F464608

General Info

Members Datasets Scaffolds Average Seq Length
568 240 1136 457

Family's Representative Sequence

Representative Sequence 3300005615|Ga0070702_100096389|Ga0070702_1000963892
Length 508
Sequence VSSLCLCVLCVSVLKLKFVISITSSTQRRGEPRDTEIRKAIMNSNSGLSRRTFVKTALVGTVAASVDLSGFPSIVPSSVFGAYAPSNRVNIGAIGNGRISRGHDLPGVWRYDEARVMAVCDLDSKRAEDAKALVNDYYSKKTNTAYKGVTTYTDYRELLQNKDIDGVLISTPDHWHSIIGIDVAEAGKDAYLQKPASLTIAEGRALSNTVHRTGRIFQVGSQQRSTVQFRYAAELVRNGRIGQLKTVYVGLPADPAGDEEPEMPIPKNLNYEMWLGSTPYKYYTEKRVHPQNDYGRPGWLRCEQFGAGMITGWGSHHIDCAHWGMNTEYTGPIEVWGTAEFPKKGLWDVHGVFRTEALYANGVKMIVSTELPNGIKFEGSQGWIFVSRGNEQVTGSDPVAKLKDPQALAASDPKIITSVIGPQEIHLYESKEHHWNWIECVRTRSTPIAPIEIAHRSCTTCLIHQIAMKLKRKVYWDPQKEKFKNDDEANAMVSRSQRWPYVIEKHES

