F464352

General Info

Members Datasets Scaffolds Average Seq Length
566 287 1132 181

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100505675|Ga0070697_1005056751
Length 176
Sequence MTSQNGRAFNEWLRAQLKAKKMSQRQLAQQSGVDHSTISRLIRGDRMPSLGTATKLARGLRELHDDADTPQYLGLMSSGAPANPTARVEYALRADDVLSEGQVRQIMEYYLAVRMRRFGRSYQPGESGDRTTDRPMARPAAPSSRMGAGAVVTTGTRIGGLRPMGRPTGRTAGPRY

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
177 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
178 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
179 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
191 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
267 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 7.95
Rhizosphere 91.17
Stem 0
Stem Tuber 0
Unclassified 37.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100505675 3300005536 Unclassified 1057
2 JGI24033J26618_1019346 3300002155 Unclassified 862
3 JGI24742J22300_10046340 3300002244 Unclassified 781
4 Ga0070683_100181529 3300005329 Bacteria 1998
5 Ga0070690_100006052 3300005330 Bacteria 6844
6 Ga0070670_100063583 3300005331 Unclassified 3167
7 Ga0070670_100421756 3300005331 Bacteria 1180
8 Ga0068869_100840235 3300005334 Unclassified 791
9 Ga0068869_100948979 3300005334 Bacteria 746
10 Ga0068868_100109897 3300005338 Bacteria 2239
11 Ga0068868_100649041 3300005338 Unclassified 939
12 Ga0068868_100652690 3300005338 Bacteria 937
13 Ga0070660_100139996 3300005339 Bacteria 1941
14 Ga0070689_100084523 3300005340 Unclassified 2495
15 Ga0070691_10200114 3300005341 Bacteria 1049
16 Ga0070687_100086913 3300005343 Bacteria 1720
17 Ga0070687_100147113 3300005343 Unclassified 1378
18 Ga0070692_10057583 3300005345 Bacteria 2038
19 Ga0070692_10108582 3300005345 Unclassified 1531
20 Ga0070668_100096161 3300005347 Unclassified 2341
21 Ga0070668_100590141 3300005347 Bacteria 971
22 Ga0070669_100427666 3300005353 Unclassified 1088
23 Ga0070669_100651829 3300005353 Unclassified 886
24 Ga0070675_100075539 3300005354 Bacteria 2801
25 Ga0070675_100413846 3300005354 Unclassified 1204
26 Ga0070675_100427080 3300005354 Unclassified 1186
27 Ga0070671_100561216 3300005355 Unclassified 985
28 Ga0070674_100005329 3300005356 Bacteria 7416
29 Ga0070674_100047522 3300005356 Unclassified 2941
30 Ga0070674_100137478 3300005356 Bacteria 1830
31 Ga0070674_100276647 3300005356 Bacteria 1329
32 Ga0070673_100053934 3300005364 Unclassified 3161
33 Ga0070659_100053371 3300005366 Unclassified 3181
34 Ga0070659_100495693 3300005366 Unclassified 1041
35 Ga0070703_10008360 3300005406 Unclassified 2909
36 Ga0070701_10002027 3300005438 Bacteria 7679
37 Ga0070701_10361182 3300005438 Bacteria 910
38 Ga0070705_100018225 3300005440 Bacteria 3676
39 Ga0070705_100122629 3300005440 Unclassified 1681
40 Ga0070705_100135096 3300005440 Unclassified 1615
41 Ga0070705_100144159 3300005440 Unclassified 1571
42 Ga0070705_100182854 3300005440 Bacteria 1421
43 Ga0070705_100601549 3300005440 Unclassified 851
