F464522

General Info

Members Datasets Scaffolds Average Seq Length
567 263 1134 146

Family's Representative Sequence

Representative Sequence 3300027682|Ga0209971_1006700|Ga0209971_10067003
Length 168
Sequence MDVFTLSLWALRLGFVLLIYVFFFFVARALWRDLRAGVAGAGRPLARLLVVGSPEGRPQAGTSIALDAVNSLGRDVNNSIVLDDSFVSSEHALLTFRGRAWYVEDRGSTNGTWLNGQRIEGLAPLGYGDEVQVGQVRMRLERPRQVSPQASKXLRRYGTMADIHKLPQ

Samples

Sample ID Description Type Environment
1 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
152 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
153 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
154 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
170 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
174 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
175 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
176 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
177 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
178 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
179 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
180 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
238 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
239 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
261 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.7
Rhizosphere 95.94
Stem 0
Stem Tuber 0
Unclassified 14.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209971_1006700 3300027682 Bacteria 2726
2 rootH1_10015656 3300003316 Bacteria 5384
3 JGI26145J50221_1011436 3300003371 Bacteria 789
4 Ga0070676_10862026 3300005328 Unclassified 672
5 Ga0070683_100345133 3300005329 Unclassified 1418
6 Ga0070690_100327353 3300005330 Bacteria 1106
7 Ga0070680_100064306 3300005336 Bacteria 3006
8 Ga0070680_100366832 3300005336 Bacteria 1225
9 Ga0070680_101676394 3300005336 Bacteria 551
10 Ga0068868_100341104 3300005338 Bacteria 1281
11 Ga0068868_100486639 3300005338 Bacteria 1079
12 Ga0070689_100570739 3300005340 Bacteria 977
13 Ga0070687_100008745 3300005343 Bacteria 4301
14 Ga0070687_100352221 3300005343 Bacteria 951
15 Ga0070692_10553521 3300005345 Bacteria 754
16 Ga0070692_10632033 3300005345 Bacteria 712
17 Ga0070675_100318993 3300005354 Bacteria 1372
18 Ga0070675_100484515 3300005354 Unclassified 1113
19 Ga0070675_100633232 3300005354 Bacteria 971
20 Ga0070674_100008186 3300005356 Bacteria 6208
21 Ga0070673_100785154 3300005364 Bacteria 879
22 Ga0070659_100275372 3300005366 Unclassified 1399
23 Ga0070667_100072370 3300005367 Bacteria 2937
24 Ga0070714_101252861 3300005435 Bacteria 724
25 Ga0070701_10688242 3300005438 Bacteria 686
26 Ga0070705_100055706 3300005440 Bacteria 2325
27 Ga0070705_100056337 3300005440 Bacteria 2314
28 Ga0070705_100275310 3300005440 Bacteria 1194
29 Ga0070705_100498421 3300005440 Bacteria 924
30 Ga0070700_100058753 3300005441 Bacteria 2417
31 Ga0070694_100160338 3300005444 Bacteria 1650
32 Ga0070694_101362093 3300005444 Bacteria 598
33 Ga0070708_100002560 3300005445 Bacteria 14063
34 Ga0070708_100014648 3300005445 Bacteria 6458
35 Ga0070708_100041233 3300005445 Bacteria 4047
36 Ga0070708_100361955 3300005445 Bacteria 1367
37 Ga0070708_100485944 3300005445 Bacteria 1165
38 Ga0070708_100928441 3300005445 Unclassified 817
39 Ga0070663_100909815 3300005455 Bacteria 760
40 Ga0070663_101129087 3300005455 Bacteria 686
41 Ga0070663_101667727 3300005455 Bacteria 569
42 Ga0070678_100133112 3300005456 Bacteria 1979
43 Ga0070678_101238461 3300005456 Unclassified 693
44 Ga0070678_101480783 3300005456 Bacteria 635
45 Ga0070662_100096578 3300005457 Bacteria 2229
46 Ga0070681_10154044 3300005458 Bacteria 2224
47 Ga0068867_100652379 3300005459 Bacteria 923
48 Ga0068867_101011188 3300005459 Bacteria 754
49 Ga0070706_100041069 3300005467 Bacteria 4271
50 Ga0070706_100066540 3300005467 Bacteria 3333
51 Ga0070706_100093954 3300005467 Bacteria 2783
52 Ga0070706_100332225 3300005467 Unclassified 1417
53 Ga0070706_100447583 3300005467 Unclassified 1202
54 Ga0070706_101164791 3300005467 Bacteria 709
55 Ga0070707_100018882 3300005468 Bacteria 6492
56 Ga0070707_100042458 3300005468 Bacteria 4354
57 Ga0070707_100200671 3300005468 Bacteria 1944
58 Ga0070707_100352921 3300005468 Bacteria 1428
59 Ga0070707_101374549 3300005468 Unclassified 673
60 Ga0070698_100004268 3300005471 Bacteria 15715
61 Ga0070698_100013975 3300005471 Bacteria 8491
62 Ga0070698_100583786 3300005471 Bacteria 1058
63 Ga0070699_100011875 3300005518 Bacteria 7519
64 Ga0070699_100112706 3300005518 Bacteria 2389
65 Ga0070699_100214558 3300005518 Bacteria 1714
66 Ga0070699_100684024 3300005518 Bacteria 937
67 Ga0070699_100761757 3300005518 Bacteria 885
68 Ga0070679_100602521 3300005530 Bacteria 1042
69 Ga0070684_100270704 3300005535 Bacteria 1555
70 Ga0070697_100002053 3300005536 Bacteria 15432
71 Ga0070697_100023444 3300005536 Bacteria 4907
72 Ga0070697_100084000 3300005536 Bacteria 2626
73 Ga0070697_100153648 3300005536 Bacteria 1941
74 Ga0070697_100241322 3300005536 Unclassified 1543
75 Ga0068853_101530096 3300005539 Bacteria 646
76 Ga0070672_101495244 3300005543 Bacteria 605
77 Ga0070686_100021920 3300005544 Bacteria 3801
78 Ga0070686_100045170 3300005544 Bacteria 2773
79 Ga0070695_100310142 3300005545 Unclassified 1169
80 Ga0070695_100538196 3300005545 Bacteria 909
81 Ga0070696_100000947 3300005546 Bacteria 18832
82 Ga0070696_100033928 3300005546 Bacteria 3509
83 Ga0070696_100066246 3300005546 Bacteria 2533
