 Ga0207708_10009117 3300026075 Bacteria 7342
324 Ga0207708_10368081 3300026075 Bacteria 1183
325 Ga0207702_10028001 3300026078 Bacteria 4681
326 Ga0207641_10008806 3300026088 Bacteria 8335
327 Ga0207641_10048207 3300026088 Bacteria 3595
328 Ga0207641_10091865 3300026088 Bacteria 2657
329 Ga0207641_10160861 3300026088 Bacteria 2041
330 Ga0207641_10170283 3300026088 Bacteria 1987
331 Ga0207641_10220504 3300026088 Bacteria 1758
332 Ga0207648_10002224 3300026089 Bacteria 21032
333 Ga0207648_10074027 3300026089 Bacteria 2968
334 Ga0207648_10151375 3300026089 Bacteria 2047
335 Ga0207676_10000082 3300026095 Bacteria 92500
336 Ga0207676_10025670 3300026095 Bacteria 4373
337 Ga0207675_100001716 3300026118 Bacteria 21951
338 Ga0207675_100006118 3300026118 Bacteria 11440
339 Ga0207675_100018142 3300026118 Bacteria 6562
340 Ga0207683_10002265 3300026121 Bacteria 16869
341 Ga0207683_10022096 3300026121 Bacteria 5459
342 Ga0207683_10054051 3300026121 Bacteria 3521
343 Ga0207683_10058620 3300026121 Bacteria 3381
344 Ga0207683_10083771 3300026121 Bacteria 2834
345 Ga0207698_10001794 3300026142 Bacteria 12530
346 Ga0207698_10006101 3300026142 Bacteria 7498
347 Ga0207698_10031329 3300026142 Bacteria 3837
348 Ga0207698_10235875 3300026142 Bacteria 1664
349 Ga0268266_10192476 3300028379 Bacteria 1863
350 Ga0268266_10317614 3300028379 Bacteria 1457
351 Ga0268266_10434013 3300028379 Bacteria 1247
352 Ga0268265_10008857 3300028380 Bacteria 6800
353 Ga0268265_10013044 3300028380 Bacteria 5643
354 Ga0268264_10001195 3300028381 Bacteria 25076
355 Ga0268264_10026094 3300028381 Bacteria 4771
356 Ga0307517_10000005 3300028786 Bacteria 260207
357 Ga0307515_10000051 3300028794 Bacteria 272100
358 Ga0307515_10000093 3300028794 Bacteria 212053
359 Ga0307515_10000204 3300028794 Bacteria 145075
360 Ga0307515_10000651 3300028794 Bacteria 80257
361 Ga0307515_10064322 3300028794 Bacteria 5130
362 Ga0307512_10031215 3300030522 Bacteria 4618
363 Ga0307512_10039531 3300030522 Bacteria 3951
364 Ga0265327_10001335 3300031251 Bacteria 31984
365 Ga0307513_10000104 3300031456 Bacteria 119239
366 Ga0307513_10000113 3300031456 Bacteria 114576
367 Ga0307513_10010357 3300031456 Bacteria 11695
368 Ga0307509_10001413 3300031507 Bacteria 40503
369 Ga0307509_10097966 3300031507 Bacteria 2979
370 Ga0307408_100067102 3300031548 Bacteria 2637
371 Ga0307408_100100894 3300031548 Bacteria 2199
372 Ga0265342_10057039 3300031712 Bacteria 2313
373 Ga0307516_10016192 3300031730 Bacteria 7810
374 Ga0307516_10249434 3300031730 Bacteria 1470
375 Ga0307516_10302136 3300031730 Bacteria 1276
376 Ga0307405_10088871 3300031731 Bacteria 2040
377 Ga0307405_10107887 3300031731 Bacteria 1880
378 Ga0307405_10282892 3300031731 Bacteria 1249
379 Ga0307413_10062288 3300031824 Bacteria 2306
380 Ga0307410_10003394 3300031852 Bacteria 7985
381 Ga0307406_10000141 3300031901 Bacteria 43017
382 Ga0307406_10099989 3300031901 Bacteria 1973
383 Ga0307407_10029633 3300031903 Bacteria 2943
384 Ga0307412_10004268 3300031911 Bacteria 7971
385 Ga0307412_10237233 3300031911 Bacteria 1408
386 Ga0307409_100001481 3300031995 Bacteria 11581
387 Ga0307409_100064726 3300031995 Bacteria 2874
388 Ga0307416_100001862 3300032002 Bacteria 11764
389 Ga0307416_100021676 3300032002 Bacteria 4619
390 Ga0307414_10034372 3300032004 Bacteria 3360
391 Ga0307411_10045359 3300032005 Bacteria 2827
392 Ga0307411_10076414 3300032005 Bacteria 2289
393 Ga0307415_100040656 3300032126 Bacteria 3082
394 Ga0373954_0092218 3300035118 Bacteria 1456
395 Ga0373946_0123360 3300035171 Bacteria 1185
396 Ga0373927_0220686 3300035695 Bacteria 1245
397 Ga0373947_0079653 3300035725 Bacteria 2025
398 Ga0373925_0008608 3300037068 Bacteria 7436
399 Ga0373925_0113586 3300037068 Bacteria 2095
400 Ga0373925_0148758 3300037068 Bacteria 1837
401 Ga0395899_0033266 3300037312 Bacteria 3872
402 Ga0395898_0003041 3300037466 Bacteria 19009
403 Ga0395898_0081559 3300037466 Bacteria 3118
404 Ga0395905_0035908 3300037471 Bacteria 4654
405 Ga0395905_0174495 3300037471 Bacteria 2018
406 Ga0395901_0106748 3300038443 Bacteria 2939
407 Ga0436365_0414269 3300039437 Bacteria 1325
408 Ga0439464_0000405 3300042439 Bacteria 8475
409 Ga0451577_0001779 3300042876 Bacteria 27698
410 Ga0453684_0109703 3300044712 Bacteria 3356
411 Ga0453684_0492093 3300044712 Bacteria 1359
412 Ga0466971_0097990 3300044719 Bacteria 1346
413 Ga0466959_0249077 3300045049 Bacteria 1226
414 Ga0451576_0117145 3300045051 Bacteria 2773
415 Ga0451576_0130661 3300045051 Bacteria 2618
416 Ga0495592_0000262 3300046454 Bacteria 44956
417 Ga0495638_0087515 3300046460 Bacteria 1882
418 Ga0495638_0096306 3300046460 Bacteria 1777
419 Ga0495650_0002530 3300046471 Bacteria 14607
420 Ga0495639_0002977 3300046475 Bacteria 7374
421 Ga0495631_0000082 3300046518 Bacteria 61773
422 Ga0495632_0002553 3300046519 Bacteria 13792
423 Ga0495637_0002629 3300046520 Bacteria 9845
424 Ga0495621_0017534 3300046539 Bacteria 2316
425 Ga0495645_0042546 3300046543 Bacteria 3312
426 Ga0495667_0076203 3300046559 Bacteria 2182
427 Ga0495656_0065696 3300046615 Bacteria 1596
428 Ga0495625_0036214 3300046660 Bacteria 3629
429 Ga0495588_0009596 3300046674 Bacteria 4478
430 Ga0495588_0012804 3300046674 Bacteria 3977
431 Ga0495646_0007763 3300046680 Bacteria 6816
432 Ga0495647_0020570 3300046681 Bacteria 2371
433 Ga0495658_0069154 3300046683 Bacteria 2046
434 Ga0495658_0092728 3300046683 Bacteria 1791
435 Ga0495613_0126573 3300046689 Bacteria 1832
436 Ga0495671_0040438 3300046692 Bacteria 2351
437 Ga0495649_0006431 3300046694 Bacteria 7313
438 Ga0495660_0039960 3300046810 Bacteria 2602
439 Ga0495676_0005431 3300047321 Bacteria 11692
440 Ga0495687_026873 3300047443 Bacteria 2700
441 Ga0495677_0068859 3300047445 Bacteria 1318
442 Ga0495686_0011103 3300047472 Bacteria 6362