Samples

Sample ID Description Type Environment
1 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
155 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
156 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
182 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
183 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
240 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.58
Nodule 0
Rhizoplane 2.64
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070702_100096389 3300005615 Bacteria 1805
2 rootH1_10082082 3300003316 Bacteria 2443
3 rootH2_10029369 3300003320 Bacteria 6864
4 rootH1_10112609 3300003323 Bacteria 3137
5 rootH1_10179196 3300003323 Bacteria 3980
6 rootH1_10227810 3300003323 Unclassified 1606
7 JGI25160J50197_1000803 3300003354 Bacteria 16898
8 Ga0065712_10002818 3300005290 Bacteria 4802
9 Ga0065712_10005289 3300005290 Bacteria 6219
10 Ga0065712_10071595 3300005290 Bacteria 5167
11 Ga0065715_10006374 3300005293 Bacteria 3357
12 Ga0065715_10040717 3300005293 Bacteria 1655
13 Ga0065715_10128400 3300005293 Bacteria 2066
14 Ga0065707_10136119 3300005295 Bacteria 1839
15 Ga0070683_100000105 3300005329 Bacteria 54897
16 Ga0070683_100000158 3300005329 Bacteria 44374
17 Ga0070683_100038802 3300005329 Bacteria 4367
18 Ga0070683_100067785 3300005329 Unclassified 3324
19 Ga0070683_100244345 3300005329 Unclassified 1707
20 Ga0070690_100009849 3300005330 Bacteria 5546
21 Ga0070670_100005608 3300005331 Bacteria 10591
22 Ga0070670_100015115 3300005331 Bacteria 6625
23 Ga0068869_100000217 3300005334 Bacteria 29938
24 Ga0068869_100006034 3300005334 Bacteria 7665
25 Ga0068869_100120754 3300005334 Bacteria 2004
26 Ga0070666_10057199 3300005335 Bacteria 2635
27 Ga0070680_100020200 3300005336 Bacteria 5285
28 Ga0068868_100001487 3300005338 Bacteria 16175
29 Ga0068868_100019570 3300005338 Bacteria 5074
30 Ga0068868_100057282 3300005338 Bacteria 3078
31 Ga0070689_100081759 3300005340 Bacteria 2536
32 Ga0070687_100010219 3300005343 Bacteria 4048
33 Ga0070687_100019417 3300005343 Bacteria 3161
34 Ga0070687_100036972 3300005343 Bacteria 2437
35 Ga0070661_100003276 3300005344 Bacteria 11181
36 Ga0070661_100020553 3300005344 Bacteria 4710
37 Ga0070668_100013397 3300005347 Bacteria 6118
38 Ga0070669_100003903 3300005353 Bacteria 10787
39 Ga0070669_100011506 3300005353 Bacteria 6280
40 Ga0070669_100037893 3300005353 Bacteria 3498
41 Ga0070675_100028308 3300005354 Bacteria 4510
42 Ga0070675_100069716 3300005354 Bacteria 2913
43 Ga0070675_100144648 3300005354 Bacteria 2035
44 Ga0070675_100297380 3300005354 Unclassified 1421
45 Ga0070671_100002811 3300005355 Bacteria 13525
46 Ga0070671_100040124 3300005355 Bacteria 3887
47 Ga0070671_100211036 3300005355 Unclassified 1647
48 Ga0070674_100037082 3300005356 Bacteria 3277
49 Ga0070674_100044702 3300005356 Bacteria 3022
50 Ga0070673_100030681 3300005364 Bacteria 4028
51 Ga0070673_100119528 3300005364 Bacteria 2196
52 Ga0070673_100176633 3300005364 Bacteria 1826
53 Ga0070688_100010508 3300005365 Bacteria 5108
54 Ga0070659_100014478 3300005366 Bacteria 5894
55 Ga0070667_100002458 3300005367 Bacteria 16177
56 Ga0070667_100116120 3300005367 Bacteria 2325
57 Ga0070667_100120797 3300005367 Bacteria 2279
58 Ga0070701_10030937 3300005438 Bacteria 2652
59 Ga0070705_100010084 3300005440 Bacteria 4718
60 Ga0070700_100018850 3300005441 Bacteria 3974
61 Ga0070694_100095550 3300005444 Bacteria 2093
62 Ga0070694_100106710 3300005444 Bacteria 1989
63 Ga0070708_100167428 3300005445 Bacteria 2050
64 Ga0070663_100103352 3300005455 Bacteria 2130
65 Ga0070662_100007705 3300005457 Bacteria 6988
66 Ga0070681_10009641 3300005458 Bacteria 9497
67 Ga0070681_10012279 3300005458 Bacteria 8496
68 Ga0070681_10056744 3300005458 Bacteria 3897
69 Ga0070681_10114661 3300005458 Bacteria 2633
70 Ga0068867_100007645 3300005459 Bacteria 7647
71 Ga0068867_100029973 3300005459 Bacteria 3923
72 Ga0068867_100045154 3300005459 Bacteria 3230
73 Ga0068867_100079628 3300005459 Bacteria 2466
74 Ga0068867_100083612 3300005459 Bacteria 2410
75 Ga0068867_100085298 3300005459 Bacteria 2387
76 Ga0070685_10006631 3300005466 Bacteria 5908
77 Ga0070685_10030621 3300005466 Bacteria 3000
78 Ga0070707_100009185 3300005468 Bacteria 9172
79 Ga0070707_100166284 3300005468 Unclassified 2150
80 Ga0070698_100002438 3300005471 Bacteria 20505
81 Ga0070698_100017528 3300005471 Bacteria 7547
82 Ga0070684_100000161 3300005535 Bacteria 45787
83 Ga0070684_100077796 3300005535 Unclassified 2930
84 Ga0070684_100106690 3300005535 Bacteria 2508
85 Ga0068853_100018177 3300005539 Bacteria 5815
86 Ga0068853_100028452 3300005539 Unclassified 4701
87 Ga0068853_100217832 3300005539 Bacteria 1742
88 Ga0070672_100013177 3300005543 Bacteria 5831
89 Ga0070665_100101744 3300005548 Bacteria 2877
90 Ga0070704_100020406 3300005549 Bacteria 4272
91 Ga0068855_100000255 3300005563 Bacteria 67204
92 Ga0068855_100041026 3300005563 Bacteria 5488
93 Ga0068855_100142622 3300005563 Bacteria 2729
94 Ga0070664_100003916 3300005564 Bacteria 12014
95 Ga0070664_100004441 3300005564 Bacteria 11265
96 Ga0070664_100096017 3300005564 Bacteria 2572
97 Ga0070664_100101875 3300005564 Bacteria 2497
98 Ga0070664_100177156 3300005564 Bacteria 1893
99 Ga0068857_100000590 3300005577 Bacteria 26594
100 Ga0068857_100002496 3300005577 Bacteria 15042
101 Ga0068857_100218099 3300005577 Unclassified 1742
102 Ga0068854_100046614 3300005578 Bacteria 3086
103 Ga0068856_100002932 3300005614 Bacteria 17472
104 Ga0068856_100022829 3300005614 Bacteria 6085
105 Ga0068856_100182612 3300005614 Bacteria 2111
106 Ga0070702_100005558 3300005615 Bacteria 5889
107 Ga0068852_100000004 3300005616 Bacteria 179746
108 Ga0068852_100015738 3300005616 Bacteria 5879
109 Ga0068852_100303198 3300005616 Bacteria 1547
110 Ga0068859_100008646 3300005617 Bacteria 10289
111 Ga0068859_100037067 3300005617 Unclassified 4894
112 Ga0068859_100043172 3300005617 Bacteria 4531
113 Ga0068859_100048041 3300005617 Bacteria 4287
114 Ga0068859_100060505 3300005617 Bacteria 3816
115 Ga0068859_100234523 3300005617 Bacteria 1923
116 Ga0068864_100000524 3300005618 Bacteria 33081
117 Ga0068864_100003605 3300005618 Bacteria 12802