84 Ga0070696_100667506 3300005546 Bacteria 844
85 Ga0070693_100169593 3300005547 Bacteria 1397
86 Ga0070693_100197741 3300005547 Bacteria 1304
87 Ga0070704_100008992 3300005549 Bacteria 6020
88 Ga0070704_100554228 3300005549 Bacteria 1005
89 Ga0070704_101641149 3300005549 Bacteria 593
90 Ga0070664_100875387 3300005564 Bacteria 842
91 Ga0070664_100895473 3300005564 Bacteria 832
92 Ga0068856_100613563 3300005614 Bacteria 1109
93 Ga0068859_100155098 3300005617 Bacteria 2367
94 Ga0068859_101848999 3300005617 Bacteria 667
95 Ga0068864_100306748 3300005618 Unclassified 1487
96 Ga0068861_101059622 3300005719 Bacteria 777
97 Ga0068870_10499002 3300005840 Bacteria 811
98 Ga0068870_10645496 3300005840 Unclassified 724
99 Ga0068863_100252995 3300005841 Unclassified 1702
100 Ga0068858_101188533 3300005842 Bacteria 750
101 Ga0068860_100947957 3300005843 Bacteria 878
102 Ga0068860_101017724 3300005843 Bacteria 847
103 Ga0081455_10516522 3300005937 Bacteria 798
104 Ga0081539_10012455 3300005985 Bacteria 6554
105 Ga0075433_10112621 3300006852 Bacteria 2414
106 Ga0075433_10444990 3300006852 Unclassified 1142
107 Ga0075434_100074167 3300006871 Bacteria 3396
108 Ga0075434_100115121 3300006871 Unclassified 2701
109 Ga0075434_101341100 3300006871 Bacteria 726
110 Ga0068865_100198398 3300006881 Bacteria 1556
111 Ga0075436_100787782 3300006914 Unclassified 707
112 Ga0075436_101255940 3300006914 Bacteria 560
113 Ga0097620_100155104 3300006931 Bacteria 2367
114 Ga0097620_101848962 3300006931 Bacteria 667
115 Ga0075435_100011722 3300007076 Bacteria 6467
116 Ga0075435_100058268 3300007076 Bacteria 3128
117 Ga0111539_10054276 3300009094 Bacteria 4769
118 Ga0111539_12005720 3300009094 Bacteria 671
119 Ga0111539_12237819 3300009094 Unclassified 634
120 Ga0105245_10176410 3300009098 Bacteria 2038
121 Ga0105245_10208262 3300009098 Unclassified 1881
122 Ga0114129_10063460 3300009147 Bacteria 5158
123 Ga0114129_10488988 3300009147 Bacteria 1609
124 Ga0105243_10278172 3300009148 Bacteria 1506
125 Ga0105243_11705140 3300009148 Bacteria 659
126 Ga0105241_10410370 3300009174 Bacteria 1190
127 Ga0105241_10855698 3300009174 Bacteria 841
128 Ga0105242_10039244 3300009176 Bacteria 3809
129 Ga0105242_10056687 3300009176 Bacteria 3206
130 Ga0105242_10260123 3300009176 Bacteria 1567
131 Ga0105242_10550254 3300009176 Bacteria 1106
132 Ga0105242_10741369 3300009176 Unclassified 966
133 Ga0105248_12517606 3300009177 Unclassified 586
134 Ga0105249_10260204 3300009553 Bacteria 1724
135 Ga0105239_10455781 3300010375 Bacteria 1451
136 Ga0105246_10032796 3300011119 Bacteria 3447
137 Ga0157378_10055361 3300013297 Bacteria 3534
138 Ga0157378_10982941 3300013297 Bacteria 878
139 Ga0157378_11451304 3300013297 Bacteria 730
140 Ga0163162_10522210 3300013306 Bacteria 1317
141 Ga0157375_11451877 3300013308 Bacteria 809
142 Ga0163163_10405556 3300014325 Bacteria 1421
143 Ga0163163_10632657 3300014325 Bacteria 1133
144 Ga0157380_10165702 3300014326 Bacteria 1925
145 Ga0157377_10548223 3300014745 Bacteria 816
146 Ga0157377_11451103 3300014745 Unclassified 543
147 Ga0157379_10022331 3300014968 Bacteria 5606
148 Ga0157379_10305533 3300014968 Bacteria 1450
149 Ga0157379_10315785 3300014968 Bacteria 1426
150 Ga0157379_11965091 3300014968 Bacteria 577
151 Ga0157376_10463567 3300014969 Bacteria 1238
152 Ga0163161_10636915 3300017792 Bacteria 882
153 Ga0207645_10260709 3300025907 Bacteria 1148
154 Ga0207684_10049686 3300025910 Bacteria 3558
155 Ga0207684_10052836 3300025910 Bacteria 3449
156 Ga0207684_10076862 3300025910 Bacteria 2838
157 Ga0207684_10139497 3300025910 Bacteria 2083
158 Ga0207684_10232832 3300025910 Bacteria 1589
159 Ga0207684_10369058 3300025910 Unclassified 1235
160 Ga0207684_11326544 3300025910 Bacteria 591
161 Ga0207654_10604024 3300025911 Bacteria 783
162 Ga0207707_10018352 3300025912 Bacteria 6097
163 Ga0207663_10248614 3300025916 Unclassified 1308
164 Ga0207660_10000001 3300025917 Bacteria 1034169
165 Ga0207660_10426444 3300025917 Bacteria 1070
166 Ga0207660_11422826 3300025917 Bacteria 561
167 Ga0207662_10005144 3300025918 Bacteria 6941
168 Ga0207662_10059763 3300025918 Bacteria 2285
169 Ga0207662_10377481 3300025918 Bacteria 957
170 Ga0207657_10328141 3300025919 Bacteria 1209
171 Ga0207652_11086604 3300025921 Bacteria 700
172 Ga0207646_10011228 3300025922 Bacteria 8697
173 Ga0207646_10038779 3300025922 Bacteria 4288
174 Ga0207646_10082663 3300025922 Bacteria 2872
175 Ga0207646_10723083 3300025922 Bacteria 889
176 Ga0207646_11400125 3300025922 Bacteria 608
177 Ga0207694_10182769 3300025924 Bacteria 1701
178 Ga0207650_11214838 3300025925 Bacteria 642
179 Ga0207659_10129030 3300025926 Bacteria 1948
180 Ga0207659_10352888 3300025926 Bacteria 1221
181 Ga0207659_11444999 3300025926 Bacteria 589
182 Ga0207687_10152631 3300025927 Bacteria 1764
183 Ga0207690_10462130 3300025932 Unclassified 1022
184 Ga0207706_10226575 3300025933 Bacteria 1636
185 Ga0207706_10376581 3300025933 Bacteria 1232
186 Ga0207706_10865255 3300025933 Bacteria 765
187 Ga0207686_10706360 3300025934 Bacteria 802
188 Ga0207709_10371730 3300025935 Bacteria 1085
189 Ga0207669_10052528 3300025937 Bacteria 2449
190 Ga0207669_10491718 3300025937 Bacteria 980
191 Ga0207704_10094903 3300025938 Bacteria 1971
192 Ga0207689_10047502 3300025942 Bacteria 3543
193 Ga0207689_10398222 3300025942 Bacteria 1147
194 Ga0207661_10511301 3300025944 Bacteria 1098
195 Ga0207679_11086909 3300025945 Bacteria 734