44 Ga0070700_100877594 3300005441 Unclassified 729
45 Ga0070694_100071786 3300005444 Bacteria 2387
46 Ga0070694_100135905 3300005444 Bacteria 1781
47 Ga0070708_100099574 3300005445 Unclassified 2659
48 Ga0070708_100106216 3300005445 Unclassified 2577
49 Ga0070708_100623737 3300005445 Bacteria 1016
50 Ga0070663_100176456 3300005455 Bacteria 1655
51 Ga0070663_100343922 3300005455 Bacteria 1206
52 Ga0070678_100009562 3300005456 Bacteria 5882
53 Ga0070678_100306341 3300005456 Bacteria 1352
54 Ga0070678_100992178 3300005456 Bacteria 772
55 Ga0070662_100060908 3300005457 Unclassified 2754
56 Ga0070662_100440658 3300005457 Bacteria 1080
57 Ga0070681_10121250 3300005458 Bacteria 2549
58 Ga0068867_100003110 3300005459 Bacteria 11701
59 Ga0068867_100249960 3300005459 Unclassified 1441
60 Ga0070685_10003033 3300005466 Bacteria 8563
61 Ga0070706_100000164 3300005467 Bacteria 84577
62 Ga0070706_100042536 3300005467 Bacteria 4198
63 Ga0070706_100315707 3300005467 Bacteria 1458
64 Ga0070706_100693316 3300005467 Unclassified 945
65 Ga0070707_100003168 3300005468 Bacteria 15566
66 Ga0070707_100026008 3300005468 Bacteria 5554
67 Ga0070707_100471544 3300005468 Bacteria 1216
68 Ga0070698_100291663 3300005471 Bacteria 1562
69 Ga0070698_100308439 3300005471 Unclassified 1513
70 Ga0070698_100413617 3300005471 Unclassified 1282
71 Ga0070699_100026807 3300005518 Bacteria 4971
72 Ga0070699_100081160 3300005518 Unclassified 2827
73 Ga0070699_100132148 3300005518 Bacteria 2200
74 Ga0070699_100870194 3300005518 Bacteria 825
75 Ga0070679_100532513 3300005530 Bacteria 1119
76 Ga0070684_100080087 3300005535 Bacteria 2889
77 Ga0070684_100092907 3300005535 Unclassified 2685
78 Ga0070697_100028779 3300005536 Bacteria 4451
79 Ga0070697_100042273 3300005536 Bacteria 3688
80 Ga0070697_100069364 3300005536 Bacteria 2887
81 Ga0070697_100650035 3300005536 Unclassified 929
82 Ga0068853_100906549 3300005539 Unclassified 847
83 Ga0070672_100074560 3300005543 Unclassified 2707
84 Ga0070672_100707038 3300005543 Bacteria 883
85 Ga0070686_100008576 3300005544 Bacteria 5726
86 Ga0070686_100041124 3300005544 Unclassified 2887
87 Ga0070686_100155118 3300005544 Bacteria 1607
88 Ga0070695_100006210 3300005545 Bacteria 7057
89 Ga0070695_100025166 3300005545 Bacteria 3673
90 Ga0070695_100029684 3300005545 Bacteria 3399
91 Ga0070696_100019385 3300005546 Bacteria 4606
92 Ga0070696_100034086 3300005546 Bacteria 3501
93 Ga0070696_100156648 3300005546 Bacteria 1676
94 Ga0070696_100335845 3300005546 Bacteria 1166
95 Ga0070696_100342339 3300005546 Bacteria 1156
96 Ga0070693_100022566 3300005547 Bacteria 3349
97 Ga0070693_100036710 3300005547 Unclassified 2727
98 Ga0070693_100079057 3300005547 Bacteria 1956
99 Ga0070693_100357139 3300005547 Archaea 1002
100 Ga0070693_100392519 3300005547 Bacteria 960
101 Ga0070693_100453152 3300005547 Bacteria 901
102 Ga0070693_100506890 3300005547 Unclassified 857
103 Ga0070704_100061353 3300005549 Unclassified 2690
104 Ga0068855_100283517 3300005563 Unclassified 1839