443 Ga0495686_0166145 3300047472 Bacteria 1286
444 Ga0495626_0071427 3300048091 Bacteria 1560
445 Ga0496100_0012091 3300048903 Bacteria 4938
446 Ga0496101_0012444 3300048904 Bacteria 5679
447 Ga0496102_0006139 3300048905 Bacteria 10239
448 Ga0496102_0020213 3300048905 Bacteria 5882
449 Ga0496103_0072138 3300048906 Bacteria 2162
450 Ga0496104_0019273 3300048907 Bacteria 6239
451 Ga0496104_0061743 3300048907 Bacteria 3553
452 Ga0496105_0003961 3300048908 Bacteria 11082
453 Ga0496105_0006380 3300048908 Bacteria 9062
454 Ga0496106_0005445 3300048909 Bacteria 9421
455 Ga0496106_0052011 3300048909 Bacteria 3089
456 Ga0496107_0011950 3300048910 Bacteria 6062
457 Ga0496108_0068716 3300048911 Bacteria 2989
458 Ga0496108_0214499 3300048911 Bacteria 1671
459 Ga0496108_0250063 3300048911 Bacteria 1542
460 Ga0496109_0010310 3300048912 Bacteria 7981
461 Ga0496109_0051998 3300048912 Bacteria 3733
462 Ga0496109_0092837 3300048912 Bacteria 2792
463 Ga0496110_0019162 3300048913 Bacteria 5753
464 Ga0496110_0447083 3300048913 Bacteria 1178
465 Ga0496111_0177974 3300048914 Bacteria 1581
466 Ga0496112_0062520 3300048915 Bacteria 3672
467 Ga0496112_0359804 3300048915 Bacteria 1397
468 Ga0496113_0031926 3300048916 Bacteria 3825
469 Ga0496113_0075597 3300048916 Bacteria 2571
470 Ga0496114_0047496 3300048917 Bacteria 3571
471 Ga0496116_0037004 3300048919 Bacteria 3409
472 Ga0496117_0022933 3300048920 Bacteria 4996
473 Ga0496117_0044046 3300048920 Bacteria 3236
474 Ga0496118_0077754 3300048921 Bacteria 2352
475 Ga0496121_0002223 3300048924 Bacteria 30304
476 Ga0496121_0007783 3300048924 Bacteria 12834
477 Ga0496121_0012676 3300048924 Bacteria 9149
478 Ga0496121_0045767 3300048924 Bacteria 3756
479 Ga0496122_0000272 3300048925 Bacteria 115666
480 Ga0496122_0091514 3300048925 Bacteria 2071
481 Ga0496123_0000221 3300048926 Bacteria 115688
482 Ga0496124_0070175 3300048927 Bacteria 2907
483 Ga0496125_0085134 3300048928 Bacteria 2397
484 Ga0496125_0161785 3300048928 Bacteria 1519
485 Ga0496126_0073685 3300048929 Bacteria 3035
486 Ga0496126_0091520 3300048929 Bacteria 2674
487 Ga0501033_0028411 3300049570 Bacteria 4201
488 Ga0501036_0100773 3300049572 Bacteria 2443
489 Ga0501039_0067537 3300049575 Bacteria 2777
490 Ga0501047_0006267 3300049581 Bacteria 11180
491 Ga0501035_0018114 3300049822 Bacteria 6489
492 Ga0501035_0282103 3300049822 Bacteria 1404
493 Ga0501044_0001968 3300049823 Bacteria 23773
494 nmdc:mga03683_18341_c1 3300050489 Bacteria 2659
495 nmdc:mga00v17_32198_c1 3300050491 Bacteria 3098
496 nmdc:mga0yw44_215784_c1 3300050492 Bacteria 1270
497 nmdc:mga0k408_15845_c1 3300050493 Bacteria 4174
498 nmdc:mga0k408_641_c2 3300050493 Bacteria 18568
499 nmdc:mga0k408_9486_c1 3300050493 Bacteria 5247
500 nmdc:mga09592_8189_c1 3300050508 Bacteria 8499
501 nmdc:mga0n895_401542_c1 3300050512 Bacteria 1386
502 Ga0500610_0000853 3300053079 Bacteria 9757
503 Ga0500635_0050273 3300053080 Bacteria 1425
504 Ga0495655_0007348 3300053083 Bacteria 2044
505 Ga0495619_0144197 3300053085 Bacteria 1641
506 Ga0500578_0029960 3300053086 Bacteria 3496
507 Ga0500644_0000705 3300053088 Bacteria 11835
508 Ga0500644_0001232 3300053088 Bacteria 7072
509 Ga0500644_0063018 3300053088 Bacteria 1312
510 Ga0500646_0036511 3300053090 Bacteria 1369
511 Ga0500583_0017390 3300053092 Bacteria 2896
512 Ga0500651_0000180 3300053093 Bacteria 41015
513 Ga0500651_0012530 3300053093 Bacteria 5143
514 Ga0500651_0022177 3300053093 Bacteria 3966
515 Ga0500651_0074678 3300053093 Bacteria 2106
516 Ga0500650_0128371 3300053098 Bacteria 1179
517 Ga0500562_000377 3300053108 Bacteria 10814
518 Ga0500571_000246 3300053110 Bacteria 20455
519 Ga0500593_000105 3300053117 Bacteria 32307
520 Ga0500593_000781 3300053117 Bacteria 11874
521 Ga0500594_0002193 3300053118 Bacteria 4233
522 Ga0500595_009664 3300053119 Bacteria 3882
523 Ga0500597_007955 3300053120 Bacteria 3634
524 Ga0500618_007817 3300053125 Bacteria 3022
525 Ga0500628_000488 3300053129 Bacteria 7351
526 Ga0500652_001554 3300053131 Bacteria 7013
527 Ga0500655_000414 3300053133 Bacteria 8968
528 Ga0500658_0000397 3300053134 Bacteria 18932
529 Ga0500658_0000407 3300053134 Bacteria 18703
530 Ga0500658_0018630 3300053134 Bacteria 2605
531 Ga0500559_0000038 3300053136 Bacteria 109922
532 Ga0500564_078834 3300053138 Bacteria 1478
533 Ga0500568_0001478 3300053139 Bacteria 15055
534 Ga0500568_0007472 3300053139 Bacteria 5358
535 Ga0500568_0016704 3300053139 Bacteria 3254
536 Ga0500573_0005690 3300053140 Bacteria 6681
537 Ga0500616_0004312 3300053153 Bacteria 10203
538 Ga0500619_000027 3300053154 Bacteria 48298
539 Ga0500619_000183 3300053154 Bacteria 14804
540 Ga0500622_0000142 3300053156 Bacteria 76275
541 Ga0500622_0001771 3300053156 Bacteria 16539
542 Ga0500622_0005368 3300053156 Bacteria 7715
543 Ga0500645_000661 3300053730 Bacteria 21613
544 Ga0500645_001225 3300053730 Bacteria 13527
545 Ga0500645_004879 3300053730 Bacteria 5049
546 Ga0500645_006124 3300053730 Bacteria 4331
547 Ga0500565_001597 3300053734 Bacteria 1554
548 Ga0500587_000318 3300053739 Bacteria 5404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_215784_c1 nmdc:mga0yw44_215784_c1_405_1244 263
2 3300005445 Ga0070708_100507906 Ga0070708_1005079062 276
3 3300005539 Ga0068853_100340886 Ga0068853_1003408861 286
4 3300053154 Ga0500619_000027 Ga0500619_000027_35556_36530 289
5 3300005355 Ga0070671_100232551 Ga0070671_1002325512 292
6 3300005841 Ga0068863_100049857 Ga0068863_1000498572 292
7 3300009177 Ga0105248_10001312 Ga0105248_1000131223 292
8 3300025931 Ga0207644_10011943 Ga0207644_100119436 292
9 3300025941 Ga0207711_10004798 Ga0207711_100047987 292
10 3300048911 Ga0496108_0250063 Ga0496108_0250063_339_1310 292
11 3300048914 Ga0496111_0177974 Ga0496111_0177974_297_1268 292
12 3300048915 Ga0496112_0062520 Ga0496112_0062520_2456_3427 292