196 Ga0207667_11663459 3300025949 Bacteria 606
197 Ga0207667_11851687 3300025949 Bacteria 566
198 Ga0207651_10434036 3300025960 Bacteria 1124
199 Ga0207640_10491656 3300025981 Bacteria 1020
200 Ga0207640_11142907 3300025981 Bacteria 690
201 Ga0207658_10038461 3300025986 Bacteria 3447
202 Ga0207677_10261211 3300026023 Bacteria 1412
203 Ga0207703_10364811 3300026035 Bacteria 1333
204 Ga0207678_10230452 3300026067 Bacteria 1586
205 Ga0207708_10102413 3300026075 Bacteria 2217
206 Ga0207708_10293528 3300026075 Bacteria 1320
207 Ga0207702_10139195 3300026078 Bacteria 2194
208 Ga0207641_10571729 3300026088 Bacteria 1104
209 Ga0207648_10227078 3300026089 Bacteria 1660
210 Ga0207648_10599772 3300026089 Bacteria 1015
211 Ga0207676_10061981 3300026095 Bacteria 2964
212 Ga0207676_10469318 3300026095 Bacteria 1190
213 Ga0207676_10541908 3300026095 Bacteria 1111
214 Ga0207674_10833118 3300026116 Bacteria 890
215 Ga0207683_10176847 3300026121 Bacteria 1934
216 Ga0207683_11224504 3300026121 Unclassified 696
217 Ga0207698_10285106 3300026142 Bacteria 1530
218 Ga0209973_1022576 3300027252 Bacteria 845
219 Ga0209968_1018810 3300027526 Bacteria 1109
220 Ga0209999_1042782 3300027543 Bacteria 850
221 Ga0209982_1017984 3300027552 Bacteria 1080
222 Ga0209983_1016596 3300027665 Bacteria 1521
223 Ga0209966_1010834 3300027695 Bacteria 1653
224 Ga0209998_10000128 3300027717 Bacteria 29823
225 Ga0209998_10018069 3300027717 Bacteria 1495
226 Ga0209974_10004650 3300027876 Bacteria 4880
227 Ga0209974_10010850 3300027876 Bacteria 3069
228 Ga0209974_10131808 3300027876 Bacteria 892
229 Ga0268264_10181864 3300028381 Bacteria 1910
230 Ga0265337_1050609 3300028556 Bacteria 1171
231 Ga0265326_10046570 3300028558 Bacteria 1230
232 Ga0265326_10086980 3300028558 Bacteria 885
233 Ga0265319_1001513 3300028563 Bacteria 13799
234 Ga0265319_1009909 3300028563 Bacteria 4014
235 Ga0265319_1010260 3300028563 Bacteria 3920
236 Ga0265319_1156744 3300028563 Bacteria 704
237 Ga0265334_10032083 3300028573 Bacteria 2096
238 Ga0265334_10048258 3300028573 Bacteria 1640
239 Ga0265334_10111540 3300028573 Unclassified 983
240 Ga0265318_10091628 3300028577 Bacteria 1120
241 Ga0265322_10009779 3300028654 Bacteria 2785
242 Ga0265322_10023754 3300028654 Bacteria 1753
243 Ga0265336_10016645 3300028666 Bacteria 2403
244 Ga0265338_10103814 3300028800 Bacteria 2308
245 Ga0265338_10893775 3300028800 Bacteria 605
246 Ga0265324_10037698 3300029957 Bacteria 1679
247 Ga0265324_10090981 3300029957 Bacteria 1038
248 Ga0265320_10028896 3300031240 Bacteria 2874
249 Ga0265320_10046307 3300031240 Bacteria 2132
250 Ga0265320_10076690 3300031240 Bacteria 1566
251 Ga0265325_10031774 3300031241 Bacteria 2822
252 Ga0265325_10071163 3300031241 Bacteria 1746
253 Ga0265325_10122539 3300031241 Bacteria 1252
254 Ga0265340_10031709 3300031247 Bacteria 2641
255 Ga0265340_10066848 3300031247 Bacteria 1709
256 Ga0265340_10187416 3300031247 Bacteria 934
257 Ga0265339_10013213 3300031249 Bacteria 5008
258 Ga0265339_10080457 3300031249 Bacteria 1723
259 Ga0265339_10205414 3300031249 Bacteria 970
260 Ga0265331_10046711 3300031250 Bacteria 2086
261 Ga0265316_10031288 3300031344 Bacteria 4353
262 Ga0265316_10083908 3300031344 Unclassified 2440
263 Ga0265316_10514757 3300031344 Bacteria 854
264 Ga0265313_10090816 3300031595 Bacteria 1372
265 Ga0265313_10286042 3300031595 Bacteria 665
266 Ga0316575_10023050 3300031665 Bacteria 2405
267 Ga0316575_10040714 3300031665 Unclassified 1837
268 Ga0265314_10066289 3300031711 Bacteria 2435
269 Ga0265314_10075686 3300031711 Bacteria 2239
270 Ga0265342_10071223 3300031712 Unclassified 2026
271 Ga0265342_10071617 3300031712 Bacteria 2019
272 Ga0316576_10000728 3300031727 Bacteria 16314
273 Ga0316578_10118103 3300031728 Bacteria 1593
274 Ga0316578_10478413 3300031728 Unclassified 735
275 Ga0316577_10144399 3300031733 Bacteria 1340
276 Ga0307413_10103988 3300031824 Unclassified 1884
277 Ga0307413_10269142 3300031824 Bacteria 1275
278 Ga0307410_10749855 3300031852 Bacteria 827
279 Ga0307416_101593407 3300032002 Bacteria 758
280 Ga0307416_102327334 3300032002 Bacteria 636
281 Ga0307415_100174251 3300032126 Unclassified 1681
282 Ga0307415_101510992 3300032126 Bacteria 643
283 Ga0316583_10016878 3300032133 Unclassified 2626
284 Ga0316585_10028212 3300032137 Unclassified 1755
285 Ga0316580_10016590 3300032139 Unclassified 2260
286 Ga0316580_10083768 3300032139 Unclassified 975
287 Ga0316596_1016871 3300033541 Unclassified 1831
288 Ga0373939_0333865 3300035114 Bacteria 613
289 Ga0373941_0385724 3300035115 Bacteria 577
290 Ga0373954_0468152 3300035118 Unclassified 624
291 Ga0373942_0184267 3300035207 Bacteria 685
292 Ga0373961_0302004 3300035241 Bacteria 592
293 Ga0316574_0011845 3300035398 Unclassified 4970
294 Ga0316574_0409535 3300035398 Unclassified 853
295 Ga0373947_0379938 3300035725 Bacteria 951
296 Ga0373937_0070441 3300036401 Bacteria 3226
297 Ga0373937_1547578 3300036401 Bacteria 610
298 Ga0316582_0391229 3300036647 Bacteria 957
299 Ga0316584_0431435 3300036712 Bacteria 934
300 Ga0395900_0243566 3300037418 Bacteria 1803
301 Ga0316581_0138553 3300037588 Bacteria 750
302 Ga0395901_0569039 3300038443 Bacteria 1146
303 Ga0439436_0219660 3300041404 Bacteria 547
304 Ga0439453_0083189 3300041408 Unclassified 693
305 Ga0439465_0156690 3300041413 Bacteria 815
306 Ga0439465_0163874 3300041413 Bacteria 798
307 Ga0451802_0129478 3300041460 Bacteria 586
308 Ga0451853_0404390 3300041512 Bacteria 683