105 Ga0068855_101069666 3300005563 Bacteria 845
106 Ga0070664_100007312 3300005564 Bacteria 8903
107 Ga0068857_100071295 3300005577 Bacteria 3095
108 Ga0068857_100429517 3300005577 Bacteria 1233
109 Ga0068854_100070326 3300005578 Bacteria 2558
110 Ga0068854_100177445 3300005578 Bacteria 1662
111 Ga0068856_100377330 3300005614 Bacteria 1437
112 Ga0068856_101198697 3300005614 Bacteria 776
113 Ga0068856_101276396 3300005614 Unclassified 750
114 Ga0070702_100000577 3300005615 Bacteria 13406
115 Ga0070702_100143545 3300005615 Unclassified 1523
116 Ga0068852_100193542 3300005616 Bacteria 1920
117 Ga0068859_100014014 3300005617 Bacteria 8039
118 Ga0068864_100057005 3300005618 Bacteria 3375
119 Ga0068866_10041868 3300005718 Bacteria 2276
120 Ga0068861_100395617 3300005719 Bacteria 1225
121 Ga0068861_100478354 3300005719 Bacteria 1122
122 Ga0068870_10014405 3300005840 Bacteria 3733
123 Ga0068863_100037025 3300005841 Unclassified 4646
124 Ga0068863_100178789 3300005841 Bacteria 2037
125 Ga0068863_100756687 3300005841 Unclassified 968
126 Ga0068860_100012515 3300005843 Bacteria 8353
127 Ga0068862_100109182 3300005844 Bacteria 2427
128 Ga0068862_100443922 3300005844 Unclassified 1222
129 Ga0081539_10020557 3300005985 Bacteria 4455
130 Ga0075365_10583478 3300006038 Bacteria 791
131 Ga0075432_10046438 3300006058 Bacteria 1525
132 Ga0070716_100229624 3300006173 Bacteria 1252
133 Ga0097621_100591274 3300006237 Bacteria 1013
134 Ga0068871_100676663 3300006358 Archaea 944
135 Ga0075428_100042054 3300006844 Bacteria 5026
136 Ga0075431_100132292 3300006847 Unclassified 2573
137 Ga0075433_10046899 3300006852 Bacteria 3758
138 Ga0075433_10062481 3300006852 Bacteria 3261
139 Ga0075433_10274355 3300006852 Unclassified 1494
140 Ga0075434_100058875 3300006871 Bacteria 3818
141 Ga0075434_100122503 3300006871 Unclassified 2616
142 Ga0075434_100360634 3300006871 Bacteria 1474
143 Ga0075434_101447790 3300006871 Unclassified 697
144 Ga0068865_100038498 3300006881 Bacteria 3237
145 Ga0068865_100183731 3300006881 Unclassified 1612
146 Ga0097620_100014013 3300006931 Bacteria 8039
147 Ga0075435_100107080 3300007076 Unclassified 2322
148 Ga0075435_100308079 3300007076 Bacteria 1355
149 Ga0075435_100356567 3300007076 Unclassified 1254
150 Ga0105244_10178334 3300009036 Bacteria 1008
151 Ga0105240_10519070 3300009093 Unclassified 1322
152 Ga0105240_10994280 3300009093 Archaea 897
153 Ga0111539_10016989 3300009094 Bacteria 9006
154 Ga0111539_10415244 3300009094 Bacteria 1567
155 Ga0105245_10049291 3300009098 Bacteria 3771
156 Ga0105245_10110638 3300009098 Unclassified 2554
157 Ga0105245_10129355 3300009098 Bacteria 2367
158 Ga0105245_10413403 3300009098 Bacteria 1350
159 Ga0105245_10421894 3300009098 Bacteria 1337
160 Ga0105245_10518709 3300009098 Bacteria 1210
161 Ga0114129_10016528 3300009147 Bacteria 10506
162 Ga0114129_10035974 3300009147 Bacteria 6993
163 Ga0114129_10050093 3300009147 Bacteria 5868