118 Ga0068864_100209085 3300005618 Unclassified 1796
119 Ga0068866_10011061 3300005718 Bacteria 3890
120 Ga0068866_10025232 3300005718 Bacteria 2792
121 Ga0068861_100047975 3300005719 Bacteria 3226
122 Ga0068861_100169184 3300005719 Bacteria 1810
123 Ga0068851_10006499 3300005834 Bacteria 5338
124 Ga0068851_10079502 3300005834 Bacteria 1710
125 Ga0068863_100000589 3300005841 Bacteria 37008
126 Ga0068863_100006897 3300005841 Bacteria 11130
127 Ga0068863_100029012 3300005841 Bacteria 5285
128 Ga0068863_100034452 3300005841 Unclassified 4823
129 Ga0068863_100112045 3300005841 Bacteria 2598
130 Ga0068858_100001558 3300005842 Bacteria 23497
131 Ga0068858_100003853 3300005842 Bacteria 14829
132 Ga0068858_100015302 3300005842 Bacteria 7216
133 Ga0068858_100041822 3300005842 Bacteria 4248
134 Ga0068858_100300367 3300005842 Bacteria 1532
135 Ga0068860_100000853 3300005843 Bacteria 34017
136 Ga0068860_100015963 3300005843 Bacteria 7330
137 Ga0068860_100018171 3300005843 Bacteria 6844
138 Ga0068860_100027208 3300005843 Bacteria 5509
139 Ga0068860_100106642 3300005843 Bacteria 2676
140 Ga0068862_100002335 3300005844 Bacteria 16891
141 Ga0068862_100010649 3300005844 Bacteria 7597
142 Ga0068862_100019692 3300005844 Bacteria 5634
143 Ga0068862_100022598 3300005844 Bacteria 5262
144 Ga0068862_100073120 3300005844 Unclassified 2963
145 Ga0075363_100026528 3300006048 Bacteria 2965
146 Ga0075364_10005334 3300006051 Bacteria 7462
147 Ga0075364_10006334 3300006051 Bacteria 6955
148 Ga0075362_10005678 3300006177 Bacteria 4589
149 Ga0075367_10013353 3300006178 Bacteria 4413
150 Ga0075367_10022946 3300006178 Unclassified 3506
151 Ga0075367_10090390 3300006178 Bacteria 1862
152 Ga0075366_10000797 3300006195 Bacteria 15090
153 Ga0075366_10010913 3300006195 Bacteria 5113
154 Ga0097621_100002564 3300006237 Bacteria 12447
155 Ga0097621_100040853 3300006237 Bacteria 3730
156 Ga0075370_10094529 3300006353 Bacteria 1726
157 Ga0068871_100000735 3300006358 Bacteria 22253
158 Ga0068871_100005931 3300006358 Bacteria 8600
159 Ga0068871_100082725 3300006358 Bacteria 2662
160 Ga0068871_100093233 3300006358 Bacteria 2512
161 Ga0075428_100034208 3300006844 Bacteria 5607
162 Ga0075428_100052592 3300006844 Bacteria 4463
163 Ga0075428_100077352 3300006844 Bacteria 3632
164 Ga0075430_100105141 3300006846 Bacteria 2356
165 Ga0075430_100144387 3300006846 Bacteria 1982
166 Ga0075431_100006291 3300006847 Bacteria 11797
167 Ga0075431_100129183 3300006847 Bacteria 2607
168 Ga0075433_10003415 3300006852 Bacteria 12264
169 Ga0075433_10161992 3300006852 Bacteria 1991
170 Ga0075434_100101218 3300006871 Bacteria 2888
171 Ga0075434_100189538 3300006871 Bacteria 2077
172 Ga0075429_100133843 3300006880 Bacteria 2169
173 Ga0068865_100016075 3300006881 Bacteria 4779
174 Ga0097620_100008646 3300006931 Bacteria 10289
175 Ga0097620_100037064 3300006931 Unclassified 4894
176 Ga0097620_100043172 3300006931 Bacteria 4531
177 Ga0097620_100048042 3300006931 Bacteria 4287
178 Ga0097620_100060496 3300006931 Bacteria 3816
179 Ga0097620_100234519 3300006931 Bacteria 1923
180 Ga0105240_10000111 3300009093 Bacteria 171005
181 Ga0105240_10000147 3300009093 Bacteria 142340
182 Ga0105240_10000168 3300009093 Bacteria 133212
183 Ga0105240_10002651 3300009093 Bacteria 28481
184 Ga0105240_10084119 3300009093 Bacteria 3902
185 Ga0105240_10095403 3300009093 Bacteria 3626
186 Ga0111539_10000396 3300009094 Bacteria 54075
187 Ga0111539_10003108 3300009094 Bacteria 22003
188 Ga0111539_10007675 3300009094 Bacteria 13782
189 Ga0111539_10008255 3300009094 Bacteria 13255
190 Ga0111539_10010885 3300009094 Bacteria 11448
191 Ga0111539_10061004 3300009094 Bacteria 4468
192 Ga0111539_10106709 3300009094 Bacteria 3286
193 Ga0105245_10000769 3300009098 Bacteria 29064
194 Ga0105245_10017566 3300009098 Bacteria 6244
195 Ga0105245_10235603 3300009098 Bacteria 1772
196 Ga0105247_10000309 3300009101 Bacteria 43841
197 Ga0114129_10005003 3300009147 Bacteria 18665
198 Ga0114129_10006205 3300009147 Bacteria 16952
199 Ga0114129_10006598 3300009147 Bacteria 16471
200 Ga0114129_10010903 3300009147 Bacteria 12947
201 Ga0114129_10024463 3300009147 Bacteria 8556
202 Ga0114129_10025616 3300009147 Bacteria 8355
203 Ga0114129_10182340 3300009147 Bacteria 2856
204 Ga0114129_10277015 3300009147 Bacteria 2242
205 Ga0105243_10016839 3300009148 Bacteria 5525
206 Ga0105243_10077303 3300009148 Bacteria 2707
207 Ga0105243_10100199 3300009148 Bacteria 2403
208 Ga0105243_10188034 3300009148 Unclassified 1801
209 Ga0105241_10000633 3300009174 Bacteria 26500
210 Ga0105241_10114358 3300009174 Bacteria 2165
211 Ga0105242_10029870 3300009176 Bacteria 4350
212 Ga0105242_10040950 3300009176 Bacteria 3734
213 Ga0105242_10121909 3300009176 Unclassified 2239
214 Ga0105248_10012483 3300009177 Bacteria 9372
215 Ga0105248_10083861 3300009177 Bacteria 3585
216 Ga0105248_10100981 3300009177 Bacteria 3251
217 Ga0105248_10315146 3300009177 Bacteria 1762
218 Ga0105248_10365270 3300009177 Bacteria 1625
219 Ga0105237_10001214 3300009545 Bacteria 34431
220 Ga0105237_10002839 3300009545 Bacteria 21072
221 Ga0105237_10021103 3300009545 Bacteria 6700
222 Ga0105237_10036386 3300009545 Bacteria 4981
223 Ga0105237_10086556 3300009545 Bacteria 3123
224 Ga0105238_10000631 3300009551 Bacteria 37036
225 Ga0105238_10005541 3300009551 Bacteria 12467
226 Ga0105238_10019836 3300009551 Bacteria 6843
227 Ga0105238_10022560 3300009551 Bacteria 6416
228 Ga0105238_10027038 3300009551 Bacteria 5848
229 Ga0105238_10128185 3300009551 Bacteria 2516
230 Ga0105249_10001151 3300009553 Bacteria 23409
231 Ga0105249_10035404 3300009553 Bacteria 4529
232 Ga0105249_10081438 3300009553 Bacteria 3009
233 Ga0105249_10116902 3300009553 Bacteria 2529
234 Ga0105239_10000981 3300010375 Bacteria 40055
235 Ga0105239_10005827 3300010375 Bacteria 14367
236 Ga0105239_10011615 3300010375 Bacteria 9826
237 Ga0105239_10026376 3300010375 Bacteria 6395
238 Ga0105239_10097784 3300010375 Bacteria 3244
239 Ga0105239_10346696 3300010375 Bacteria 1677
240 Ga0105239_10348765 3300010375 Bacteria 1671
241 Ga0105246_10001302 3300011119 Bacteria 14655
242 Ga0157370_10000016 3300013104 Bacteria 179999
243 Ga0157370_10085087 3300013104 Bacteria 2970