309 Ga0439441_000882 3300042001 Bacteria 3621
310 Ga0450920_006497 3300042122 Bacteria 2105
311 Ga0450920_017244 3300042122 Bacteria 1380
312 Ga0450922_003659 3300042124 Bacteria 1413
313 Ga0450923_001161 3300042125 Bacteria 3367
314 Ga0450910_001819 3300042147 Bacteria 2750
315 Ga0439446_0265966 3300042156 Bacteria 595
316 Ga0439460_0064513 3300042461 Bacteria 1124
317 Ga0450918_044373 3300042531 Bacteria 802
318 Ga0451577_0498935 3300042876 Bacteria 1105
319 Ga0453684_0214295 3300044712 Bacteria 2236
320 Ga0451576_0067224 3300045051 Bacteria 3730
321 Ga0495629_0295735 3300046459 Bacteria 1109
322 Ga0495641_0039829 3300046461 Bacteria 2189
323 Ga0495653_0187651 3300046463 Unclassified 1413
324 Ga0495618_0066953 3300046514 Bacteria 2283
325 Ga0495628_0339307 3300046516 Bacteria 1106
326 Ga0495630_0126886 3300046517 Bacteria 1937
327 Ga0495630_0986732 3300046517 Bacteria 640
328 Ga0495640_0065556 3300046533 Bacteria 2452
329 Ga0495640_0827931 3300046533 Bacteria 551
330 Ga0495586_0526721 3300046535 Unclassified 682
331 Ga0495587_0381923 3300046536 Bacteria 783
332 Ga0495645_0279022 3300046543 Unclassified 1099
333 Ga0495667_0348774 3300046559 Unclassified 935
334 Ga0495634_0031258 3300046642 Bacteria 3668
335 Ga0495634_0599070 3300046642 Bacteria 640
336 Ga0495635_0187192 3300046663 Bacteria 1406
337 Ga0495599_0208218 3300046678 Bacteria 1200
338 Ga0495623_0451025 3300046679 Bacteria 685
339 Ga0495613_0322908 3300046689 Bacteria 1065
340 Ga0495600_0331530 3300046809 Unclassified 955
341 Ga0495600_0734883 3300046809 Bacteria 592
342 Ga0495581_0274974 3300047315 Bacteria 985
343 Ga0495676_0427176 3300047321 Unclassified 876
344 Ga0495680_0065024 3300047322 Bacteria 2795
345 Ga0495684_0209226 3300047471 Bacteria 1435
346 Ga0496101_0568260 3300048904 Bacteria 897
347 Ga0496102_0388641 3300048905 Bacteria 1313
348 Ga0496103_0123233 3300048906 Bacteria 1652
349 Ga0496103_0338193 3300048906 Bacteria 968
350 Ga0496104_0060164 3300048907 Bacteria 3598
351 Ga0496105_0013014 3300048908 Bacteria 6593
352 Ga0496106_0120230 3300048909 Bacteria 2053
353 Ga0496107_1290131 3300048910 Bacteria 523
354 Ga0496108_0003463 3300048911 Bacteria 12662
355 Ga0496108_1220391 3300048911 Unclassified 635
356 Ga0496108_1282046 3300048911 Bacteria 617
357 Ga0496109_0074887 3300048912 Bacteria 3112
358 Ga0496109_0126979 3300048912 Bacteria 2378
359 Ga0496109_1132111 3300048912 Unclassified 720
360 Ga0496110_0049428 3300048913 Bacteria 3689
361 Ga0496111_0053288 3300048914 Bacteria 2922
362 Ga0496112_0000005 3300048915 Bacteria 525541
363 Ga0496112_0141232 3300048915 Bacteria 2377
364 Ga0496113_0045468 3300048916 Bacteria 3256
365 Ga0496114_0468301 3300048917 Bacteria 1115
366 Ga0501031_0000603 3300049568 Bacteria 21177
367 Ga0501031_0015944 3300049568 Bacteria 4878
368 Ga0501031_0048477 3300049568 Bacteria 2768
369 Ga0501031_0220199 3300049568 Bacteria 1236
370 Ga0501031_0335951 3300049568 Bacteria 978
371 Ga0501031_0456240 3300049568 Bacteria 826
372 Ga0501032_0502818 3300049569 Unclassified 775
373 Ga0501033_0077132 3300049570 Bacteria 2446
374 Ga0501033_0120197 3300049570 Bacteria 1907
375 Ga0501034_0670992 3300049571 Bacteria 937
376 Ga0501036_0003299 3300049572 Bacteria 12875
377 Ga0501036_0038236 3300049572 Bacteria 4061
378 Ga0501036_0096653 3300049572 Unclassified 2497
379 Ga0501036_0553395 3300049572 Unclassified 956
380 Ga0501037_0179444 3300049573 Bacteria 1503
381 Ga0501037_0187283 3300049573 Unclassified 1466
382 Ga0501037_1058454 3300049573 Unclassified 527
383 Ga0501038_0058105 3300049574 Bacteria 3318
384 Ga0501038_0101367 3300049574 Bacteria 2397
385 Ga0501039_0004540 3300049575 Bacteria 10482
386 Ga0501039_0011248 3300049575 Bacteria 6821
387 Ga0501039_0032050 3300049575 Bacteria 4051
388 Ga0501040_0000392 3300049576 Bacteria 25874
389 Ga0501040_0006158 3300049576 Bacteria 7781
390 Ga0501040_0029916 3300049576 Bacteria 3676
391 Ga0501040_0058790 3300049576 Bacteria 2641
392 Ga0501040_0101976 3300049576 Bacteria 2002
393 Ga0501040_0276471 3300049576 Bacteria 1199
394 Ga0501040_0288086 3300049576 Bacteria 1173
395 Ga0501040_0509714 3300049576 Bacteria 867
396 Ga0501040_0521342 3300049576 Unclassified 857
397 Ga0501041_0005621 3300049577 Bacteria 7324
398 Ga0501041_0051392 3300049577 Bacteria 2512
399 Ga0501041_0413107 3300049577 Unclassified 855
400 Ga0501041_0432592 3300049577 Bacteria 835
401 Ga0501042_0001282 3300049578 Bacteria 14632
402 Ga0501042_0008694 3300049578 Bacteria 6732
403 Ga0501042_0020317 3300049578 Bacteria 4621
404 Ga0501042_0147805 3300049578 Bacteria 1694
405 Ga0501042_0363285 3300049578 Unclassified 1048
406 Ga0501043_0018491 3300049579 Bacteria 5467
407 Ga0501043_0174167 3300049579 Unclassified 1678
408 Ga0501043_0305883 3300049579 Bacteria 1214
409 Ga0501043_0983182 3300049579 Bacteria 601
410 Ga0501046_0005053 3300049580 Bacteria 11826
411 Ga0501046_0019272 3300049580 Bacteria 5659
412 Ga0501046_0153910 3300049580 Bacteria 1734
413 Ga0501046_0566282 3300049580 Bacteria 809
414 Ga0501048_0014896 3300049582 Bacteria 5750
415 Ga0501048_0023836 3300049582 Bacteria 4469
416 Ga0501048_0026579 3300049582 Bacteria 4213
417 Ga0501048_0092761 3300049582 Bacteria 2130
418 Ga0501048_0337659 3300049582 Unclassified 1074
419 Ga0501048_0348915 3300049582 Bacteria 1055
420 Ga0501048_0574642 3300049582 Unclassified 809
421 Ga0501048_1204935 3300049582 Unclassified 544
422 Ga0501067_0002503 3300049583 Bacteria 10144