164 Ga0114129_10180502 3300009147 Unclassified 2872
165 Ga0114129_10342736 3300009147 Bacteria 1982
166 Ga0114129_10938063 3300009147 Bacteria 1094
167 Ga0114129_11124331 3300009147 Bacteria 982
168 Ga0114129_11559512 3300009147 Unclassified 810
169 Ga0105243_10115796 3300009148 Unclassified 2251
170 Ga0105243_10155387 3300009148 Bacteria 1967
171 Ga0105243_10415599 3300009148 Unclassified 1253
172 Ga0105243_10475112 3300009148 Bacteria 1178
173 Ga0105243_10499229 3300009148 Bacteria 1153
174 Ga0105243_10714084 3300009148 Bacteria 979
175 Ga0105241_10742243 3300009174 Bacteria 899
176 Ga0105242_10041148 3300009176 Bacteria 3726
177 Ga0105242_10908781 3300009176 Bacteria 881
178 Ga0105248_10053794 3300009177 Unclassified 4516
179 Ga0105248_10742675 3300009177 Unclassified 1107
180 Ga0105237_10834966 3300009545 Unclassified 928
181 Ga0105249_10017826 3300009553 Bacteria 6309
182 Ga0105249_10292370 3300009553 Bacteria 1631
183 Ga0105249_10301195 3300009553 Bacteria 1608
184 Ga0105249_11173700 3300009553 Unclassified 839
185 Ga0105239_10061689 3300010375 Bacteria 4115
186 Ga0105239_10228511 3300010375 Bacteria 2088
187 Ga0105239_10856345 3300010375 Bacteria 1042
188 Ga0105246_10075633 3300011119 Bacteria 2384
189 Ga0157374_10265656 3300013296 Bacteria 1691
190 Ga0157378_10060257 3300013297 Unclassified 3387
191 Ga0157378_10162224 3300013297 Bacteria 2091
192 Ga0157378_10368336 3300013297 Unclassified 1408
193 Ga0157378_10540300 3300013297 Unclassified 1169
194 Ga0163162_10185537 3300013306 Unclassified 2207
195 Ga0163162_10487076 3300013306 Bacteria 1364
196 Ga0163162_11005035 3300013306 Unclassified 943
197 Ga0157375_10011240 3300013308 Bacteria 7899
198 Ga0157375_12004631 3300013308 Bacteria 688
199 Ga0163163_10012043 3300014325 Bacteria 7871
200 Ga0163163_10120086 3300014325 Bacteria 2662
201 Ga0163163_10724389 3300014325 Unclassified 1058
202 Ga0157380_10007654 3300014326 Bacteria 7682
203 Ga0157380_10038215 3300014326 Bacteria 3726
204 Ga0157380_10125526 3300014326 Bacteria 2181
205 Ga0157380_10149462 3300014326 Bacteria 2017
206 Ga0157380_11494754 3300014326 Bacteria 728
207 Ga0157377_10017934 3300014745 Bacteria 3671
208 Ga0157379_10847453 3300014968 Unclassified 865
209 Ga0157376_10632303 3300014969 Unclassified 1069
210 Ga0163161_10030104 3300017792 Bacteria 3861
211 Ga0207653_10032437 3300025885 Bacteria 1690
212 Ga0207642_10378858 3300025899 Unclassified 841
213 Ga0207688_10014768 3300025901 Unclassified 4238
214 Ga0207688_10260211 3300025901 Unclassified 1053
215 Ga0207680_10527806 3300025903 Bacteria 842
216 Ga0207645_10301945 3300025907 Unclassified 1066
217 Ga0207643_10000609 3300025908 Bacteria 22613
218 Ga0207643_10464417 3300025908 Bacteria 806
219 Ga0207684_10001080 3300025910 Bacteria 30533
220 Ga0207684_10033892 3300025910 Bacteria 4342
221 Ga0207684_10051529 3300025910 Bacteria 3492
222 Ga0207684_10540566 3300025910 Unclassified 997
223 Ga0207654_10458070 3300025911 Unclassified 895
224 Ga0207707_10454193 3300025912 Bacteria 1096