244 Ga0157369_10000010 3300013105 Bacteria 273443
245 Ga0157369_10001496 3300013105 Bacteria 28650
246 Ga0157369_10023922 3300013105 Bacteria 6800
247 Ga0157369_10044419 3300013105 Bacteria 4837
248 Ga0157369_10318345 3300013105 Bacteria 1617
249 Ga0157374_10001075 3300013296 Bacteria 23658
250 Ga0157374_10031799 3300013296 Unclassified 4800
251 Ga0157374_10038936 3300013296 Bacteria 4372
252 Ga0157378_10000101 3300013297 Bacteria 80972
253 Ga0157378_10002149 3300013297 Bacteria 17505
254 Ga0157378_10021561 3300013297 Bacteria 5667
255 Ga0157378_10038484 3300013297 Bacteria 4239
256 Ga0157378_10098740 3300013297 Bacteria 2663
257 Ga0163162_10001816 3300013306 Bacteria 20061
258 Ga0163162_10010134 3300013306 Bacteria 9160
259 Ga0163162_10010268 3300013306 Bacteria 9098
260 Ga0163162_10127897 3300013306 Bacteria 2648
261 Ga0157372_10000036 3300013307 Bacteria 172504
262 Ga0157372_10003462 3300013307 Bacteria 17030
263 Ga0157372_10008962 3300013307 Bacteria 10633
264 Ga0157372_10018756 3300013307 Bacteria 7444
265 Ga0157372_10046076 3300013307 Bacteria 4839
266 Ga0157372_10057629 3300013307 Bacteria 4342
267 Ga0157372_10153288 3300013307 Bacteria 2661
268 Ga0157375_10002123 3300013308 Bacteria 17125
269 Ga0157375_10038575 3300013308 Bacteria 4587
270 Ga0157375_10116345 3300013308 Bacteria 2778
271 Ga0163163_10001254 3300014325 Bacteria 21395
272 Ga0163163_10004806 3300014325 Bacteria 11601
273 Ga0163163_10008092 3300014325 Bacteria 9315
274 Ga0163163_10091032 3300014325 Bacteria 3064
275 Ga0163163_10160444 3300014325 Bacteria 2294
276 Ga0163163_10333578 3300014325 Unclassified 1571
277 Ga0157380_10002434 3300014326 Bacteria 12542
278 Ga0157380_10007547 3300014326 Bacteria 7728
279 Ga0157380_10014883 3300014326 Bacteria 5702
280 Ga0157380_10057171 3300014326 Bacteria 3105
281 Ga0157377_10005996 3300014745 Bacteria 5757
282 Ga0157377_10023544 3300014745 Bacteria 3265
283 Ga0157379_10000549 3300014968 Bacteria 30325
284 Ga0157379_10075214 3300014968 Bacteria 3024
285 Ga0157376_10001719 3300014969 Bacteria 14556
286 Ga0213875_10049276 3300021388 Bacteria 1975
287 Ga0207426_1000019 3300025302 Bacteria 558579
288 Ga0207697_10001088 3300025315 Bacteria 14992
289 Ga0207697_10043783 3300025315 Bacteria 1840
290 Ga0207710_10000259 3300025900 Bacteria 43990
291 Ga0207688_10023657 3300025901 Bacteria 3366
292 Ga0207647_10004164 3300025904 Bacteria 10728
293 Ga0207645_10095219 3300025907 Bacteria 1917
294 Ga0207684_10068710 3300025910 Bacteria 3011
295 Ga0207654_10003407 3300025911 Bacteria 8036
296 Ga0207707_10052311 3300025912 Bacteria 3556
297 Ga0207695_10000023 3300025913 Bacteria 657903
298 Ga0207695_10000031 3300025913 Bacteria 526801
299 Ga0207695_10000050 3300025913 Bacteria 405727
300 Ga0207695_10010236 3300025913 Bacteria 11499
301 Ga0207695_10018280 3300025913 Bacteria 8111
302 Ga0207695_10191227 3300025913 Unclassified 1964
303 Ga0207671_10001384 3300025914 Bacteria 28203
304 Ga0207671_10003377 3300025914 Bacteria 15979
305 Ga0207660_10038474 3300025917 Unclassified 3340
306 Ga0207662_10016675 3300025918 Bacteria 4148
307 Ga0207662_10023019 3300025918 Bacteria 3576
308 Ga0207662_10028785 3300025918 Bacteria 3214
309 Ga0207649_10058977 3300025920 Bacteria 2406
310 Ga0207649_10072538 3300025920 Unclassified 2203
311 Ga0207649_10153884 3300025920 Unclassified 1587
312 Ga0207646_10010583 3300025922 Bacteria 8993
313 Ga0207646_10022837 3300025922 Bacteria 5752
314 Ga0207681_10004517 3300025923 Bacteria 8571
315 Ga0207681_10015928 3300025923 Bacteria 4694
316 Ga0207694_10000965 3300025924 Bacteria 25347
317 Ga0207650_10001984 3300025925 Bacteria 14346
318 Ga0207650_10055614 3300025925 Bacteria 2938
319 Ga0207650_10084636 3300025925 Bacteria 2411
320 Ga0207659_10028372 3300025926 Bacteria 3803
321 Ga0207687_10002774 3300025927 Bacteria 11882
322 Ga0207687_10095928 3300025927 Bacteria 2173
323 Ga0207644_10076692 3300025931 Bacteria 2460
324 Ga0207706_10074622 3300025933 Bacteria 2982
325 Ga0207686_10000562 3300025934 Bacteria 23714
326 Ga0207709_10059516 3300025935 Bacteria 2378
327 Ga0207669_10018214 3300025937 Bacteria 3624
328 Ga0207669_10100072 3300025937 Bacteria 1914
329 Ga0207691_10006696 3300025940 Bacteria 11114
330 Ga0207691_10039806 3300025940 Bacteria 4347
331 Ga0207691_10191992 3300025940 Bacteria 1781
332 Ga0207691_10275968 3300025940 Bacteria 1447
333 Ga0207711_10232961 3300025941 Bacteria 1687
334 Ga0207689_10001335 3300025942 Bacteria 23803
335 Ga0207689_10001408 3300025942 Bacteria 22963
336 Ga0207689_10005389 3300025942 Bacteria 11449
337 Ga0207689_10030118 3300025942 Bacteria 4523
338 Ga0207689_10082055 3300025942 Bacteria 2650
339 Ga0207689_10099387 3300025942 Bacteria 2391
340 Ga0207689_10186971 3300025942 Bacteria 1708
341 Ga0207661_10002706 3300025944 Bacteria 12195
342 Ga0207661_10035663 3300025944 Bacteria 3878
343 Ga0207661_10054648 3300025944 Unclassified 3200
344 Ga0207661_10094875 3300025944 Bacteria 2493
345 Ga0207661_10241857 3300025944 Bacteria 1602
346 Ga0207679_10028575 3300025945 Unclassified 3872
347 Ga0207667_10002277 3300025949 Bacteria 24132
348 Ga0207667_10012231 3300025949 Bacteria 9911
349 Ga0207712_10002269 3300025961 Bacteria 12477
350 Ga0207712_10004347 3300025961 Bacteria 8953
351 Ga0207712_10038638 3300025961 Bacteria 3265
352 Ga0207712_10041344 3300025961 Bacteria 3168
353 Ga0207668_10050315 3300025972 Bacteria 2871
354 Ga0207668_10061266 3300025972 Bacteria 2645
355 Ga0207658_10002487 3300025986 Bacteria 13429
356 Ga0207658_10229646 3300025986 Bacteria 1566
357 Ga0207677_10000798 3300026023 Bacteria 18075
358 Ga0207677_10087700 3300026023 Bacteria 2253
359 Ga0207703_10017258 3300026035 Bacteria 5632
360 Ga0207703_10035602 3300026035 Bacteria 3956
361 Ga0207639_10009199 3300026041 Bacteria 6811
362 Ga0207639_10017630 3300026041 Bacteria 5063
363 Ga0207678_10005561 3300026067 Bacteria 11264
364 Ga0207678_10094545 3300026067 Bacteria 2554
365 Ga0207678_10115601 3300026067 Bacteria 2289
366 Ga0207708_10022392 3300026075 Bacteria 4772
367 Ga0207702_10005113 3300026078 Bacteria 11536
368 Ga0207641_10000854 3300026088 Bacteria 32297
369 Ga0207641_10001119 3300026088 Bacteria 26941