423 Ga0501067_0027186 3300049583 Bacteria 3169
424 Ga0501067_0114855 3300049583 Bacteria 1497
425 Ga0501067_0133247 3300049583 Bacteria 1383
426 Ga0501068_0018643 3300049584 Bacteria 4019
427 Ga0501068_0038108 3300049584 Bacteria 2879
428 Ga0501068_0309332 3300049584 Bacteria 1012
429 Ga0501068_0390729 3300049584 Unclassified 896
430 Ga0501068_0391714 3300049584 Bacteria 895
431 Ga0501068_0481160 3300049584 Unclassified 804
432 Ga0501068_0649135 3300049584 Unclassified 689
433 Ga0501069_0004781 3300049585 Bacteria 7009
434 Ga0501069_0020474 3300049585 Bacteria 3584
435 Ga0501069_0046490 3300049585 Bacteria 2408
436 Ga0501069_0047327 3300049585 Bacteria 2387
437 Ga0501069_0065015 3300049585 Bacteria 2039
438 Ga0501069_0276290 3300049585 Bacteria 982
439 Ga0501070_0058035 3300049586 Bacteria 3209
440 Ga0501070_0117137 3300049586 Bacteria 2200
441 Ga0501070_0403622 3300049586 Bacteria 1105
442 Ga0501071_0000659 3300049587 Bacteria 18012
443 Ga0501071_0003194 3300049587 Bacteria 10205
444 Ga0501071_0010090 3300049587 Bacteria 6315
445 Ga0501071_0057222 3300049587 Bacteria 2817
446 Ga0501071_0065638 3300049587 Bacteria 2635
447 Ga0501071_0096010 3300049587 Bacteria 2181
448 Ga0501071_0288387 3300049587 Bacteria 1243
449 Ga0501071_0468096 3300049587 Bacteria 965
450 Ga0501071_0513099 3300049587 Unclassified 920
451 Ga0501072_0005485 3300049588 Bacteria 9656
452 Ga0501072_0028506 3300049588 Bacteria 4359
453 Ga0501072_0040547 3300049588 Bacteria 3656
454 Ga0501072_0049508 3300049588 Bacteria 3308
455 Ga0501072_0056246 3300049588 Bacteria 3100
456 Ga0501072_0113310 3300049588 Bacteria 2159
457 Ga0501072_0744164 3300049588 Bacteria 769
458 Ga0501072_0798990 3300049588 Unclassified 739
459 Ga0501073_0035556 3300049589 Bacteria 3540
460 Ga0501073_0040082 3300049589 Bacteria 3317
461 Ga0501073_0554245 3300049589 Unclassified 794
462 Ga0501074_0002071 3300049590 Bacteria 13859
463 Ga0501074_0073479 3300049590 Bacteria 2456
464 Ga0501074_0162801 3300049590 Bacteria 1593
465 Ga0501074_0239800 3300049590 Unclassified 1290
466 Ga0501074_0368046 3300049590 Unclassified 1020
467 Ga0501074_0402708 3300049590 Bacteria 970
468 Ga0501074_0403127 3300049590 Bacteria 970
469 Ga0501074_0466282 3300049590 Bacteria 895
470 Ga0501075_0001232 3300049591 Bacteria 16583
471 Ga0501075_0017700 3300049591 Bacteria 5146
472 Ga0501075_0038785 3300049591 Bacteria 3562
473 Ga0501075_0045694 3300049591 Bacteria 3288
474 Ga0501075_0115798 3300049591 Bacteria 2038
475 Ga0501075_0177104 3300049591 Bacteria 1627
476 Ga0501075_0811883 3300049591 Bacteria 712
477 Ga0501076_0001610 3300049592 Bacteria 15206
478 Ga0501076_0007921 3300049592 Bacteria 7748
479 Ga0501076_0032810 3300049592 Bacteria 4055
480 Ga0501076_0050934 3300049592 Bacteria 3277
481 Ga0501076_0068551 3300049592 Bacteria 2833
482 Ga0501076_0069501 3300049592 Unclassified 2814
483 Ga0501076_0305125 3300049592 Bacteria 1305
484 Ga0501076_0993010 3300049592 Bacteria 692
485 Ga0501077_0010624 3300049593 Bacteria 5733
486 Ga0501077_0023133 3300049593 Bacteria 3940
487 Ga0501077_0069504 3300049593 Bacteria 2232
488 Ga0501077_0073046 3300049593 Bacteria 2173
489 Ga0501077_0075713 3300049593 Bacteria 2131
490 Ga0501077_0116718 3300049593 Bacteria 1691
491 Ga0501077_0140965 3300049593 Bacteria 1529
492 Ga0501077_0998355 3300049593 Bacteria 539
493 Ga0501079_0014943 3300049741 Bacteria 5917
494 Ga0501079_0020354 3300049741 Bacteria 5070
495 Ga0501079_0047832 3300049741 Bacteria 3301
496 Ga0501079_0049336 3300049741 Bacteria 3248
497 Ga0501079_0243399 3300049741 Bacteria 1405
498 Ga0501080_0007065 3300049742 Bacteria 10139
499 Ga0501080_0017605 3300049742 Bacteria 6607
500 Ga0501080_0049102 3300049742 Bacteria 3928
501 Ga0501080_0066287 3300049742 Bacteria 3358
502 Ga0501080_0133724 3300049742 Bacteria 2296
503 Ga0501080_0160288 3300049742 Unclassified 2078
504 Ga0501080_0315496 3300049742 Bacteria 1416
505 Ga0501080_0385083 3300049742 Bacteria 1263
506 Ga0501080_0441463 3300049742 Bacteria 1167
507 Ga0501080_0842363 3300049742 Unclassified 802
508 Ga0501080_1249705 3300049742 Bacteria 637
509 Ga0501081_0000481 3300049743 Bacteria 22201
510 Ga0501081_0023855 3300049743 Bacteria 4103
511 Ga0501081_0034723 3300049743 Bacteria 3432
512 Ga0501081_0177143 3300049743 Unclassified 1541
513 Ga0501081_0400374 3300049743 Bacteria 1016
514 Ga0501081_0658282 3300049743 Bacteria 785
515 Ga0501081_1088454 3300049743 Bacteria 605
516 Ga0501083_0125635 3300049744 Unclassified 1682
517 Ga0501083_0200926 3300049744 Bacteria 1300
518 Ga0501083_0559379 3300049744 Unclassified 744
519 Ga0501035_0048720 3300049822 Bacteria 3799
520 Ga0501035_0083046 3300049822 Bacteria 2827
521 Ga0501045_0037724 3300049824 Bacteria 3513
522 Ga0501045_0138003 3300049824 Bacteria 1813
523 Ga0501045_0153503 3300049824 Bacteria 1713
524 Ga0501045_0173849 3300049824 Bacteria 1604
525 Ga0501045_0235480 3300049824 Unclassified 1363
526 Ga0501045_0470369 3300049824 Bacteria 934
527 Ga0501045_0492720 3300049824 Unclassified 910
528 Ga0501045_0700706 3300049824 Bacteria 747
529 nmdc:mga06r32_875828_c1 3300050510 Bacteria 855
530 nmdc:mga08y16_90442_c1 3300050511 Bacteria 3191
531 nmdc:mga0n895_269375_c1 3300050512 Archaea 1728
532 nmdc:mga0n895_356549_c1 3300050512 Bacteria 1481
533 nmdc:mga0n895_384411_c1 3300050512 Bacteria 1420
534 nmdc:mga0rr50_438690_c1 3300050513 Viruses 1106
535 nmdc:mga0rr50_836722_c1 3300050513 Bacteria 785