225 Ga0207707_10726690 3300025912 Bacteria 832
226 Ga0207663_10562693 3300025916 Unclassified 892
227 Ga0207660_10278321 3300025917 Unclassified 1327
228 Ga0207662_10004351 3300025918 Bacteria 7438
229 Ga0207662_10109702 3300025918 Bacteria 1719
230 Ga0207657_10070948 3300025919 Bacteria 2951
231 Ga0207652_10521723 3300025921 Unclassified 1069
232 Ga0207646_10023209 3300025922 Bacteria 5701
233 Ga0207646_10042566 3300025922 Bacteria 4079
234 Ga0207646_10084925 3300025922 Unclassified 2832
235 Ga0207681_10364452 3300025923 Unclassified 1160
236 Ga0207650_10184675 3300025925 Bacteria 1663
237 Ga0207650_10545776 3300025925 Bacteria 971
238 Ga0207659_10043124 3300025926 Bacteria 3167
239 Ga0207659_10381369 3300025926 Bacteria 1176
240 Ga0207687_10085282 3300025927 Bacteria 2291
241 Ga0207687_10166743 3300025927 Bacteria 1695
242 Ga0207644_10922503 3300025931 Unclassified 732
243 Ga0207690_10035912 3300025932 Unclassified 3205
244 Ga0207690_10370229 3300025932 Unclassified 1136
245 Ga0207690_10737089 3300025932 Unclassified 812
246 Ga0207706_10031776 3300025933 Bacteria 4702
247 Ga0207706_10125644 3300025933 Bacteria 2256
248 Ga0207706_11122333 3300025933 Unclassified 656
249 Ga0207709_10070497 3300025935 Bacteria 2217
250 Ga0207709_10301122 3300025935 Unclassified 1192
251 Ga0207670_10024961 3300025936 Bacteria 3744
252 Ga0207669_10268269 3300025937 Unclassified 1280
253 Ga0207704_10139968 3300025938 Bacteria 1691
254 Ga0207704_10593735 3300025938 Unclassified 906
255 Ga0207665_10393205 3300025939 Bacteria 1054
256 Ga0207691_10015057 3300025940 Bacteria 7360
257 Ga0207691_10532986 3300025940 Bacteria 996
258 Ga0207711_10237094 3300025941 Bacteria 1672
259 Ga0207711_10316332 3300025941 Bacteria 1442
260 Ga0207689_10099794 3300025942 Bacteria 2386
261 Ga0207661_10206167 3300025944 Bacteria 1731
262 Ga0207661_10426226 3300025944 Bacteria 1205
263 Ga0207679_10323413 3300025945 Bacteria 1336
264 Ga0207679_10775941 3300025945 Bacteria 873
265 Ga0207651_10089926 3300025960 Bacteria 2243
266 Ga0207712_10098267 3300025961 Unclassified 2171
267 Ga0207712_10180854 3300025961 Unclassified 1656
268 Ga0207712_10282926 3300025961 Bacteria 1354
269 Ga0207712_10344566 3300025961 Unclassified 1237
270 Ga0207712_10789843 3300025961 Bacteria 834
271 Ga0207668_10066899 3300025972 Bacteria 2549
272 Ga0207677_10295432 3300026023 Bacteria 1336
273 Ga0207677_10725646 3300026023 Bacteria 884
274 Ga0207639_10652278 3300026041 Unclassified 974
275 Ga0207678_10012791 3300026067 Bacteria 7369
276 Ga0207708_10002055 3300026075 Bacteria 14820
277 Ga0207708_10213321 3300026075 Unclassified 1544
278 Ga0207708_10313827 3300026075 Unclassified 1278
279 Ga0207708_10767274 3300026075 Unclassified 828
280 Ga0207702_10398627 3300026078 Unclassified 1327
281 Ga0207641_10140146 3300026088 Bacteria 2181
282 Ga0207641_10357817 3300026088 Bacteria 1393
283 Ga0207641_10471408 3300026088 Unclassified 1216
284 Ga0207648_10016811 3300026089 Bacteria 6671