13 3300048916 Ga0496113_0031926 Ga0496113_0031926_2354_3325 292
14 3300053108 Ga0500562_000377 Ga0500562_000377_1742_2710 293
15 3300030522 Ga0307512_10039531 Ga0307512_100395313 296
16 3300003791 Ga0055530_10006422 Ga0055530_100064222 302
17 3300025298 Ga0209050_1002737 Ga0209050_10027373 302
18 3300025304 Ga0209257_1029423 Ga0209257_10294232 302
19 3300053080 Ga0500635_0050273 Ga0500635_0050273_171_1139 302
20 3300005456 Ga0070678_100300660 Ga0070678_1003006602 303
21 3300005616 Ga0068852_100117712 Ga0068852_1001177123 303
22 3300006195 Ga0075366_10006197 Ga0075366_100061976 303
23 3300006353 Ga0075370_10010052 Ga0075370_100100523 303
24 3300031251 Ga0265327_10001335 Ga0265327_100013358 303
25 3300053085 Ga0495619_0144197 Ga0495619_0144197_172_1137 303
26 3300005331 Ga0070670_100017564 Ga0070670_1000175644 304
27 3300005354 Ga0070675_100007049 Ga0070675_1000070495 304
28 3300005364 Ga0070673_100050820 Ga0070673_1000508204 304
29 3300005456 Ga0070678_100093749 Ga0070678_1000937491 304
30 3300005543 Ga0070672_100001669 Ga0070672_1000016693 304
31 3300005841 Ga0068863_100336395 Ga0068863_1003363952 304
32 3300006237 Ga0097621_100021399 Ga0097621_1000213992 304
33 3300006358 Ga0068871_100033503 Ga0068871_1000335032 304
34 3300009177 Ga0105248_10156414 Ga0105248_101564142 304
35 3300013296 Ga0157374_10064321 Ga0157374_100643212 304
36 3300013308 Ga0157375_10098773 Ga0157375_100987733 304
37 3300025920 Ga0207649_10208916 Ga0207649_102089161 304
38 3300025925 Ga0207650_10070045 Ga0207650_100700452 304
39 3300025926 Ga0207659_10020280 Ga0207659_100202802 304
40 3300025940 Ga0207691_10025240 Ga0207691_100252402 304
41 3300025960 Ga0207651_10224723 Ga0207651_102247231 304
42 3300026088 Ga0207641_10170283 Ga0207641_101702831 304
43 3300026121 Ga0207683_10083771 Ga0207683_100837713 304
44 3300037068 Ga0373925_0113586 Ga0373925_0113586_570_1640 304
45 3300046681 Ga0495647_0020570 Ga0495647_0020570_1146_2114 304
46 3300048907 Ga0496104_0061743 Ga0496104_0061743_2202_3170 304
47 3300048908 Ga0496105_0003961 Ga0496105_0003961_5394_6362 304
48 3300009553 Ga0105249_10253417 Ga0105249_102534172 305
49 3300025903 Ga0207680_10030035 Ga0207680_100300353 305
50 3300025926 Ga0207659_10226018 Ga0207659_102260182 305
51 3300025931 Ga0207644_10132774 Ga0207644_101327743 305
52 3300025961 Ga0207712_10312324 Ga0207712_103123242 305
53 3300053098 Ga0500650_0128371 Ga0500650_0128371_197_1168 305
54 3300006038 Ga0075365_10080650 Ga0075365_100806503 306
55 3300025291 Ga0209675_1003637 Ga0209675_10036372 306
56 3300025292 Ga0209676_1029548 Ga0209676_10295481 306
57 3300025925 Ga0207650_10355201 Ga0207650_103552012 306
58 3300025926 Ga0207659_10078383 Ga0207659_100783833 306
59 3300035118 Ga0373954_0092218 Ga0373954_0092218_128_1093 306
60 3300048917 Ga0496114_0047496 Ga0496114_0047496_573_1538 306
61 3300048928 Ga0496125_0085134 Ga0496125_0085134_1041_2012 306
62 3300005543 Ga0070672_100122405 Ga0070672_1001224052 307
63 3300025923 Ga0207681_10004540 Ga0207681_100045408 307
64 3300025940 Ga0207691_10016503 Ga0207691_100165037 307
65 3300026121 Ga0207683_10058620 Ga0207683_100586202 307
66 3300003215 JGI25153J46596_10001547 JGI25153J46596_100015477 308
67 3300005535 Ga0070684_100086430 Ga0070684_1000864302 308
68 3300005547 Ga0070693_100140778 Ga0070693_1001407782 308
69 3300005577 Ga0068857_100034210 Ga0068857_1000342104 308
70 3300005617 Ga0068859_100148497 Ga0068859_1001484972 308
71 3300005834 Ga0068851_10015300 Ga0068851_100153003 308
72 3300005843 Ga0068860_100078220 Ga0068860_1000782202 308
73 3300006931 Ga0097620_100148496 Ga0097620_1001484962 308
74 3300013100 Ga0157373_10013249 Ga0157373_100132495 308
75 3300013297 Ga0157378_10128940 Ga0157378_101289402 308
76 3300013307 Ga0157372_10037621 Ga0157372_100376214 308
77 3300025297 Ga0209758_1000268 Ga0209758_10002688 308
78 3300025920 Ga0207649_10002899 Ga0207649_100028994 308
79 3300025924 Ga0207694_10030870 Ga0207694_100308704 308
80 3300025944 Ga0207661_10018318 Ga0207661_100183184 308
81 3300026142 Ga0207698_10006101 Ga0207698_100061017 308
82 3300031730 Ga0307516_10302136 Ga0307516_103021362 308
83 3300046519 Ga0495632_0002553 Ga0495632_0002553_9540_10508 308
84 3300046694 Ga0495649_0006431 Ga0495649_0006431_5471_6439 308
85 3300046810 Ga0495660_0039960 Ga0495660_0039960_1385_2353 308
86 3300047443 Ga0495687_026873 Ga0495687_026873_204_1172 308
87 3300048091 Ga0495626_0071427 Ga0495626_0071427_552_1520 308
88 3300050493 nmdc:mga0k408_641_c2 nmdc:mga0k408_641_c2_12639_13610 308
89 3300053088 Ga0500644_0001232 Ga0500644_0001232_3163_4128 308
90 3300053093 Ga0500651_0074678 Ga0500651_0074678_287_1315 308
91 3300053131 Ga0500652_001554 Ga0500652_001554_3412_4440 308
92 3300053134 Ga0500658_0018630 Ga0500658_0018630_1488_2456 308
93 3300053136 Ga0500559_0000038 Ga0500559_0000038_5428_6393 308
94 3300053156 Ga0500622_0000142 Ga0500622_0000142_12117_13145 308
95 3300053156 Ga0500622_0001771 Ga0500622_0001771_12837_13802 308
96 3300053739 Ga0500587_000318 Ga0500587_000318_3288_4253 308
97 3300005328 Ga0070676_10028439 Ga0070676_100284392 309
98 3300005329 Ga0070683_100249374 Ga0070683_1002493742 309
99 3300005330 Ga0070690_100024190 Ga0070690_1000241902 309
100 3300005333 Ga0070677_10001133 Ga0070677_100011331 309
101 3300005333 Ga0070677_10011658 Ga0070677_100116583 309
102 3300005334 Ga0068869_100008622 Ga0068869_1000086225 309
103 3300005335 Ga0070666_10002696 Ga0070666_1000269612 309
104 3300005339 Ga0070660_100224418 Ga0070660_1002244182 309
105 3300005347 Ga0070668_100009623 Ga0070668_1000096238 309
106 3300005353 Ga0070669_100031641 Ga0070669_1000316414 309
107 3300005354 Ga0070675_100127137 Ga0070675_1001271372 309
108 3300005354 Ga0070675_100151866 Ga0070675_1001518661 309
109 3300005356 Ga0070674_100109765 Ga0070674_1001097652 309