370 Ga0207641_10025861 3300026088 Bacteria 4841
371 Ga0207641_10032905 3300026088 Unclassified 4307
372 Ga0207641_10213859 3300026088 Bacteria 1784
373 Ga0207648_10010944 3300026089 Bacteria 8572
374 Ga0207648_10011647 3300026089 Bacteria 8278
375 Ga0207648_10038541 3300026089 Bacteria 4205
376 Ga0207648_10066270 3300026089 Bacteria 3149
377 Ga0207648_10106542 3300026089 Bacteria 2460
378 Ga0207648_10214324 3300026089 Unclassified 1710
379 Ga0207676_10003661 3300026095 Bacteria 10867
380 Ga0207676_10115248 3300026095 Bacteria 2256
381 Ga0207676_10131573 3300026095 Unclassified 2128
382 Ga0207674_10000385 3300026116 Bacteria 57430
383 Ga0207674_10001812 3300026116 Bacteria 27271
384 Ga0207674_10008178 3300026116 Bacteria 12125
385 Ga0207674_10141759 3300026116 Bacteria 2362
386 Ga0207674_10246966 3300026116 Bacteria 1732
387 Ga0207675_100000148 3300026118 Bacteria 61193
388 Ga0207675_100004972 3300026118 Bacteria 12807
389 Ga0207675_100069188 3300026118 Bacteria 3299
390 Ga0207675_100210737 3300026118 Bacteria 1869
391 Ga0207683_10049236 3300026121 Bacteria 3689
392 Ga0207683_10152350 3300026121 Bacteria 2087
393 Ga0207698_10000008 3300026142 Bacteria 281991
394 Ga0207698_10081563 3300026142 Bacteria 2611
395 Ga0207698_10180114 3300026142 Bacteria 1871
396 Ga0207698_10185871 3300026142 Bacteria 1846
397 Ga0207428_10000473 3300027907 Bacteria 48411
398 Ga0207428_10009969 3300027907 Bacteria 8505
399 Ga0207428_10021272 3300027907 Bacteria 5494
400 Ga0207428_10040767 3300027907 Bacteria 3762
401 Ga0207428_10059719 3300027907 Bacteria 3022
402 Ga0268266_10084372 3300028379 Bacteria 2774
403 Ga0268265_10006954 3300028380 Bacteria 7654
404 Ga0268265_10014954 3300028380 Bacteria 5299
405 Ga0268265_10037129 3300028380 Bacteria 3573
406 Ga0268265_10089240 3300028380 Unclassified 2458
407 Ga0268264_10005386 3300028381 Bacteria 10834
408 Ga0268264_10017387 3300028381 Bacteria 5890
409 Ga0268264_10035260 3300028381 Bacteria 4118
410 Ga0265334_10000863 3300028573 Bacteria 15178
411 Ga0265336_10013173 3300028666 Bacteria 2763
412 Ga0307517_10000914 3300028786 Bacteria 50058
413 Ga0307515_10000001 3300028794 Bacteria 4259510
414 Ga0265338_10004615 3300028800 Bacteria 18519
415 Ga0307511_10000808 3300030521 Bacteria 33418
416 Ga0265328_10015102 3300031239 Bacteria 3031
417 Ga0265320_10035051 3300031240 Bacteria 2547
418 Ga0265329_10028326 3300031242 Bacteria 1837
419 Ga0265327_10000411 3300031251 Bacteria 78751
420 Ga0265327_10018031 3300031251 Unclassified 4392
421 Ga0265316_10007944 3300031344 Bacteria 9925
422 Ga0307509_10048224 3300031507 Bacteria 4576
423 Ga0265314_10000139 3300031711 Bacteria 108861
424 Ga0265314_10070165 3300031711 Bacteria 2349
425 Ga0265342_10035307 3300031712 Bacteria 3061
426 Ga0265342_10106834 3300031712 Bacteria 1588
427 Ga0316576_10024262 3300031727 Unclassified 4233
428 Ga0316578_10014162 3300031728 Bacteria 4251
429 Ga0307516_10002011 3300031730 Bacteria 27743
430 Ga0316577_10004901 3300031733 Bacteria 6971
431 Ga0316577_10025995 3300031733 Unclassified 3257
432 Ga0307409_100033014 3300031995 Bacteria 3761
433 Ga0307414_10025093 3300032004 Unclassified 3811
434 Ga0316574_0071637 3300035398 Bacteria 2189
435 Ga0373947_0117051 3300035725 Bacteria 1690
436 Ga0373937_0020408 3300036401 Bacteria 5941
437 Ga0316584_0001101 3300036712 Bacteria 15813
438 Ga0316584_0001861 3300036712 Bacteria 13070
439 Ga0395905_0100247 3300037471 Bacteria 2720
440 Ga0436364_1289019 3300037853 Bacteria 4940
441 Ga0436361_0633601 3300039447 Bacteria 1843
442 Ga0439439_0016048 3300041406 Unclassified 1832
443 Ga0451837_1363558 3300041494 Bacteria 2469
444 Ga0439445_0017959 3300042004 Bacteria 1752
445 Ga0439446_0003181 3300042156 Bacteria 4045
446 Ga0439460_0023344 3300042461 Bacteria 1705
447 Ga0451577_0000376 3300042876 Bacteria 83261
448 Ga0451577_0000686 3300042876 Bacteria 53267
449 Ga0451577_0000830 3300042876 Bacteria 46227
450 Ga0451577_0000943 3300042876 Bacteria 42647
451 Ga0451577_0013794 3300042876 Bacteria 7552
452 Ga0451577_0070389 3300042876 Bacteria 3120
453 Ga0451577_0099068 3300042876 Bacteria 2603
454 Ga0451577_0184838 3300042876 Bacteria 1879
455 Ga0453683_0000022 3300044673 Bacteria 269593
456 Ga0453683_0000311 3300044673 Bacteria 61262
457 Ga0453683_0001481 3300044673 Bacteria 20127
458 Ga0453683_0004090 3300044673 Bacteria 10484
459 Ga0453683_0025717 3300044673 Bacteria 3737
460 Ga0453683_0061525 3300044673 Bacteria 2347
461 Ga0466963_0003167 3300044694 Bacteria 9346
462 Ga0453684_0001039 3300044712 Bacteria 88840
463 Ga0453684_0001137 3300044712 Bacteria 83152
464 Ga0453684_0001657 3300044712 Bacteria 60393
465 Ga0453684_0004806 3300044712 Bacteria 27804
466 Ga0453684_0007186 3300044712 Bacteria 20683
467 Ga0453684_0010058 3300044712 Bacteria 16264
468 Ga0453684_0016221 3300044712 Bacteria 11670
469 Ga0453684_0056613 3300044712 Bacteria 5084
470 Ga0453684_0080021 3300044712 Bacteria 4082
471 Ga0451576_0000835 3300045051 Bacteria 60014
472 Ga0451576_0001065 3300045051 Bacteria 50428
473 Ga0451576_0002014 3300045051 Bacteria 32125
474 Ga0451576_0002639 3300045051 Bacteria 26206
475 Ga0451576_0003658 3300045051 Bacteria 20876
476 Ga0451576_0003960 3300045051 Bacteria 19725
477 Ga0451576_0060283 3300045051 Unclassified 3959
478 Ga0451576_0205211 3300045051 Bacteria 2058
479 Ga0451576_0237365 3300045051 Bacteria 1904
480 Ga0495638_0075642 3300046460 Bacteria 2052
481 Ga0495594_0103428 3300046499 Bacteria 1603
482 Ga0495586_0001038 3300046535 Bacteria 15691
483 Ga0495634_0066316 3300046642 Bacteria 2390
484 Ga0495611_0000100 3300046648 Bacteria 59688
485 Ga0495670_0079220 3300046691 Bacteria 1672
486 Ga0495676_0119493 3300047321 Bacteria 1920
487 Ga0495686_0000018 3300047472 Bacteria 434962
488 Ga0496102_0013811 3300048905 Bacteria 7008
489 Ga0496102_0016997 3300048905 Bacteria 6367
490 Ga0496103_0020327 3300048906 Bacteria 3988
491 Ga0496104_0000520 3300048907 Bacteria 32906
492 Ga0496104_0013219 3300048907 Bacteria 7442
493 Ga0496105_0063225 3300048908 Unclassified 3054
494 Ga0496108_0004362 3300048911 Bacteria 11379
495 Ga0496108_0037899 3300048911 Bacteria 4017
496 Ga0496109_0022592 3300048912 Bacteria 5572