285 Ga0207648_10200092 3300026089 Unclassified 1771
286 Ga0207648_10221425 3300026089 Bacteria 1682
287 Ga0207648_10616360 3300026089 Unclassified 1001
288 Ga0207676_10062376 3300026095 Bacteria 2956
289 Ga0207674_10010314 3300026116 Bacteria 10597
290 Ga0207674_10350177 3300026116 Bacteria 1428
291 Ga0207674_10650365 3300026116 Bacteria 1018
292 Ga0207675_100066315 3300026118 Unclassified 3374
293 Ga0207675_100901411 3300026118 Unclassified 900
294 Ga0207683_10029482 3300026121 Bacteria 4751
295 Ga0207683_10090675 3300026121 Bacteria 2722
296 Ga0207683_10362131 3300026121 Bacteria 1332
297 Ga0207683_10743825 3300026121 Bacteria 910
298 Ga0207698_10892551 3300026142 Bacteria 896
299 Ga0209998_10020478 3300027717 Bacteria 1415
300 Ga0209974_10088749 3300027876 Bacteria 1070
301 Ga0207428_10044126 3300027907 Unclassified 3597
302 Ga0207428_10179784 3300027907 Bacteria 1599
303 Ga0268265_10063232 3300028380 Unclassified 2847
304 Ga0268265_10366579 3300028380 Unclassified 1321
305 Ga0268265_10981591 3300028380 Bacteria 833
306 Ga0268264_11015935 3300028381 Bacteria 836
307 Ga0265337_1076474 3300028556 Unclassified 917
308 Ga0265319_1001119 3300028563 Bacteria 16702
309 Ga0265334_10018895 3300028573 Unclassified 2841
310 Ga0265318_10164571 3300028577 Unclassified 813
311 Ga0265318_10209998 3300028577 Bacteria 711
312 Ga0265336_10024181 3300028666 Bacteria 1921
313 Ga0265336_10046887 3300028666 Unclassified 1312
314 Ga0265338_10010690 3300028800 Bacteria 10724
315 Ga0265338_10158172 3300028800 Bacteria 1753
316 Ga0265324_10000707 3300029957 Bacteria 22228
317 Ga0265330_10076577 3300031235 Unclassified 1444
318 Ga0265330_10120540 3300031235 Unclassified 1118
319 Ga0265332_10049027 3300031238 Bacteria 1816
320 Ga0265320_10003363 3300031240 Bacteria 10785
321 Ga0265320_10170932 3300031240 Unclassified 976
322 Ga0265325_10050757 3300031241 Bacteria 2135
323 Ga0265325_10149276 3300031241 Unclassified 1107
324 Ga0265325_10165759 3300031241 Bacteria 1037
325 Ga0265329_10015055 3300031242 Bacteria 2713
326 Ga0265340_10004720 3300031247 Bacteria 7580
327 Ga0265339_10041434 3300031249 Bacteria 2556
328 Ga0265331_10036125 3300031250 Bacteria 2428
329 Ga0265316_10065219 3300031344 Bacteria 2820
330 Ga0265316_10274692 3300031344 Bacteria 1233
331 Ga0307408_100208808 3300031548 Unclassified 1586
332 Ga0307408_100825785 3300031548 Bacteria 843
333 Ga0265313_10019947 3300031595 Bacteria 3714
334 Ga0316575_10267397 3300031665 Unclassified 719
335 Ga0265314_10001767 3300031711 Bacteria 23327
336 Ga0265314_10319128 3300031711 Bacteria 865
337 Ga0307405_10546985 3300031731 Bacteria 936
338 Ga0307406_10250552 3300031901 Archaea 1334
339 Ga0307407_10086190 3300031903 Unclassified 1913
340 Ga0307409_100249291 3300031995 Bacteria 1622
341 Ga0307409_100574614 3300031995 Bacteria 1110
342 Ga0307416_100007885 3300032002 Bacteria 6814
343 Ga0307416_100119127 3300032002 Bacteria 2348
344 Ga0307416_100708183 3300032002 Unclassified 1096