110 3300005364 Ga0070673_100128665 Ga0070673_1001286653 309
111 3300005441 Ga0070700_100019974 Ga0070700_1000199744 309
112 3300005455 Ga0070663_100062855 Ga0070663_1000628552 309
113 3300005459 Ga0068867_100047149 Ga0068867_1000471492 309
114 3300005543 Ga0070672_100003805 Ga0070672_1000038054 309
115 3300005564 Ga0070664_100029143 Ga0070664_1000291434 309
116 3300005616 Ga0068852_100032837 Ga0068852_1000328372 309
117 3300005617 Ga0068859_100105470 Ga0068859_1001054701 309
118 3300005618 Ga0068864_100115767 Ga0068864_1001157672 309
119 3300005718 Ga0068866_10003255 Ga0068866_100032557 309
120 3300005719 Ga0068861_100002753 Ga0068861_10000275312 309
121 3300005841 Ga0068863_100003466 Ga0068863_10000346617 309
122 3300005842 Ga0068858_100232829 Ga0068858_1002328292 309
123 3300005843 Ga0068860_100052432 Ga0068860_1000524323 309
124 3300006881 Ga0068865_100005211 Ga0068865_1000052119 309
125 3300006931 Ga0097620_100105471 Ga0097620_1001054715 309
126 3300009101 Ga0105247_10072160 Ga0105247_100721601 309
127 3300009148 Ga0105243_10001253 Ga0105243_1000125312 309
128 3300009551 Ga0105238_10405521 Ga0105238_104055211 309
129 3300009553 Ga0105249_10027766 Ga0105249_100277664 309
130 3300009553 Ga0105249_10360728 Ga0105249_103607282 309
131 3300013306 Ga0163162_10007108 Ga0163162_1000710812 309
132 3300013306 Ga0163162_10388776 Ga0163162_103887762 309
133 3300014326 Ga0157380_10059099 Ga0157380_100590992 309
134 3300014968 Ga0157379_10016380 Ga0157379_100163808 309
135 3300025893 Ga0207682_10005689 Ga0207682_100056897 309
136 3300025899 Ga0207642_10002603 Ga0207642_100026036 309
137 3300025903 Ga0207680_10083952 Ga0207680_100839522 309
138 3300025907 Ga0207645_10003737 Ga0207645_100037373 309
139 3300025923 Ga0207681_10000340 Ga0207681_1000034034 309
140 3300025925 Ga0207650_10138658 Ga0207650_101386581 309
141 3300025926 Ga0207659_10047166 Ga0207659_100471663 309
142 3300025935 Ga0207709_10016368 Ga0207709_100163683 309
143 3300025938 Ga0207704_10023154 Ga0207704_100231543 309
144 3300025941 Ga0207711_10025564 Ga0207711_100255647 309
145 3300025942 Ga0207689_10002816 Ga0207689_100028168 309
146 3300025961 Ga0207712_10006317 Ga0207712_100063174 309
147 3300025972 Ga0207668_10000501 Ga0207668_1000050124 309
148 3300025986 Ga0207658_10000756 Ga0207658_1000075630 309
149 3300026035 Ga0207703_10018800 Ga0207703_100188002 309
150 3300026075 Ga0207708_10009117 Ga0207708_100091172 309
151 3300026088 Ga0207641_10008806 Ga0207641_100088063 309
152 3300026118 Ga0207675_100006118 Ga0207675_10000611812 309
153 3300028380 Ga0268265_10008857 Ga0268265_100088572 309
154 3300028381 Ga0268264_10001195 Ga0268264_1000119524 309
155 3300031507 Ga0307509_10001413 Ga0307509_1000141325 309
156 3300031901 Ga0307406_10099989 Ga0307406_100999892 309
157 3300031995 Ga0307409_100001481 Ga0307409_1000014812 309
158 3300032002 Ga0307416_100001862 Ga0307416_1000018629 309
159 3300032126 Ga0307415_100040656 Ga0307415_1000406562 309
160 3300035695 Ga0373927_0220686 Ga0373927_0220686_17_988 309
161 3300035725 Ga0373947_0079653 Ga0373947_0079653_342_1313 309
162 3300037068 Ga0373925_0008608 Ga0373925_0008608_4937_5908 309
163 3300037068 Ga0373925_0148758 Ga0373925_0148758_374_1339 309
164 3300045049 Ga0466959_0249077 Ga0466959_0249077_90_1022 309
165 3300046460 Ga0495638_0087515 Ga0495638_0087515_717_1682 309
166 3300046559 Ga0495667_0076203 Ga0495667_0076203_1215_2150 309
167 3300046660 Ga0495625_0036214 Ga0495625_0036214_2061_3032 309
168 3300046689 Ga0495613_0126573 Ga0495613_0126573_569_1534 309
169 3300053139 Ga0500568_0007472 Ga0500568_0007472_1453_2424 309
170 3300005367 Ga0070667_100003367 Ga0070667_1000033673 310
171 3300005459 Ga0068867_100113534 Ga0068867_1001135343 310
172 3300005548 Ga0070665_100085386 Ga0070665_1000853863 310
173 3300005718 Ga0068866_10030347 Ga0068866_100303471 310
174 3300006195 Ga0075366_10001959 Ga0075366_1000195911 310
175 3300013308 Ga0157375_10128421 Ga0157375_101284212 310
176 3300025938 Ga0207704_10009638 Ga0207704_100096382 310
177 3300025986 Ga0207658_10001976 Ga0207658_100019768 310
178 3300026089 Ga0207648_10151375 Ga0207648_101513753 310
179 3300028379 Ga0268266_10317614 Ga0268266_103176142 310
180 3300028794 Ga0307515_10000051 Ga0307515_1000005117 310
181 3300046454 Ga0495592_0000262 Ga0495592_0000262_24573_25538 310
182 3300046680 Ga0495646_0007763 Ga0495646_0007763_2981_3946 310
183 3300047445 Ga0495677_0068859 Ga0495677_0068859_289_1257 310
184 3300048925 Ga0496122_0091514 Ga0496122_0091514_500_1474 310
185 3300050493 nmdc:mga0k408_9486_c1 nmdc:mga0k408_9486_c1_3848_4819 310
186 3300050508 nmdc:mga09592_8189_c1 nmdc:mga09592_8189_c1_5037_6005 310
187 3300053138 Ga0500564_078834 Ga0500564_078834_278_1243 310
188 3300005937 Ga0081455_10326388 Ga0081455_103263881 311
189 3300031456 Ga0307513_10010357 Ga0307513_1001035710 311
190 3300031548 Ga0307408_100100894 Ga0307408_1001008942 311
191 3300031731 Ga0307405_10107887 Ga0307405_101078871 311
192 3300031824 Ga0307413_10062288 Ga0307413_100622883 311
193 3300031852 Ga0307410_10003394 Ga0307410_100033942 311
194 3300031903 Ga0307407_10029633 Ga0307407_100296332 311
195 3300031911 Ga0307412_10004268 Ga0307412_100042682 311
196 3300031995 Ga0307409_100064726 Ga0307409_1000647262 311
197 3300032002 Ga0307416_100021676 Ga0307416_1000216765 311
198 3300032004 Ga0307414_10034372 Ga0307414_100343723 311
199 3300032005 Ga0307411_10076414 Ga0307411_100764142 311
200 3300046683 Ga0495658_0069154 Ga0495658_0069154_912_1880 311
201 3300053088 Ga0500644_0000705 Ga0500644_0000705_4012_4983 311
202 3300053117 Ga0500593_000781 Ga0500593_000781_6017_6988 311
203 3300005343 Ga0070687_100019087 Ga0070687_1000190873 312
204 3300005543 Ga0070672_100014317 Ga0070672_1000143172 312
205 3300005616 Ga0068852_100229343 Ga0068852_1002293432 312