536 nmdc:mga0rr50_895475_c1 3300050513 Bacteria 757
537 nmdc:mga08x19_517158_c1 3300050514 Bacteria 843
538 nmdc:mga08x19_685482_c1 3300050514 Unclassified 727
539 nmdc:mga0a205_360776_c1 3300050515 Bacteria 1320
540 nmdc:mga0a205_88973_c1 3300050515 Bacteria 2985
541 Ga0495601_0025773 3300053077 Bacteria 3627
542 Ga0495601_0233968 3300053077 Bacteria 1200
543 Ga0495612_0025680 3300053078 Bacteria 2366
544 Ga0495595_0014545 3300053084 Bacteria 3342
545 Ga0495619_0001417 3300053085 Bacteria 15754
546 Ga0501084_0017403 3300054114 Bacteria 5975
547 Ga0501084_0037125 3300054114 Bacteria 4070
548 Ga0501084_0037943 3300054114 Bacteria 4026
549 Ga0501084_0080669 3300054114 Bacteria 2728
550 Ga0501084_0414719 3300054114 Bacteria 1138
551 Ga0501084_0598726 3300054114 Unclassified 931
552 Ga0501084_0661874 3300054114 Bacteria 881
553 Ga0501084_0967667 3300054114 Bacteria 715
554 Ga0590075_004771 3300059424 Bacteria 3207
555 Ga0501082_0003021 3300060353 Bacteria 14700
556 Ga0501082_0098701 3300060353 Bacteria 2525
557 Ga0501082_0545295 3300060353 Bacteria 1014
558 Ga0501082_0703986 3300060353 Unclassified 884
559 Ga0501082_1645438 3300060353 Bacteria 560
560 Ga0530510_0027652 3300061734 Bacteria 4064
561 Ga0530510_0029566 3300061734 Bacteria 3933
562 Ga0530510_0040081 3300061734 Bacteria 3380
563 Ga0530510_0048223 3300061734 Bacteria 3078
564 Ga0530510_0060954 3300061734 Bacteria 2731
565 Ga0530510_0078234 3300061734 Bacteria 2404
566 Ga0530510_0419991 3300061734 Unclassified 1009
567 Ga0530510_0768230 3300061734 Bacteria 735
568 Ga0209971_1006700
569 rootH1_10015656
570 JGI26145J50221_1011436
571 Ga0070676_10862026
572 Ga0070683_100345133
573 Ga0070690_100327353
574 Ga0070680_100064306
575 Ga0070680_100366832
576 Ga0070680_101676394
577 Ga0068868_100341104
578 Ga0068868_100486639
579 Ga0070689_100570739
580 Ga0070687_100008745
581 Ga0070687_100352221
582 Ga0070692_10553521
583 Ga0070692_10632033
584 Ga0070675_100318993
585 Ga0070675_100484515
586 Ga0070675_100633232
587 Ga0070674_100008186
588 Ga0070673_100785154
589 Ga0070659_100275372
590 Ga0070667_100072370
591 Ga0070714_101252861
592 Ga0070701_10688242
593 Ga0070705_100055706
594 Ga0070705_100056337
595 Ga0070705_100275310
596 Ga0070705_100498421
597 Ga0070700_100058753
598 Ga0070694_100160338
599 Ga0070694_101362093
600 Ga0070708_100002560
601 Ga0070708_100014648
602 Ga0070708_100041233
603 Ga0070708_100361955
604 Ga0070708_100485944
605 Ga0070708_100928441
606 Ga0070663_100909815
607 Ga0070663_101129087
608 Ga0070663_101667727
609 Ga0070678_100133112
610 Ga0070678_101238461
611 Ga0070678_101480783
612 Ga0070662_100096578
613 Ga0070681_10154044
614 Ga0068867_100652379
615 Ga0068867_101011188
616 Ga0070706_100041069
617 Ga0070706_100066540
618 Ga0070706_100093954
619 Ga0070706_100332225
620 Ga0070706_100447583
621 Ga0070706_101164791
622 Ga0070707_100018882
623 Ga0070707_100042458
624 Ga0070707_100200671
625 Ga0070707_100352921
626 Ga0070707_101374549
627 Ga0070698_100004268
628 Ga0070698_100013975
629 Ga0070698_100583786
630 Ga0070699_100011875
631 Ga0070699_100112706
632 Ga0070699_100214558
633 Ga0070699_100684024
634 Ga0070699_100761757
635 Ga0070679_100602521
636 Ga0070684_100270704
637 Ga0070697_100002053
638 Ga0070697_100023444
639 Ga0070697_100084000
640 Ga0070697_100153648
641 Ga0070697_100241322
642 Ga0068853_101530096
643 Ga0070672_101495244
644 Ga0070686_100021920
645 Ga0070686_100045170
646 Ga0070695_100310142
647 Ga0070695_100538196
648 Ga0070696_100000947
649 Ga0070696_100033928
650 Ga0070696_100066246
651 Ga0070696_100667506
652 Ga0070693_100169593
653 Ga0070693_100197741
654 Ga0070704_100008992
655 Ga0070704_100554228
656 Ga0070704_101641149
657 Ga0070664_100875387
658 Ga0070664_100895473
659 Ga0068856_100613563
660 Ga0068859_100155098
661 Ga0068859_101848999
662 Ga0068864_100306748
663 Ga0068861_101059622
664 Ga0068870_10499002
665 Ga0068870_10645496
666 Ga0068863_100252995
667 Ga0068858_101188533
668 Ga0068860_100947957
669 Ga0068860_101017724
670 Ga0081455_10516522
671 Ga0081539_10012455
672 Ga0075433_10112621
673 Ga0075433_10444990
674 Ga0075434_100074167
675 Ga0075434_100115121
676 Ga0075434_101341100
677 Ga0068865_100198398
678 Ga0075436_100787782
679 Ga0075436_101255940
680 Ga0097620_100155104
681 Ga0097620_101848962
682 Ga0075435_100011722
683 Ga0075435_100058268
684 Ga0111539_10054276
685 Ga0111539_12005720
686 Ga0111539_12237819
687 Ga0105245_10176410
688 Ga0105245_10208262
689 Ga0114129_10063460
690 Ga0114129_10488988
691 Ga0105243_10278172
692 Ga0105243_11705140
693 Ga0105241_10410370
694 Ga0105241_10855698
695 Ga0105242_10039244
696 Ga0105242_10056687
697 Ga0105242_10260123
698 Ga0105242_10550254
699 Ga0105242_10741369
700 Ga0105248_12517606
701 Ga0105249_10260204
702 Ga0105239_10455781
703 Ga0105246_10032796
704 Ga0157378_10055361
705 Ga0157378_10982941
706 Ga0157378_11451304
707 Ga0163162_10522210
708 Ga0157375_11451877
709 Ga0163163_10405556
710 Ga0163163_10632657
711 Ga0157380_10165702
712 Ga0157377_10548223
713 Ga0157377_11451103
714 Ga0157379_10022331
715 Ga0157379_10305533
716 Ga0157379_10315785
717 Ga0157379_11965091
718 Ga0157376_10463567
719 Ga0163161_10636915
720 Ga0207645_10260709
721 Ga0207684_10049686
722 Ga0207684_10052836
723 Ga0207684_10076862
724 Ga0207684_10139497
725 Ga0207684_10232832
726 Ga0207684_10369058
727 Ga0207684_11326544
728 Ga0207654_10604024
729 Ga0207707_10018352
730 Ga0207663_10248614