345 Ga0307411_10570803 3300032005 Unclassified 968
346 Ga0307415_100009989 3300032126 Bacteria 5354
347 Ga0307415_100114150 3300032126 Bacteria 2010
348 Ga0373930_0084589 3300034816 Unclassified 737
349 Ga0373952_0025646 3300035092 Bacteria 1275
350 Ga0373939_0039573 3300035114 Bacteria 1412
351 Ga0373941_0034565 3300035115 Bacteria 1526
352 Ga0373945_0203636 3300035116 Unclassified 823
353 Ga0373943_0116072 3300035170 Unclassified 1418
354 Ga0373961_0162630 3300035241 Unclassified 768
355 Ga0373931_0041923 3300035691 Unclassified 2406
356 Ga0373931_0145096 3300035691 Unclassified 1379
357 Ga0373925_0112132 3300037068 Unclassified 2108
358 Ga0395905_0153520 3300037471 Bacteria 2166
359 Ga0395905_0582063 3300037471 Bacteria 1021
360 Ga0395901_0088623 3300038443 Unclassified 3237
361 Ga0395901_1094527 3300038443 Bacteria 768
362 Ga0395901_1341568 3300038443 Unclassified 676
363 Ga0436365_1434494 3300039437 Bacteria 2903
364 Ga0451833_0701987 3300041491 Unclassified 866
365 Ga0451839_1489197 3300041496 Unclassified 941
366 Ga0451853_2085397 3300041512 Bacteria 723
367 Ga0450923_112362 3300042125 Unclassified 637
368 Ga0451577_0272604 3300042876 Bacteria 1533
369 Ga0453684_0555696 3300044712 Bacteria 1264
370 Ga0466960_0198811 3300044901 Bacteria 1094
371 Ga0466960_0511220 3300044901 Bacteria 705
372 Ga0451576_0836549 3300045051 Unclassified 966
373 Ga0495592_0194295 3300046454 Bacteria 1374
374 Ga0495603_0376683 3300046455 Unclassified 814
375 Ga0495629_0332341 3300046459 Bacteria 1038
376 Ga0495629_0602484 3300046459 Unclassified 735
377 Ga0495641_0194926 3300046461 Bacteria 908
378 Ga0495653_0082734 3300046463 Unclassified 2369
379 Ga0495639_0066108 3300046475 Bacteria 1664
380 Ga0495664_0513357 3300046477 Bacteria 715
381 Ga0495594_0330816 3300046499 Unclassified 868
382 Ga0495594_0381943 3300046499 Bacteria 802
383 Ga0495618_0697979 3300046514 Unclassified 597
384 Ga0495628_0875247 3300046516 Bacteria 625
385 Ga0495630_0177450 3300046517 Unclassified 1624
386 Ga0495663_0190598 3300046525 Unclassified 713
387 Ga0495663_0244422 3300046525 Unclassified 636
388 Ga0495666_0102691 3300046526 Bacteria 1347
389 Ga0495640_0223000 3300046533 Unclassified 1188
390 Ga0495640_0378028 3300046533 Unclassified 872
391 Ga0495586_0124797 3300046535 Bacteria 1440
392 Ga0495587_0449050 3300046536 Bacteria 714
393 Ga0495645_0245049 3300046543 Bacteria 1194
394 Ga0495656_0327105 3300046615 Bacteria 791
395 Ga0495634_0429930 3300046642 Bacteria 781
396 Ga0495635_0158364 3300046663 Unclassified 1541
397 Ga0495659_0169401 3300046664 Bacteria 885
398 Ga0495657_0255478 3300046675 Unclassified 1054
399 Ga0495599_0161515 3300046678 Bacteria 1385
400 Ga0495599_0365705 3300046678 Bacteria 863
401 Ga0495647_0184408 3300046681 Bacteria 909
402 Ga0495647_0282701 3300046681 Unclassified 744
403 Ga0495658_0119030 3300046683 Bacteria 1596
404 Ga0495658_0249338 3300046683 Unclassified 1116
405 Ga0495658_0423882 3300046683 Unclassified 849