206 3300005617 Ga0068859_100050225 Ga0068859_1000502254 312
207 3300005840 Ga0068870_10043939 Ga0068870_100439392 312
208 3300005842 Ga0068858_100004094 Ga0068858_1000040947 312
209 3300005843 Ga0068860_100005109 Ga0068860_1000051092 312
210 3300006177 Ga0075362_10008110 Ga0075362_100081102 312
211 3300006195 Ga0075366_10054714 Ga0075366_100547142 312
212 3300006931 Ga0097620_100050225 Ga0097620_1000502254 312
213 3300014968 Ga0157379_10022517 Ga0157379_100225173 312
214 3300025940 Ga0207691_10006845 Ga0207691_1000684510 312
215 3300026075 Ga0207708_10368081 Ga0207708_103680811 312
216 3300026142 Ga0207698_10031329 Ga0207698_100313292 312
217 3300028381 Ga0268264_10026094 Ga0268264_100260944 312
218 3300028794 Ga0307515_10000651 Ga0307515_1000065118 312
219 3300050489 nmdc:mga03683_18341_c1 nmdc:mga03683_18341_c1_943_1914 312
220 3300050493 nmdc:mga0k408_15845_c1 nmdc:mga0k408_15845_c1_2509_3480 312
221 3300005334 Ga0068869_100007139 Ga0068869_1000071392 313
222 3300005336 Ga0070680_100011705 Ga0070680_1000117056 313
223 3300005339 Ga0070660_100008436 Ga0070660_1000084364 313
224 3300005354 Ga0070675_100007219 Ga0070675_1000072198 313
225 3300005367 Ga0070667_100162888 Ga0070667_1001628882 313
226 3300005456 Ga0070678_100323485 Ga0070678_1003234852 313
227 3300005457 Ga0070662_100001879 Ga0070662_1000018792 313
228 3300005458 Ga0070681_10230677 Ga0070681_102306772 313
229 3300005530 Ga0070679_100084851 Ga0070679_1000848512 313
230 3300005543 Ga0070672_100147165 Ga0070672_1001471652 313
231 3300005563 Ga0068855_100030776 Ga0068855_1000307762 313
232 3300005578 Ga0068854_100016120 Ga0068854_1000161204 313
233 3300005616 Ga0068852_100007695 Ga0068852_1000076957 313
234 3300005618 Ga0068864_100017092 Ga0068864_1000170922 313
235 3300005719 Ga0068861_100006744 Ga0068861_1000067449 313
236 3300005834 Ga0068851_10005859 Ga0068851_100058592 313
237 3300005841 Ga0068863_100051894 Ga0068863_1000518943 313
238 3300006237 Ga0097621_100034586 Ga0097621_1000345864 313
239 3300006358 Ga0068871_100009035 Ga0068871_1000090354 313
240 3300006871 Ga0075434_100309121 Ga0075434_1003091212 313
241 3300009177 Ga0105248_10032838 Ga0105248_100328383 313
242 3300009545 Ga0105237_10044555 Ga0105237_100445554 313
243 3300013296 Ga0157374_10059809 Ga0157374_100598092 313
244 3300013306 Ga0163162_10123729 Ga0163162_101237292 313
245 3300013306 Ga0163162_10172528 Ga0163162_101725282 313
246 3300014325 Ga0163163_10383571 Ga0163163_103835712 313
247 3300014745 Ga0157377_10002466 Ga0157377_100024665 313
248 3300014968 Ga0157379_10010284 Ga0157379_100102842 313
249 3300014969 Ga0157376_10027453 Ga0157376_100274534 313
250 3300017792 Ga0163161_10006928 Ga0163161_100069286 313
251 3300025893 Ga0207682_10026651 Ga0207682_100266512 313
252 3300025907 Ga0207645_10019302 Ga0207645_100193024 313
253 3300025917 Ga0207660_10013763 Ga0207660_100137632 313
254 3300025921 Ga0207652_10282898 Ga0207652_102828981 313
255 3300025923 Ga0207681_10006022 Ga0207681_100060225 313
256 3300025926 Ga0207659_10004405 Ga0207659_100044052 313
257 3300025933 Ga0207706_10001650 Ga0207706_1000165012 313
258 3300025940 Ga0207691_10153017 Ga0207691_101530172 313
259 3300025941 Ga0207711_10057777 Ga0207711_100577772 313
260 3300025942 Ga0207689_10002276 Ga0207689_100022769 313
261 3300025944 Ga0207661_10096517 Ga0207661_100965172 313
262 3300025961 Ga0207712_10389578 Ga0207712_103895782 313
263 3300025981 Ga0207640_10209366 Ga0207640_102093661 313
264 3300026023 Ga0207677_10010049 Ga0207677_100100493 313
265 3300026041 Ga0207639_10046628 Ga0207639_100466283 313
266 3300026067 Ga0207678_10049995 Ga0207678_100499952 313
267 3300026078 Ga0207702_10028001 Ga0207702_100280012 313
268 3300026088 Ga0207641_10048207 Ga0207641_100482073 313
269 3300026088 Ga0207641_10160861 Ga0207641_101608612 313
270 3300026118 Ga0207675_100001716 Ga0207675_10000171612 313
271 3300026121 Ga0207683_10054051 Ga0207683_100540513 313
272 3300026142 Ga0207698_10001794 Ga0207698_1000179413 313
273 3300028794 Ga0307515_10000204 Ga0307515_1000020477 313
274 3300028794 Ga0307515_10064322 Ga0307515_100643221 313
275 3300031456 Ga0307513_10000113 Ga0307513_1000011364 313
276 3300031731 Ga0307405_10282892 Ga0307405_102828921 313
277 3300035171 Ga0373946_0123360 Ga0373946_0123360_161_1126 313
278 3300037312 Ga0395899_0033266 Ga0395899_0033266_2622_3590 313
279 3300037466 Ga0395898_0003041 Ga0395898_0003041_5747_6715 313
280 3300038443 Ga0395901_0106748 Ga0395901_0106748_1050_2018 313
281 3300045051 Ga0451576_0117145 Ga0451576_0117145_1315_2280 313
282 3300047472 Ga0495686_0011103 Ga0495686_0011103_2419_3390 313
283 3300048904 Ga0496101_0012444 Ga0496101_0012444_106_1071 313
284 3300048905 Ga0496102_0020213 Ga0496102_0020213_345_1310 313
285 3300048909 Ga0496106_0005445 Ga0496106_0005445_6167_7132 313
286 3300048910 Ga0496107_0011950 Ga0496107_0011950_1121_2086 313
287 3300048912 Ga0496109_0010310 Ga0496109_0010310_5521_6486 313
288 3300048915 Ga0496112_0359804 Ga0496112_0359804_137_1102 313
289 3300048916 Ga0496113_0075597 Ga0496113_0075597_996_1961 313
290 3300048919 Ga0496116_0037004 Ga0496116_0037004_1509_2480 313
291 3300048920 Ga0496117_0044046 Ga0496117_0044046_1485_2456 313
292 3300048925 Ga0496122_0000272 Ga0496122_0000272_20521_21492 313
293 3300048926 Ga0496123_0000221 Ga0496123_0000221_94175_95146 313
294 3300048929 Ga0496126_0073685 Ga0496126_0073685_708_1679 313
295 3300050512 nmdc:mga0n895_401542_c1 nmdc:mga0n895_401542_c1_242_1207 313
296 3300053090 Ga0500646_0036511 Ga0500646_0036511_120_1091 313
297 3300053140 Ga0500573_0005690 Ga0500573_0005690_363_1334 313
298 3300053730 Ga0500645_000661 Ga0500645_000661_2151_3122 313
299 3300053730 Ga0500645_001225 Ga0500645_001225_10145_11116 313
300 iso_pu_bacteria 2588253510 2588291998 313