731 Ga0207660_10000001
732 Ga0207660_10426444
733 Ga0207660_11422826
734 Ga0207662_10005144
735 Ga0207662_10059763
736 Ga0207662_10377481
737 Ga0207657_10328141
738 Ga0207652_11086604
739 Ga0207646_10011228
740 Ga0207646_10038779
741 Ga0207646_10082663
742 Ga0207646_10723083
743 Ga0207646_11400125
744 Ga0207694_10182769
745 Ga0207650_11214838
746 Ga0207659_10129030
747 Ga0207659_10352888
748 Ga0207659_11444999
749 Ga0207687_10152631
750 Ga0207690_10462130
751 Ga0207706_10226575
752 Ga0207706_10376581
753 Ga0207706_10865255
754 Ga0207686_10706360
755 Ga0207709_10371730
756 Ga0207669_10052528
757 Ga0207669_10491718
758 Ga0207704_10094903
759 Ga0207689_10047502
760 Ga0207689_10398222
761 Ga0207661_10511301
762 Ga0207679_11086909
763 Ga0207667_11663459
764 Ga0207667_11851687
765 Ga0207651_10434036
766 Ga0207640_10491656
767 Ga0207640_11142907
768 Ga0207658_10038461
769 Ga0207677_10261211
770 Ga0207703_10364811
771 Ga0207678_10230452
772 Ga0207708_10102413
773 Ga0207708_10293528
774 Ga0207702_10139195
775 Ga0207641_10571729
776 Ga0207648_10227078
777 Ga0207648_10599772
778 Ga0207676_10061981
779 Ga0207676_10469318
780 Ga0207676_10541908
781 Ga0207674_10833118
782 Ga0207683_10176847
783 Ga0207683_11224504
784 Ga0207698_10285106
785 Ga0209973_1022576
786 Ga0209968_1018810
787 Ga0209999_1042782
788 Ga0209982_1017984
789 Ga0209983_1016596
790 Ga0209966_1010834
791 Ga0209998_10000128
792 Ga0209998_10018069
793 Ga0209974_10004650
794 Ga0209974_10010850
795 Ga0209974_10131808
796 Ga0268264_10181864
797 Ga0265337_1050609
798 Ga0265326_10046570
799 Ga0265326_10086980
800 Ga0265319_1001513
801 Ga0265319_1009909
802 Ga0265319_1010260
803 Ga0265319_1156744
804 Ga0265334_10032083
805 Ga0265334_10048258
806 Ga0265334_10111540
807 Ga0265318_10091628
808 Ga0265322_10009779
809 Ga0265322_10023754
810 Ga0265336_10016645
811 Ga0265338_10103814
812 Ga0265338_10893775
813 Ga0265324_10037698
814 Ga0265324_10090981
815 Ga0265320_10028896
816 Ga0265320_10046307
817 Ga0265320_10076690
818 Ga0265325_10031774
819 Ga0265325_10071163
820 Ga0265325_10122539
821 Ga0265340_10031709
822 Ga0265340_10066848
823 Ga0265340_10187416
824 Ga0265339_10013213
825 Ga0265339_10080457
826 Ga0265339_10205414
827 Ga0265331_10046711
828 Ga0265316_10031288
829 Ga0265316_10083908
830 Ga0265316_10514757
831 Ga0265313_10090816
832 Ga0265313_10286042
833 Ga0316575_10023050
834 Ga0316575_10040714
835 Ga0265314_10066289
836 Ga0265314_10075686
837 Ga0265342_10071223
838 Ga0265342_10071617
839 Ga0316576_10000728
840 Ga0316578_10118103
841 Ga0316578_10478413
842 Ga0316577_10144399
843 Ga0307413_10103988
844 Ga0307413_10269142
845 Ga0307410_10749855
846 Ga0307416_101593407
847 Ga0307416_102327334
848 Ga0307415_100174251
849 Ga0307415_101510992
850 Ga0316583_10016878
851 Ga0316585_10028212
852 Ga0316580_10016590
853 Ga0316580_10083768
854 Ga0316596_1016871
855 Ga0373939_0333865
856 Ga0373941_0385724
857 Ga0373954_0468152
858 Ga0373942_0184267
859 Ga0373961_0302004
860 Ga0316574_0011845
861 Ga0316574_0409535
862 Ga0373947_0379938
863 Ga0373937_0070441
864 Ga0373937_1547578
865 Ga0316582_0391229
866 Ga0316584_0431435
867 Ga0395900_0243566
868 Ga0316581_0138553
869 Ga0395901_0569039
870 Ga0439436_0219660
871 Ga0439453_0083189
872 Ga0439465_0156690
873 Ga0439465_0163874
874 Ga0451802_0129478
875 Ga0451853_0404390
876 Ga0439441_000882
877 Ga0450920_006497
878 Ga0450920_017244
879 Ga0450922_003659
880 Ga0450923_001161
881 Ga0450910_001819
882 Ga0439446_0265966
883 Ga0439460_0064513
884 Ga0450918_044373
885 Ga0451577_0498935
886 Ga0453684_0214295
887 Ga0451576_0067224
888 Ga0495629_0295735
889 Ga0495641_0039829
890 Ga0495653_0187651
891 Ga0495618_0066953
892 Ga0495628_0339307
893 Ga0495630_0126886
894 Ga0495630_0986732
895 Ga0495640_0065556
896 Ga0495640_0827931
897 Ga0495586_0526721
898 Ga0495587_0381923
899 Ga0495645_0279022
900 Ga0495667_0348774
901 Ga0495634_0031258
902 Ga0495634_0599070
903 Ga0495635_0187192
904 Ga0495599_0208218
905 Ga0495623_0451025
906 Ga0495613_0322908
907 Ga0495600_0331530
908 Ga0495600_0734883
909 Ga0495581_0274974
910 Ga0495676_0427176
911 Ga0495680_0065024
912 Ga0495684_0209226
913 Ga0496101_0568260
914 Ga0496102_0388641
915 Ga0496103_0123233
916 Ga0496103_0338193
917 Ga0496104_0060164
918 Ga0496105_0013014
919 Ga0496106_0120230
920 Ga0496107_1290131
921 Ga0496108_0003463
922 Ga0496108_1220391
923 Ga0496108_1282046
924 Ga0496109_0074887
925 Ga0496109_0126979
926 Ga0496109_1132111
927 Ga0496110_0049428
928 Ga0496111_0053288
929 Ga0496112_0000005
930 Ga0496112_0141232
931 Ga0496113_0045468
932 Ga0496114_0468301
933 Ga0501031_0000603
934 Ga0501031_0015944
935 Ga0501031_0048477
936 Ga0501031_0220199
937 Ga0501031_0335951
938 Ga0501031_0456240
939 Ga0501032_0502818
940 Ga0501033_0077132
941 Ga0501033_0120197
942 Ga0501034_0670992
943 Ga0501036_0003299
944 Ga0501036_0038236
945 Ga0501036_0096653
946 Ga0501036_0553395
947 Ga0501037_0179444
948 Ga0501037_0187283
949 Ga0501037_1058454
950 Ga0501038_0058105
951 Ga0501038_0101367
952 Ga0501039_0004540
953 Ga0501039_0011248
954 Ga0501039_0032050
955 Ga0501040_0000392
956 Ga0501040_0006158
957 Ga0501040_0029916
958 Ga0501040_0058790
959 Ga0501040_0101976
960 Ga0501040_0276471
961 Ga0501040_0288086
962 Ga0501040_0509714
963 Ga0501040_0521342
964 Ga0501041_0005621
965 Ga0501041_0051392
966 Ga0501041_0413107
967 Ga0501041_0432592
968 Ga0501042_0001282
969 Ga0501042_0008694
970 Ga0501042_0020317
971 Ga0501042_0147805