497 Ga0496109_0062152 3300048912 Bacteria 3415
498 Ga0496110_0000313 3300048913 Bacteria 32036
499 Ga0496110_0067826 3300048913 Bacteria 3157
500 Ga0496112_0001772 3300048915 Bacteria 16946
501 Ga0496112_0171658 3300048915 Bacteria 2133
502 Ga0496114_0142426 3300048917 Bacteria 2077
503 Ga0496126_0001766 3300048929 Bacteria 31999
504 Ga0496126_0009009 3300048929 Bacteria 10675
505 Ga0501031_0041731 3300049568 Bacteria 2996
506 Ga0501034_0084785 3300049571 Bacteria 3170
507 Ga0501036_0029921 3300049572 Bacteria 4602
508 Ga0501036_0033175 3300049572 Bacteria 4366
509 Ga0501042_0076817 3300049578 Bacteria 2391
510 Ga0501048_0011432 3300049582 Bacteria 6623
511 Ga0501071_0009711 3300049587 Bacteria 6421
512 Ga0501071_0081513 3300049587 Bacteria 2368
513 Ga0501072_0063408 3300049588 Bacteria 2915
514 Ga0501072_0087643 3300049588 Bacteria 2470
515 Ga0501072_0135111 3300049588 Unclassified 1966
516 Ga0501072_0288784 3300049588 Bacteria 1304
517 Ga0501075_0005982 3300049591 Bacteria 8333
518 Ga0501075_0021815 3300049591 Bacteria 4672
519 Ga0501075_0125268 3300049591 Bacteria 1956
520 Ga0501076_0013913 3300049592 Bacteria 6042
521 Ga0501076_0033945 3300049592 Bacteria 3985
522 Ga0501076_0034871 3300049592 Bacteria 3936
523 Ga0501076_0185437 3300049592 Bacteria 1697
524 Ga0501206_002526 3300049653 Bacteria 2307
525 Ga0501081_0095314 3300049743 Bacteria 2098
526 Ga0501045_0018937 3300049824 Bacteria 4902
527 nmdc:mga03683_8699_c1 3300050489 Bacteria 3579
528 nmdc:mga00v17_41133_c1 3300050491 Bacteria 2775
529 nmdc:mga0yw44_119144_c1 3300050492 Bacteria 1699
530 nmdc:mga0k408_20116_c1 3300050493 Bacteria 3735
531 nmdc:mga0k408_47950_c1 3300050493 Bacteria 2470
532 nmdc:mga0k408_70486_c1 3300050493 Bacteria 2040
533 nmdc:mga0k408_9621_c1 3300050493 Bacteria 5216
534 nmdc:mga06z11_57941_c1 3300050494 Bacteria 2008
535 nmdc:mga06z11_6939_c1 3300050494 Bacteria 4639
536 nmdc:mga07m45_66865_c1 3300050496 Bacteria 2042
537 nmdc:mga05p37_146940_c1 3300050507 Bacteria 2885
538 nmdc:mga05p37_1766_c1 3300050507 Bacteria 25251
539 nmdc:mga05p37_192122_c1 3300050507 Bacteria 2478
540 nmdc:mga05p37_238322_c1 3300050507 Bacteria 2189
541 nmdc:mga05p37_312570_c1 3300050507 Bacteria 1862
542 nmdc:mga05p37_7399_c1 3300050507 Bacteria 12955
543 nmdc:mga09592_13193_c1 3300050508 Bacteria 6745
544 nmdc:mga09592_44224_c1 3300050508 Bacteria 3748
545 nmdc:mga06r32_2424_c1 3300050510 Bacteria 16692
546 nmdc:mga06r32_30571_c1 3300050510 Bacteria 5054
547 nmdc:mga08y16_114373_c1 3300050511 Bacteria 2809
548 nmdc:mga08y16_13936_c1 3300050511 Bacteria 8462
549 nmdc:mga08y16_187698_c1 3300050511 Bacteria 2145
550 nmdc:mga08y16_26680_c1 3300050511 Bacteria 6088
551 nmdc:mga08y16_3358_c1 3300050511 Bacteria 16584
552 nmdc:mga08y16_33743_c1 3300050511 Bacteria 5375
553 nmdc:mga0n895_122504_c1 3300050512 Bacteria 2622
554 nmdc:mga0a205_20160_c1 3300050515 Bacteria 6290
555 nmdc:mga0a205_28166_c1 3300050515 Bacteria 5370
556 nmdc:mga0a205_40145_c1 3300050515 Bacteria 4505
557 Ga0500568_0023174 3300053139 Bacteria 2643
558 Ga0500616_0002741 3300053153 Bacteria 14266
559 Ga0500616_0053586 3300053153 Bacteria 2116
560 Ga0500622_0003659 3300053156 Bacteria 10098
561 Ga0501084_0146211 3300054114 Bacteria 1991
562 Ga0501084_0150770 3300054114 Bacteria 1960
563 Ga0501084_0152370 3300054114 Bacteria 1949
564 Ga0590071_000187 3300059421 Bacteria 18049
565 Ga0590075_000024 3300059424 Bacteria 40294
566 Ga0590075_007384 3300059424 Bacteria 2611
567 2910248439 2910245624 Bacteria 6935613
568 2911143127 2911138879 Bacteria 5811561
569 Ga0070702_100096389
570 rootH1_10082082
571 rootH2_10029369
572 rootH1_10112609
573 rootH1_10179196
574 rootH1_10227810
575 JGI25160J50197_1000803
576 Ga0065712_10002818
577 Ga0065712_10005289
578 Ga0065712_10071595
579 Ga0065715_10006374
580 Ga0065715_10040717
581 Ga0065715_10128400
582 Ga0065707_10136119
583 Ga0070683_100000105
584 Ga0070683_100000158
585 Ga0070683_100038802
586 Ga0070683_100067785
587 Ga0070683_100244345
588 Ga0070690_100009849
589 Ga0070670_100005608
590 Ga0070670_100015115
591 Ga0068869_100000217
592 Ga0068869_100006034
593 Ga0068869_100120754
594 Ga0070666_10057199
595 Ga0070680_100020200
596 Ga0068868_100001487
597 Ga0068868_100019570
598 Ga0068868_100057282
599 Ga0070689_100081759
600 Ga0070687_100010219
601 Ga0070687_100019417
602 Ga0070687_100036972
603 Ga0070661_100003276
604 Ga0070661_100020553
605 Ga0070668_100013397
606 Ga0070669_100003903
607 Ga0070669_100011506
608 Ga0070669_100037893
609 Ga0070675_100028308
610 Ga0070675_100069716
611 Ga0070675_100144648
612 Ga0070675_100297380
613 Ga0070671_100002811
614 Ga0070671_100040124
615 Ga0070671_100211036
616 Ga0070674_100037082
617 Ga0070674_100044702
618 Ga0070673_100030681
619 Ga0070673_100119528
620 Ga0070673_100176633
621 Ga0070688_100010508
622 Ga0070659_100014478
623 Ga0070667_100002458
624 Ga0070667_100116120
625 Ga0070667_100120797
626 Ga0070701_10030937
627 Ga0070705_100010084
628 Ga0070700_100018850
629 Ga0070694_100095550
630 Ga0070694_100106710
631 Ga0070708_100167428
632 Ga0070663_100103352
633 Ga0070662_100007705
634 Ga0070681_10009641
635 Ga0070681_10012279
636 Ga0070681_10056744
637 Ga0070681_10114661
638 Ga0068867_100007645
639 Ga0068867_100029973
640 Ga0068867_100045154
641 Ga0068867_100079628
642 Ga0068867_100083612
643 Ga0068867_100085298
644 Ga0070685_10006631
645 Ga0070685_10030621
646 Ga0070707_100009185
647 Ga0070707_100166284
648 Ga0070698_100002438
649 Ga0070698_100017528
650 Ga0070684_100000161
651 Ga0070684_100077796
652 Ga0070684_100106690
653 Ga0068853_100018177
654 Ga0068853_100028452
655 Ga0068853_100217832
656 Ga0070672_100013177
657 Ga0070665_100101744
658 Ga0070704_100020406
659 Ga0068855_100000255
660 Ga0068855_100041026
661 Ga0068855_100142622
662 Ga0070664_100003916
663 Ga0070664_100004441
664 Ga0070664_100096017
665 Ga0070664_100101875
666 Ga0070664_100177156
667 Ga0068857_100000590
668 Ga0068857_100002496
669 Ga0068857_100218099
670 Ga0068854_100046614
671 Ga0068856_100002932
672 Ga0068856_100022829
673 Ga0068856_100182612
674 Ga0070702_100005558
675 Ga0068852_100000004
676 Ga0068852_100015738
677 Ga0068852_100303198
678 Ga0068859_100008646