301 3300005543 Ga0070672_100216648 Ga0070672_1002166482 314
302 3300021384 Ga0213876_10017580 Ga0213876_100175803 314
303 3300028379 Ga0268266_10192476 Ga0268266_101924761 314
304 3300031901 Ga0307406_10000141 Ga0307406_1000014137 314
305 3300046520 Ga0495637_0002629 Ga0495637_0002629_3354_4328 314
306 3300053079 Ga0500610_0000853 Ga0500610_0000853_5782_6756 314
307 3300053093 Ga0500651_0022177 Ga0500651_0022177_2226_3197 314
308 3300053139 Ga0500568_0016704 Ga0500568_0016704_40_1008 314
309 3300046518 Ga0495631_0000082 Ga0495631_0000082_7475_8449 315
310 3300046539 Ga0495621_0017534 Ga0495621_0017534_550_1524 315
311 3300046674 Ga0495588_0009596 Ga0495588_0009596_2149_3123 315
312 3300046683 Ga0495658_0092728 Ga0495658_0092728_237_1211 315
313 3300046692 Ga0495671_0040438 Ga0495671_0040438_346_1320 315
314 3300047321 Ga0495676_0005431 Ga0495676_0005431_4990_5964 315
315 3300048924 Ga0496121_0012676 Ga0496121_0012676_1657_2631 315
316 3300048928 Ga0496125_0161785 Ga0496125_0161785_328_1302 315
317 3300053093 Ga0500651_0000180 Ga0500651_0000180_31950_32924 315
318 3300053110 Ga0500571_000246 Ga0500571_000246_11898_12872 315
319 3300053117 Ga0500593_000781 Ga0500593_000781_8588_9562 315
320 3300053118 Ga0500594_0002193 Ga0500594_0002193_1294_2268 315
321 3300053120 Ga0500597_007955 Ga0500597_007955_1828_2802 315
322 3300053125 Ga0500618_007817 Ga0500618_007817_414_1388 315
323 3300053133 Ga0500655_000414 Ga0500655_000414_1733_2707 315
324 3300053134 Ga0500658_0000397 Ga0500658_0000397_4773_5747 315
325 3300053134 Ga0500658_0000407 Ga0500658_0000407_12948_13922 315
326 3300053139 Ga0500568_0001478 Ga0500568_0001478_5658_6632 315
327 3300053153 Ga0500616_0004312 Ga0500616_0004312_5843_6817 315
328 3300053734 Ga0500565_001597 Ga0500565_001597_285_1259 315
329 3300005458 Ga0070681_10002957 Ga0070681_100029572 316
330 3300005459 Ga0068867_100072743 Ga0068867_1000727432 316
331 3300005937 Ga0081455_10000315 Ga0081455_100003159 316
332 3300009553 Ga0105249_10113456 Ga0105249_101134563 316
333 3300014968 Ga0157379_10025743 Ga0157379_100257434 316
334 3300025912 Ga0207707_10009961 Ga0207707_100099612 316
335 3300025917 Ga0207660_10137283 Ga0207660_101372831 316
336 3300046674 Ga0495588_0012804 Ga0495588_0012804_2552_3541 316
337 3300048924 Ga0496121_0045767 Ga0496121_0045767_1823_2794 316
338 3300048927 Ga0496124_0070175 Ga0496124_0070175_1858_2829 316
339 3300053730 Ga0500645_004879 Ga0500645_004879_295_1266 316
340 3300031730 Ga0307516_10016192 Ga0307516_100161924 317
341 3300053088 Ga0500644_0063018 Ga0500644_0063018_164_1162 317
342 iso_pu_bacteria 2585428057 2587728643 317
343 iso_pu_bacteria 2599185214 2599621839 317
344 iso_pu_bacteria 2599185226 2599670477 317
345 iso_pu_bacteria 2599185227 2599678967 317
346 iso_pu_bacteria 2599185229 2599691350 317
347 iso_pu_bacteria 2738543013 2739249409 317
348 3300050491 nmdc:mga00v17_32198_c1 nmdc:mga00v17_32198_c1_1976_2938 318
349 iso_pu_bacteria 2831864461 2831867016 318
350 iso_pu_bacteria 2842733646 2842738009 318
351 iso_pu_bacteria 2904541872 2904545587 318
352 iso_pu_bacteria 2928084124 2928086745 318
353 iso_pu_bacteria 2929160207 2929168230 318
354 3300005365 Ga0070688_100095018 Ga0070688_1000950183 319
355 3300048920 Ga0496117_0022933 Ga0496117_0022933_527_1510 319
356 3300048921 Ga0496118_0077754 Ga0496118_0077754_1333_2316 319
357 3300048924 Ga0496121_0002223 Ga0496121_0002223_28481_29464 319
358 3300048929 Ga0496126_0091520 Ga0496126_0091520_833_1816 319
359 3300053092 Ga0500583_0017390 Ga0500583_0017390_1684_2667 319
360 3300053093 Ga0500651_0012530 Ga0500651_0012530_1748_2728 319
361 3300053119 Ga0500595_009664 Ga0500595_009664_1773_2756 319
362 3300005290 Ga0065712_10139313 Ga0065712_101393132 320
363 3300005328 Ga0070676_10001100 Ga0070676_100011001 320
364 3300005328 Ga0070676_10148311 Ga0070676_101483111 320
365 3300005331 Ga0070670_100005394 Ga0070670_1000053948 320
366 3300005331 Ga0070670_100189194 Ga0070670_1001891943 320
367 3300005333 Ga0070677_10008202 Ga0070677_100082022 320
368 3300005338 Ga0068868_100017855 Ga0068868_1000178552 320
369 3300005338 Ga0068868_100036397 Ga0068868_1000363972 320
370 3300005353 Ga0070669_100005697 Ga0070669_1000056974 320
371 3300005354 Ga0070675_100004610 Ga0070675_1000046102 320
372 3300005355 Ga0070671_100009192 Ga0070671_1000091922 320
373 3300005355 Ga0070671_100099197 Ga0070671_1000991973 320
374 3300005355 Ga0070671_100178409 Ga0070671_1001784091 320
375 3300005356 Ga0070674_100002594 Ga0070674_1000025942 320
376 3300005364 Ga0070673_100001378 Ga0070673_1000013789 320
377 3300005367 Ga0070667_100019766 Ga0070667_1000197662 320
378 3300005367 Ga0070667_100150437 Ga0070667_1001504372 320
379 3300005456 Ga0070678_100014203 Ga0070678_1000142036 320
380 3300005459 Ga0068867_100008289 Ga0068867_1000082894 320
381 3300005466 Ga0070685_10082185 Ga0070685_100821853 320
382 3300005543 Ga0070672_100002067 Ga0070672_1000020672 320
383 3300005564 Ga0070664_100239913 Ga0070664_1002399132 320
384 3300005719 Ga0068861_100191067 Ga0068861_1001910672 320
385 3300005719 Ga0068861_100456696 Ga0068861_1004566961 320
386 3300006237 Ga0097621_100019133 Ga0097621_1000191335 320
387 3300006358 Ga0068871_100085884 Ga0068871_1000858844 320
388 3300013306 Ga0163162_10452391 Ga0163162_104523911 320
389 3300013308 Ga0157375_10158241 Ga0157375_101582412 320
390 3300025315 Ga0207697_10030149 Ga0207697_100301491 320
391 3300025893 Ga0207682_10003776 Ga0207682_100037762 320
392 3300025901 Ga0207688_10038436 Ga0207688_100384362 320
393 3300025907 Ga0207645_10002674 Ga0207645_100026743 320
394 3300025907 Ga0207645_10032065 Ga0207645_100320652 320
395 3300025923 Ga0207681_10205214 Ga0207681_102052142 320
396 3300025925 Ga0207650_10000607 Ga0207650_1000060719 320