972 Ga0501042_0363285
973 Ga0501043_0018491
974 Ga0501043_0174167
975 Ga0501043_0305883
976 Ga0501043_0983182
977 Ga0501046_0005053
978 Ga0501046_0019272
979 Ga0501046_0153910
980 Ga0501046_0566282
981 Ga0501048_0014896
982 Ga0501048_0023836
983 Ga0501048_0026579
984 Ga0501048_0092761
985 Ga0501048_0337659
986 Ga0501048_0348915
987 Ga0501048_0574642
988 Ga0501048_1204935
989 Ga0501067_0002503
990 Ga0501067_0027186
991 Ga0501067_0114855
992 Ga0501067_0133247
993 Ga0501068_0018643
994 Ga0501068_0038108
995 Ga0501068_0309332
996 Ga0501068_0390729
997 Ga0501068_0391714
998 Ga0501068_0481160
999 Ga0501068_0649135
1000 Ga0501069_0004781
1001 Ga0501069_0020474
1002 Ga0501069_0046490
1003 Ga0501069_0047327
1004 Ga0501069_0065015
1005 Ga0501069_0276290
1006 Ga0501070_0058035
1007 Ga0501070_0117137
1008 Ga0501070_0403622
1009 Ga0501071_0000659
1010 Ga0501071_0003194
1011 Ga0501071_0010090
1012 Ga0501071_0057222
1013 Ga0501071_0065638
1014 Ga0501071_0096010
1015 Ga0501071_0288387
1016 Ga0501071_0468096
1017 Ga0501071_0513099
1018 Ga0501072_0005485
1019 Ga0501072_0028506
1020 Ga0501072_0040547
1021 Ga0501072_0049508
1022 Ga0501072_0056246
1023 Ga0501072_0113310
1024 Ga0501072_0744164
1025 Ga0501072_0798990
1026 Ga0501073_0035556
1027 Ga0501073_0040082
1028 Ga0501073_0554245
1029 Ga0501074_0002071
1030 Ga0501074_0073479
1031 Ga0501074_0162801
1032 Ga0501074_0239800
1033 Ga0501074_0368046
1034 Ga0501074_0402708
1035 Ga0501074_0403127
1036 Ga0501074_0466282
1037 Ga0501075_0001232
1038 Ga0501075_0017700
1039 Ga0501075_0038785
1040 Ga0501075_0045694
1041 Ga0501075_0115798
1042 Ga0501075_0177104
1043 Ga0501075_0811883
1044 Ga0501076_0001610
1045 Ga0501076_0007921
1046 Ga0501076_0032810
1047 Ga0501076_0050934
1048 Ga0501076_0068551
1049 Ga0501076_0069501
1050 Ga0501076_0305125
1051 Ga0501076_0993010
1052 Ga0501077_0010624
1053 Ga0501077_0023133
1054 Ga0501077_0069504
1055 Ga0501077_0073046
1056 Ga0501077_0075713
1057 Ga0501077_0116718
1058 Ga0501077_0140965
1059 Ga0501077_0998355
1060 Ga0501079_0014943
1061 Ga0501079_0020354
1062 Ga0501079_0047832
1063 Ga0501079_0049336
1064 Ga0501079_0243399
1065 Ga0501080_0007065
1066 Ga0501080_0017605
1067 Ga0501080_0049102
1068 Ga0501080_0066287
1069 Ga0501080_0133724
1070 Ga0501080_0160288
1071 Ga0501080_0315496
1072 Ga0501080_0385083
1073 Ga0501080_0441463
1074 Ga0501080_0842363
1075 Ga0501080_1249705
1076 Ga0501081_0000481
1077 Ga0501081_0023855
1078 Ga0501081_0034723
1079 Ga0501081_0177143
1080 Ga0501081_0400374
1081 Ga0501081_0658282
1082 Ga0501081_1088454
1083 Ga0501083_0125635
1084 Ga0501083_0200926
1085 Ga0501083_0559379
1086 Ga0501035_0048720
1087 Ga0501035_0083046
1088 Ga0501045_0037724
1089 Ga0501045_0138003
1090 Ga0501045_0153503
1091 Ga0501045_0173849
1092 Ga0501045_0235480
1093 Ga0501045_0470369
1094 Ga0501045_0492720
1095 Ga0501045_0700706
1096 nmdc:mga06r32_875828_c1
1097 nmdc:mga08y16_90442_c1
1098 nmdc:mga0n895_269375_c1
1099 nmdc:mga0n895_356549_c1
1100 nmdc:mga0n895_384411_c1
1101 nmdc:mga0rr50_438690_c1
1102 nmdc:mga0rr50_836722_c1
1103 nmdc:mga0rr50_895475_c1
1104 nmdc:mga08x19_517158_c1
1105 nmdc:mga08x19_685482_c1
1106 nmdc:mga0a205_360776_c1
1107 nmdc:mga0a205_88973_c1
1108 Ga0495601_0025773
1109 Ga0495601_0233968
1110 Ga0495612_0025680
1111 Ga0495595_0014545
1112 Ga0495619_0001417
1113 Ga0501084_0017403
1114 Ga0501084_0037125
1115 Ga0501084_0037943
1116 Ga0501084_0080669
1117 Ga0501084_0414719
1118 Ga0501084_0598726
1119 Ga0501084_0661874
1120 Ga0501084_0967667
1121 Ga0590075_004771
1122 Ga0501082_0003021
1123 Ga0501082_0098701
1124 Ga0501082_0545295
1125 Ga0501082_0703986
1126 Ga0501082_1645438
1127 Ga0530510_0027652
1128 Ga0530510_0029566
1129 Ga0530510_0040081
1130 Ga0530510_0048223
1131 Ga0530510_0060954
1132 Ga0530510_0078234
1133 Ga0530510_0419991
1134 Ga0530510_0768230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

70

134

0.97

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

58

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ff4-assembly1.cif.gz_A mycobacterium tuberculosis embr in complex with low affinity phosphopeptide 0.9514 51 146
7rj3-assembly3.cif.gz_C crystal structure of the forkhead associated (fha) domain of the glycogen accumulation regulator (gara) from mycobacterium tuberculosis 0.9504 51 147
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.948 53 147
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9429 51 147
8p5x-assembly1.cif.gz_G single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi 0.9338 51 146
ID Description Score Start End Superfamily
af_A6PWD2_8_99_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9801 69 139 2.60.200.20
af_O65934_209_307_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9709 74 142 2.60.200.20
af_Q8II28_278_394_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9571 73 139 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9536 51 147 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9479 52 147 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A351EUQ2-F1-model_v4 FHA domain-containing protein 0.9844 51 146
AF-A0A1V6HFH0-F1-model_v4 Phosphoserine phosphatase RsbU (EC 3.1.3.3) 0.98 51 146 GO:0036424
AF-A0A7X8E9X8-F1-model_v4 FHA domain-containing protein 0.9787 51 146
AF-A0A5R8KJG1-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9766 51 146 GO:0004016
GO:0009190
GO:0035556
AF-A0A5S9F2P7-F1-model_v4 FHA domain-containing protein 0.9759 51 147 GO:0016020

Map