679 Ga0068859_100037067
680 Ga0068859_100043172
681 Ga0068859_100048041
682 Ga0068859_100060505
683 Ga0068859_100234523
684 Ga0068864_100000524
685 Ga0068864_100003605
686 Ga0068864_100209085
687 Ga0068866_10011061
688 Ga0068866_10025232
689 Ga0068861_100047975
690 Ga0068861_100169184
691 Ga0068851_10006499
692 Ga0068851_10079502
693 Ga0068863_100000589
694 Ga0068863_100006897
695 Ga0068863_100029012
696 Ga0068863_100034452
697 Ga0068863_100112045
698 Ga0068858_100001558
699 Ga0068858_100003853
700 Ga0068858_100015302
701 Ga0068858_100041822
702 Ga0068858_100300367
703 Ga0068860_100000853
704 Ga0068860_100015963
705 Ga0068860_100018171
706 Ga0068860_100027208
707 Ga0068860_100106642
708 Ga0068862_100002335
709 Ga0068862_100010649
710 Ga0068862_100019692
711 Ga0068862_100022598
712 Ga0068862_100073120
713 Ga0075363_100026528
714 Ga0075364_10005334
715 Ga0075364_10006334
716 Ga0075362_10005678
717 Ga0075367_10013353
718 Ga0075367_10022946
719 Ga0075367_10090390
720 Ga0075366_10000797
721 Ga0075366_10010913
722 Ga0097621_100002564
723 Ga0097621_100040853
724 Ga0075370_10094529
725 Ga0068871_100000735
726 Ga0068871_100005931
727 Ga0068871_100082725
728 Ga0068871_100093233
729 Ga0075428_100034208
730 Ga0075428_100052592
731 Ga0075428_100077352
732 Ga0075430_100105141
733 Ga0075430_100144387
734 Ga0075431_100006291
735 Ga0075431_100129183
736 Ga0075433_10003415
737 Ga0075433_10161992
738 Ga0075434_100101218
739 Ga0075434_100189538
740 Ga0075429_100133843
741 Ga0068865_100016075
742 Ga0097620_100008646
743 Ga0097620_100037064
744 Ga0097620_100043172
745 Ga0097620_100048042
746 Ga0097620_100060496
747 Ga0097620_100234519
748 Ga0105240_10000111
749 Ga0105240_10000147
750 Ga0105240_10000168
751 Ga0105240_10002651
752 Ga0105240_10084119
753 Ga0105240_10095403
754 Ga0111539_10000396
755 Ga0111539_10003108
756 Ga0111539_10007675
757 Ga0111539_10008255
758 Ga0111539_10010885
759 Ga0111539_10061004
760 Ga0111539_10106709
761 Ga0105245_10000769
762 Ga0105245_10017566
763 Ga0105245_10235603
764 Ga0105247_10000309
765 Ga0114129_10005003
766 Ga0114129_10006205
767 Ga0114129_10006598
768 Ga0114129_10010903
769 Ga0114129_10024463
770 Ga0114129_10025616
771 Ga0114129_10182340
772 Ga0114129_10277015
773 Ga0105243_10016839
774 Ga0105243_10077303
775 Ga0105243_10100199
776 Ga0105243_10188034
777 Ga0105241_10000633
778 Ga0105241_10114358
779 Ga0105242_10029870
780 Ga0105242_10040950
781 Ga0105242_10121909
782 Ga0105248_10012483
783 Ga0105248_10083861
784 Ga0105248_10100981
785 Ga0105248_10315146
786 Ga0105248_10365270
787 Ga0105237_10001214
788 Ga0105237_10002839
789 Ga0105237_10021103
790 Ga0105237_10036386
791 Ga0105237_10086556
792 Ga0105238_10000631
793 Ga0105238_10005541
794 Ga0105238_10019836
795 Ga0105238_10022560
796 Ga0105238_10027038
797 Ga0105238_10128185
798 Ga0105249_10001151
799 Ga0105249_10035404
800 Ga0105249_10081438
801 Ga0105249_10116902
802 Ga0105239_10000981
803 Ga0105239_10005827
804 Ga0105239_10011615
805 Ga0105239_10026376
806 Ga0105239_10097784
807 Ga0105239_10346696
808 Ga0105239_10348765
809 Ga0105246_10001302
810 Ga0157370_10000016
811 Ga0157370_10085087
812 Ga0157369_10000010
813 Ga0157369_10001496
814 Ga0157369_10023922
815 Ga0157369_10044419
816 Ga0157369_10318345
817 Ga0157374_10001075
818 Ga0157374_10031799
819 Ga0157374_10038936
820 Ga0157378_10000101
821 Ga0157378_10002149
822 Ga0157378_10021561
823 Ga0157378_10038484
824 Ga0157378_10098740
825 Ga0163162_10001816
826 Ga0163162_10010134
827 Ga0163162_10010268
828 Ga0163162_10127897
829 Ga0157372_10000036
830 Ga0157372_10003462
831 Ga0157372_10008962
832 Ga0157372_10018756
833 Ga0157372_10046076
834 Ga0157372_10057629
835 Ga0157372_10153288
836 Ga0157375_10002123
837 Ga0157375_10038575
838 Ga0157375_10116345
839 Ga0163163_10001254
840 Ga0163163_10004806
841 Ga0163163_10008092
842 Ga0163163_10091032
843 Ga0163163_10160444
844 Ga0163163_10333578
845 Ga0157380_10002434
846 Ga0157380_10007547
847 Ga0157380_10014883
848 Ga0157380_10057171
849 Ga0157377_10005996
850 Ga0157377_10023544
851 Ga0157379_10000549
852 Ga0157379_10075214
853 Ga0157376_10001719
854 Ga0213875_10049276
855 Ga0207426_1000019
856 Ga0207697_10001088
857 Ga0207697_10043783
858 Ga0207710_10000259
859 Ga0207688_10023657
860 Ga0207647_10004164
861 Ga0207645_10095219
862 Ga0207684_10068710
863 Ga0207654_10003407
864 Ga0207707_10052311
865 Ga0207695_10000023
866 Ga0207695_10000031
867 Ga0207695_10000050
868 Ga0207695_10010236
869 Ga0207695_10018280
870 Ga0207695_10191227
871 Ga0207671_10001384
872 Ga0207671_10003377
873 Ga0207660_10038474
874 Ga0207662_10016675
875 Ga0207662_10023019
876 Ga0207662_10028785
877 Ga0207649_10058977
878 Ga0207649_10072538
879 Ga0207649_10153884
880 Ga0207646_10010583
881 Ga0207646_10022837
882 Ga0207681_10004517
883 Ga0207681_10015928
884 Ga0207694_10000965
885 Ga0207650_10001984
886 Ga0207650_10055614
887 Ga0207650_10084636
888 Ga0207659_10028372
889 Ga0207687_10002774
890 Ga0207687_10095928
891 Ga0207644_10076692
892 Ga0207706_10074622
893 Ga0207686_10000562
894 Ga0207709_10059516
895 Ga0207669_10018214
896 Ga0207669_10100072
897 Ga0207691_10006696
898 Ga0207691_10039806
899 Ga0207691_10191992
900 Ga0207691_10275968
901 Ga0207711_10232961
902 Ga0207689_10001335
903 Ga0207689_10001408
904 Ga0207689_10005389
905 Ga0207689_10030118
906 Ga0207689_10082055
907 Ga0207689_10099387
908 Ga0207689_10186971
909 Ga0207661_10002706
910 Ga0207661_10035663
911 Ga0207661_10054648
912 Ga0207661_10094875
913 Ga0207661_10241857
914 Ga0207679_10028575
915 Ga0207667_10002277
916 Ga0207667_10012231
917 Ga0207712_10002269
918 Ga0207712_10004347
919 Ga0207712_10038638
920 Ga0207712_10041344
921 Ga0207668_10050315
922 Ga0207668_10061266
923 Ga0207658_10002487
924 Ga0207658_10229646
925 Ga0207677_10000798
926 Ga0207677_10087700
927 Ga0207703_10017258
928 Ga0207703_10035602
929 Ga0207639_10009199
930 Ga0207639_10017630
931 Ga0207678_10005561
932 Ga0207678_10094545
933 Ga0207678_10115601
934 Ga0207708_10022392
935 Ga0207702_10005113
936 Ga0207641_10000854
937 Ga0207641_10001119
938 Ga0207641_10025861
939 Ga0207641_10032905
940 Ga0207641_10213859
941 Ga0207648_10010944
942 Ga0207648_10011647