397 3300025926 Ga0207659_10010197 Ga0207659_100101978 320
398 3300025931 Ga0207644_10006212 Ga0207644_100062124 320
399 3300025933 Ga0207706_10110606 Ga0207706_101106062 320
400 3300025937 Ga0207669_10007987 Ga0207669_100079876 320
401 3300025940 Ga0207691_10027921 Ga0207691_100279212 320
402 3300025945 Ga0207679_10331027 Ga0207679_103310271 320
403 3300025960 Ga0207651_10121929 Ga0207651_101219291 320
404 3300025986 Ga0207658_10038948 Ga0207658_100389481 320
405 3300026023 Ga0207677_10025004 Ga0207677_100250043 320
406 3300026023 Ga0207677_10110132 Ga0207677_101101322 320
407 3300026089 Ga0207648_10002224 Ga0207648_1000222418 320
408 3300026121 Ga0207683_10022096 Ga0207683_100220962 320
409 3300028794 Ga0307515_10000093 Ga0307515_10000093143 320
410 3300042876 Ga0451577_0001779 Ga0451577_0001779_7475_8440 320
411 3300044712 Ga0453684_0109703 Ga0453684_0109703_616_1590 320
412 3300044712 Ga0453684_0492093 Ga0453684_0492093_22_987 320
413 3300053117 Ga0500593_000105 Ga0500593_000105_17905_18873 320
414 iso_pu_bacteria 2887375801 2887378613 320
415 iso_pu_bacteria 2904479285 2904481581 320
416 iso_pu_bacteria 2939631187 2939634579 320
417 3300004625 Ga0055543_1003908 Ga0055543_10039083 321
418 3300005262 Ga0065165_1000070 Ga0065165_100007024 321
419 3300005330 Ga0070690_100010503 Ga0070690_1000105032 321
420 3300005344 Ga0070661_100134284 Ga0070661_1001342841 321
421 3300005354 Ga0070675_100000052 Ga0070675_10000005260 321
422 3300005355 Ga0070671_100002160 Ga0070671_10000216010 321
423 3300005355 Ga0070671_100004178 Ga0070671_10000417812 321
424 3300005364 Ga0070673_100002903 Ga0070673_1000029039 321
425 3300005367 Ga0070667_100008684 Ga0070667_1000086847 321
426 3300005456 Ga0070678_100001959 Ga0070678_1000019593 321
427 3300005456 Ga0070678_100023602 Ga0070678_1000236026 321
428 3300005457 Ga0070662_100226577 Ga0070662_1002265772 321
429 3300005543 Ga0070672_100069623 Ga0070672_1000696233 321
430 3300005543 Ga0070672_100129652 Ga0070672_1001296522 321
431 3300005564 Ga0070664_100292148 Ga0070664_1002921482 321
432 3300005564 Ga0070664_100370049 Ga0070664_1003700492 321
433 3300005616 Ga0068852_100059698 Ga0068852_1000596983 321
434 3300005617 Ga0068859_100003350 Ga0068859_10000335014 321
435 3300005618 Ga0068864_100001554 Ga0068864_10000155414 321
436 3300005618 Ga0068864_100058425 Ga0068864_1000584252 321
437 3300005841 Ga0068863_100022688 Ga0068863_1000226885 321
438 3300005841 Ga0068863_100119647 Ga0068863_1001196472 321
439 3300005842 Ga0068858_100000312 Ga0068858_10000031241 321
440 3300005843 Ga0068860_100146699 Ga0068860_1001466992 321
441 3300005844 Ga0068862_100163476 Ga0068862_1001634762 321
442 3300006237 Ga0097621_100008733 Ga0097621_1000087337 321
443 3300006358 Ga0068871_100018365 Ga0068871_1000183654 321
444 3300006358 Ga0068871_100103369 Ga0068871_1001033693 321
445 3300006881 Ga0068865_100145248 Ga0068865_1001452482 321
446 3300006931 Ga0097620_100003350 Ga0097620_1000033503 321
447 3300009148 Ga0105243_10142115 Ga0105243_101421152 321
448 3300009177 Ga0105248_10027348 Ga0105248_100273484 321
449 3300009177 Ga0105248_10030539 Ga0105248_100305393 321
450 3300009553 Ga0105249_10218057 Ga0105249_102180572 321
451 3300013306 Ga0163162_10006102 Ga0163162_100061022 321
452 3300013306 Ga0163162_10075932 Ga0163162_100759322 321
453 3300013308 Ga0157375_10015559 Ga0157375_100155596 321
454 3300013308 Ga0157375_10156756 Ga0157375_101567562 321
455 3300014325 Ga0163163_10001116 Ga0163163_100011165 321
456 3300014326 Ga0157380_10153291 Ga0157380_101532912 321
457 3300014968 Ga0157379_10001049 Ga0157379_100010494 321
458 3300014969 Ga0157376_10225779 Ga0157376_102257792 321
459 3300014969 Ga0157376_10468482 Ga0157376_104684821 321
460 3300017792 Ga0163161_10074296 Ga0163161_100742962 321
461 3300017792 Ga0163161_10138744 Ga0163161_101387442 321
462 3300021384 Ga0213876_10095183 Ga0213876_100951832 321
463 3300025893 Ga0207682_10013152 Ga0207682_100131522 321
464 3300025893 Ga0207682_10014181 Ga0207682_100141812 321
465 3300025903 Ga0207680_10007400 Ga0207680_100074002 321
466 3300025908 Ga0207643_10172821 Ga0207643_101728212 321
467 3300025920 Ga0207649_10023906 Ga0207649_100239063 321
468 3300025926 Ga0207659_10001135 Ga0207659_100011359 321
469 3300025926 Ga0207659_10337391 Ga0207659_103373911 321
470 3300025931 Ga0207644_10000068 Ga0207644_100000686 321
471 3300025931 Ga0207644_10015138 Ga0207644_100151385 321
472 3300025931 Ga0207644_10223476 Ga0207644_102234762 321
473 3300025934 Ga0207686_10048515 Ga0207686_100485153 321
474 3300025935 Ga0207709_10096362 Ga0207709_100963622 321
475 3300025937 Ga0207669_10024078 Ga0207669_100240783 321
476 3300025938 Ga0207704_10013736 Ga0207704_100137363 321
477 3300025940 Ga0207691_10016137 Ga0207691_100161378 321
478 3300025940 Ga0207691_10038231 Ga0207691_100382314 321
479 3300025940 Ga0207691_10094816 Ga0207691_100948163 321
480 3300025940 Ga0207691_10120204 Ga0207691_101202042 321
481 3300025941 Ga0207711_10001139 Ga0207711_100011394 321
482 3300025941 Ga0207711_10021411 Ga0207711_100214115 321
483 3300025941 Ga0207711_10022560 Ga0207711_100225604 321
484 3300025942 Ga0207689_10009709 Ga0207689_100097097 321
485 3300025945 Ga0207679_10229330 Ga0207679_102293301 321
486 3300025960 Ga0207651_10002585 Ga0207651_100025855 321
487 3300025961 Ga0207712_10041969 Ga0207712_100419691 321
488 3300025986 Ga0207658_10010568 Ga0207658_100105685 321
489 3300026023 Ga0207677_10009225 Ga0207677_100092253 321
490 3300026035 Ga0207703_10001098 Ga0207703_100010983 321
491 3300026067 Ga0207678_10276783 Ga0207678_102767832 321
492 3300026088 Ga0207641_10091865 Ga0207641_100918653 321
493 3300026088 Ga0207641_10220504 Ga0207641_102205042 321
494 3300026089 Ga0207648_10074027 Ga0207648_100740271 321
495 3300026095 Ga0207676_10000082 Ga0207676_1000008291 321
496 3300026095 Ga0207676_10025670 Ga0207676_100256702 321
497 3300026118 Ga0207675_100018142 Ga0207675_1000181422 321
498 3300026121 Ga0207683_10002265 Ga0207683_100022658 321
499 3300028380 Ga0268265_10013044 Ga0268265_100130445 321
500 3300028786 Ga0307517_10000005 Ga0307517_1000000522 321
501 3300030522 Ga0307512_10031215 Ga0307512_100312154 321
502 3300031507 Ga0307509_10097966 Ga0307509_100979662 321
503 3300031548 Ga0307408_100067102 Ga0307408_1000671023 321
504 3300031712 Ga0265342_10057039 Ga0265342_100570391 321
505 3300031730 Ga0307516_10249434 Ga0307516_102494341 321
506 3300031911 Ga0307412_10237233 Ga0307412_102372332 321
507 3300032005 Ga0307411_10045359 Ga0307411_100453593 321
508 3300037466 Ga0395898_0081559 Ga0395898_0081559_1944_2912 321
509 3300037471 Ga0395905_0035908 Ga0395905_0035908_946_1914 321
510 3300037471 Ga0395905_0174495 Ga0395905_0174495_40_1008 321
511 3300039437 Ga0436365_0414269 Ga0436365_0414269_309_1277 321
512 3300042439 Ga0439464_0000405 Ga0439464_0000405_3256_4224 321
513 3300045051 Ga0451576_0130661 Ga0451576_0130661_1540_2508 321
514 3300046460 Ga0495638_0096306 Ga0495638_0096306_745_1713 321
515 3300046471 Ga0495650_0002530 Ga0495650_0002530_427_1398 321
516 3300046543 Ga0495645_0042546 Ga0495645_0042546_1885_2853 321
517 3300048911 Ga0496108_0214499 Ga0496108_0214499_283_1251 321
518 3300053156 Ga0500622_0005368 Ga0500622_0005368_663_1637 321
519 3300005288 Ga0065714_10108763 Ga0065714_101087632 322
520 3300005335 Ga0070666_10040956 Ga0070666_100409562 322
521 3300005355 Ga0070671_100150253 Ga0070671_1001502532 322
522 3300006237 Ga0097621_100475561 Ga0097621_1004755611 322
523 3300006353 Ga0075370_10081549 Ga0075370_100815491 322
524 3300009553 Ga0105249_10432899 Ga0105249_104328992 322
525 3300013306 Ga0163162_10062486 Ga0163162_100624862 322
526 3300025294 Ga0209025_1000029 Ga0209025_1000029134 322
527 3300025903 Ga0207680_10149642 Ga0207680_101496422 322
528 3300025931 Ga0207644_10081292 Ga0207644_100812922 322
529 3300025986 Ga0207658_10067375 Ga0207658_100673752 322
530 3300026142 Ga0207698_10235875 Ga0207698_102358751 322
531 3300028379 Ga0268266_10434013 Ga0268266_104340131 322
532 3300031456 Ga0307513_10000104 Ga0307513_1000010417 322
533 3300031731 Ga0307405_10088871 Ga0307405_100888712 322
534 3300044719 Ga0466971_0097990 Ga0466971_0097990_87_1058 322
535 3300046475 Ga0495639_0002977 Ga0495639_0002977_3279_4250 322
536 3300046615 Ga0495656_0065696 Ga0495656_0065696_336_1307 322
537 3300047472 Ga0495686_0166145 Ga0495686_0166145_274_1245 322
538 3300048903 Ga0496100_0012091 Ga0496100_0012091_3800_4771 322
539 3300048905 Ga0496102_0006139 Ga0496102_0006139_1150_2121 322
540 3300048906 Ga0496103_0072138 Ga0496103_0072138_569_1540 322
541 3300048907 Ga0496104_0019273 Ga0496104_0019273_2646_3617 322
542 3300048908 Ga0496105_0006380 Ga0496105_0006380_3021_3992 322
543 3300048909 Ga0496106_0052011 Ga0496106_0052011_70_1041 322
544 3300048911 Ga0496108_0068716 Ga0496108_0068716_1569_2540 322
545 3300048912 Ga0496109_0051998 Ga0496109_0051998_938_1909 322
546 3300048912 Ga0496109_0092837 Ga0496109_0092837_747_1718 322
547 3300048913 Ga0496110_0019162 Ga0496110_0019162_1451_2422 322
548 3300048913 Ga0496110_0447083 Ga0496110_0447083_167_1138 322
549 3300053083 Ga0495655_0007348 Ga0495655_0007348_588_1583 322
550 3300053086 Ga0500578_0029960 Ga0500578_0029960_1818_2789 322
551 3300053088 Ga0500644_0000705 Ga0500644_0000705_1431_2405 322
552 3300053129 Ga0500628_000488 Ga0500628_000488_5930_6901 322
553 3300053154 Ga0500619_000183 Ga0500619_000183_8900_9883 322
554 3300053730 Ga0500645_006124 Ga0500645_006124_361_1332 322
555 iso_pu_bacteria 2855730933 2855732943 322
556 iso_pu_bacteria 2855767633 2855771695 322
557 iso_pu_bacteria 2881412998 2881415749 322
558 3300006051 Ga0075364_10010318 Ga0075364_100103184 324
559 3300048924 Ga0496121_0007783 Ga0496121_0007783_6037_7011 324
560 3300049570 Ga0501033_0028411 Ga0501033_0028411_1731_2705 324
561 3300049572 Ga0501036_0100773 Ga0501036_0100773_1407_2381 324
562 3300049575 Ga0501039_0067537 Ga0501039_0067537_64_1038 324
563 3300049581 Ga0501047_0006267 Ga0501047_0006267_8412_9386 324
564 3300049822 Ga0501035_0018114 Ga0501035_0018114_1570_2544 324
565 3300049822 Ga0501035_0282103 Ga0501035_0282103_24_998 324
566 3300049823 Ga0501044_0001968 Ga0501044_0001968_7242_8216 324
567 3300003187 JGI25151J46595_10000744 JGI25151J46595_100007448 326
568 3300025294 Ga0209025_1000019 Ga0209025_1000019238 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

83

356

0.98

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

4

90

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9498 30 325
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9467 30 325
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9448 32 322
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9419 29 325
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9417 32 322
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9436 128 248 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9387 128 251 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9288 128 243 3.40.190.10
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9244 28 319 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9238 128 251 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6N0JW53-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9656 25 325
AF-A0A4Q5V568-F1-model_v4 deleted 0.9646 83 325
AF-A0A536SS29-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9636 37 325
AF-A0A1G8FVB9-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9631 25 325
AF-A0A375FQQ0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9621 66 323

Feature Viewer

pLDDT pTM Quality
91.03 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map