943 Ga0207648_10038541
944 Ga0207648_10066270
945 Ga0207648_10106542
946 Ga0207648_10214324
947 Ga0207676_10003661
948 Ga0207676_10115248
949 Ga0207676_10131573
950 Ga0207674_10000385
951 Ga0207674_10001812
952 Ga0207674_10008178
953 Ga0207674_10141759
954 Ga0207674_10246966
955 Ga0207675_100000148
956 Ga0207675_100004972
957 Ga0207675_100069188
958 Ga0207675_100210737
959 Ga0207683_10049236
960 Ga0207683_10152350
961 Ga0207698_10000008
962 Ga0207698_10081563
963 Ga0207698_10180114
964 Ga0207698_10185871
965 Ga0207428_10000473
966 Ga0207428_10009969
967 Ga0207428_10021272
968 Ga0207428_10040767
969 Ga0207428_10059719
970 Ga0268266_10084372
971 Ga0268265_10006954
972 Ga0268265_10014954
973 Ga0268265_10037129
974 Ga0268265_10089240
975 Ga0268264_10005386
976 Ga0268264_10017387
977 Ga0268264_10035260
978 Ga0265334_10000863
979 Ga0265336_10013173
980 Ga0307517_10000914
981 Ga0307515_10000001
982 Ga0265338_10004615
983 Ga0307511_10000808
984 Ga0265328_10015102
985 Ga0265320_10035051
986 Ga0265329_10028326
987 Ga0265327_10000411
988 Ga0265327_10018031
989 Ga0265316_10007944
990 Ga0307509_10048224
991 Ga0265314_10000139
992 Ga0265314_10070165
993 Ga0265342_10035307
994 Ga0265342_10106834
995 Ga0316576_10024262
996 Ga0316578_10014162
997 Ga0307516_10002011
998 Ga0316577_10004901
999 Ga0316577_10025995
1000 Ga0307409_100033014
1001 Ga0307414_10025093
1002 Ga0316574_0071637
1003 Ga0373947_0117051
1004 Ga0373937_0020408
1005 Ga0316584_0001101
1006 Ga0316584_0001861
1007 Ga0395905_0100247
1008 Ga0436364_1289019
1009 Ga0436361_0633601
1010 Ga0439439_0016048
1011 Ga0451837_1363558
1012 Ga0439445_0017959
1013 Ga0439446_0003181
1014 Ga0439460_0023344
1015 Ga0451577_0000376
1016 Ga0451577_0000686
1017 Ga0451577_0000830
1018 Ga0451577_0000943
1019 Ga0451577_0013794
1020 Ga0451577_0070389
1021 Ga0451577_0099068
1022 Ga0451577_0184838
1023 Ga0453683_0000022
1024 Ga0453683_0000311
1025 Ga0453683_0001481
1026 Ga0453683_0004090
1027 Ga0453683_0025717
1028 Ga0453683_0061525
1029 Ga0466963_0003167
1030 Ga0453684_0001039
1031 Ga0453684_0001137
1032 Ga0453684_0001657
1033 Ga0453684_0004806
1034 Ga0453684_0007186
1035 Ga0453684_0010058
1036 Ga0453684_0016221
1037 Ga0453684_0056613
1038 Ga0453684_0080021
1039 Ga0451576_0000835
1040 Ga0451576_0001065
1041 Ga0451576_0002014
1042 Ga0451576_0002639
1043 Ga0451576_0003658
1044 Ga0451576_0003960
1045 Ga0451576_0060283
1046 Ga0451576_0205211
1047 Ga0451576_0237365
1048 Ga0495638_0075642
1049 Ga0495594_0103428
1050 Ga0495586_0001038
1051 Ga0495634_0066316
1052 Ga0495611_0000100
1053 Ga0495670_0079220
1054 Ga0495676_0119493
1055 Ga0495686_0000018
1056 Ga0496102_0013811
1057 Ga0496102_0016997
1058 Ga0496103_0020327
1059 Ga0496104_0000520
1060 Ga0496104_0013219
1061 Ga0496105_0063225
1062 Ga0496108_0004362
1063 Ga0496108_0037899
1064 Ga0496109_0022592
1065 Ga0496109_0062152
1066 Ga0496110_0000313
1067 Ga0496110_0067826
1068 Ga0496112_0001772
1069 Ga0496112_0171658
1070 Ga0496114_0142426
1071 Ga0496126_0001766
1072 Ga0496126_0009009
1073 Ga0501031_0041731
1074 Ga0501034_0084785
1075 Ga0501036_0029921
1076 Ga0501036_0033175
1077 Ga0501042_0076817
1078 Ga0501048_0011432
1079 Ga0501071_0009711
1080 Ga0501071_0081513
1081 Ga0501072_0063408
1082 Ga0501072_0087643
1083 Ga0501072_0135111
1084 Ga0501072_0288784
1085 Ga0501075_0005982
1086 Ga0501075_0021815
1087 Ga0501075_0125268
1088 Ga0501076_0013913
1089 Ga0501076_0033945
1090 Ga0501076_0034871
1091 Ga0501076_0185437
1092 Ga0501206_002526
1093 Ga0501081_0095314
1094 Ga0501045_0018937
1095 nmdc:mga03683_8699_c1
1096 nmdc:mga00v17_41133_c1
1097 nmdc:mga0yw44_119144_c1
1098 nmdc:mga0k408_20116_c1
1099 nmdc:mga0k408_47950_c1
1100 nmdc:mga0k408_70486_c1
1101 nmdc:mga0k408_9621_c1
1102 nmdc:mga06z11_57941_c1
1103 nmdc:mga06z11_6939_c1
1104 nmdc:mga07m45_66865_c1
1105 nmdc:mga05p37_146940_c1
1106 nmdc:mga05p37_1766_c1
1107 nmdc:mga05p37_192122_c1
1108 nmdc:mga05p37_238322_c1
1109 nmdc:mga05p37_312570_c1
1110 nmdc:mga05p37_7399_c1
1111 nmdc:mga09592_13193_c1
1112 nmdc:mga09592_44224_c1
1113 nmdc:mga06r32_2424_c1
1114 nmdc:mga06r32_30571_c1
1115 nmdc:mga08y16_114373_c1
1116 nmdc:mga08y16_13936_c1
1117 nmdc:mga08y16_187698_c1
1118 nmdc:mga08y16_26680_c1
1119 nmdc:mga08y16_3358_c1
1120 nmdc:mga08y16_33743_c1
1121 nmdc:mga0n895_122504_c1
1122 nmdc:mga0a205_20160_c1
1123 nmdc:mga0a205_28166_c1
1124 nmdc:mga0a205_40145_c1
1125 Ga0500568_0023174
1126 Ga0500616_0002741
1127 Ga0500616_0053586
1128 Ga0500622_0003659
1129 Ga0501084_0146211
1130 Ga0501084_0150770
1131 Ga0501084_0152370
1132 Ga0590071_000187
1133 Ga0590075_000024
1134 Ga0590075_007384
1135 2910248439
1136 2911143127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

89

221

0.93

PF19051

GFO_IDH_MocA_C2

Oxidoreductase family, C-terminal alpha/beta domain

416

503

0.92

PF19051

GFO_IDH_MocA_C2

Oxidoreductase family, C-terminal alpha/beta domain

255

416

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8354 40 428
3q2k-assembly1.cif.gz_B crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.828 40 428
3q2k-assembly2.cif.gz_P crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8257 40 428
3q2k-assembly1.cif.gz_E crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8256 40 428
3q2k-assembly2.cif.gz_L crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca 0.8251 40 428
ID Description Score Start End Superfamily
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9326 41 169 3.40.50.720
af_P77503_5_146_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.918 40 179 3.40.50.720
af_P77503_10_129_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9127 42 171 3.30.360.10
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9101 41 169 3.40.50.720
1zh8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9071 40 171 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A151BEY2-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9389 40 195 GO:0000166
AF-A0A416RGB7-F1-model_v4 deleted 0.9281 40 179
AF-A0A7V2XFZ2-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9156 16 454 GO:0000166
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9088 40 196 GO:0000166
AF-A0A416RGB7-F1-model_v4 deleted 0.9076 40 179

Map