406 Ga0495613_0511377 3300046689 Unclassified 808
407 Ga0495604_0505793 3300047317 Bacteria 783
408 Ga0495674_0879335 3300047319 Bacteria 693
409 Ga0495680_0476613 3300047322 Unclassified 850
410 Ga0495675_0202732 3300047444 Bacteria 1207
411 Ga0495684_0814421 3300047471 Bacteria 609
412 Ga0495593_0523231 3300047673 Unclassified 595
413 Ga0496100_1135447 3300048903 Unclassified 616
414 Ga0496101_0061236 3300048904 Unclassified 2733
415 Ga0496102_0036687 3300048905 Bacteria 4417
416 Ga0496102_0112135 3300048905 Bacteria 2543
417 Ga0496102_0281353 3300048905 Unclassified 1568
418 Ga0496102_0423797 3300048905 Bacteria 1250
419 Ga0496102_0578600 3300048905 Bacteria 1046
420 Ga0496102_0719991 3300048905 Unclassified 921
421 Ga0496102_1244974 3300048905 Bacteria 663
422 Ga0496103_0100232 3300048906 Bacteria 1833
423 Ga0496103_0196085 3300048906 Bacteria 1298
424 Ga0496103_0309434 3300048906 Bacteria 1016
425 Ga0496104_0018099 3300048907 Bacteria 6424
426 Ga0496104_0732316 3300048907 Unclassified 896
427 Ga0496105_0353296 3300048908 Unclassified 1174
428 Ga0496105_0558797 3300048908 Unclassified 892
429 Ga0496106_0022372 3300048909 Bacteria 4695
430 Ga0496106_0191773 3300048909 Bacteria 1625
431 Ga0496106_0382376 3300048909 Unclassified 1131
432 Ga0496106_0700813 3300048909 Bacteria 807
433 Ga0496107_0100366 3300048910 Bacteria 2122
434 Ga0496107_0149399 3300048910 Unclassified 1728
435 Ga0496107_0557395 3300048910 Unclassified 848
436 Ga0496107_0705668 3300048910 Unclassified 742
437 Ga0496108_0065030 3300048911 Bacteria 3073
438 Ga0496108_0350811 3300048911 Unclassified 1287
439 Ga0496109_0026593 3300048912 Bacteria 5161
440 Ga0496109_0051970 3300048912 Bacteria 3733
441 Ga0496109_0926754 3300048912 Bacteria 809
442 Ga0496109_1023415 3300048912 Unclassified 763
443 Ga0496110_0144304 3300048913 Bacteria 2153
444 Ga0496110_0417167 3300048913 Bacteria 1224
445 Ga0496110_0541211 3300048913 Bacteria 1058
446 Ga0496111_0035466 3300048914 Bacteria 3565
447 Ga0496111_0427866 3300048914 Unclassified 978
448 Ga0496112_0000001 3300048915 Bacteria 1346031
449 Ga0496112_0013312 3300048915 Bacteria 7594
450 Ga0496112_0290255 3300048915 Bacteria 1582
451 Ga0496112_0390276 3300048915 Unclassified 1332
452 Ga0496113_0028942 3300048916 Bacteria 3992
453 Ga0496113_0125217 3300048916 Bacteria 2012
454 Ga0496113_0182405 3300048916 Bacteria 1664
455 Ga0496114_0285258 3300048917 Bacteria 1456
456 Ga0496114_0697779 3300048917 Unclassified 890
457 Ga0496114_0941099 3300048917 Bacteria 746
458 Ga0501031_0015897 3300049568 Bacteria 4887
459 Ga0501031_0026546 3300049568 Bacteria 3776
460 Ga0501032_0223460 3300049569 Unclassified 1225
461 Ga0501032_0239915 3300049569 Bacteria 1178
462 Ga0501033_0507510 3300049570 Unclassified 834
463 Ga0501036_0071487 3300049572 Bacteria 2934
464 Ga0501036_0194290 3300049572 Bacteria 1707
465 Ga0501037_0187378 3300049573 Bacteria 1466
466 Ga0501038_0069477 3300049574 Bacteria 2992
467 Ga0501038_0202898 3300049574 Unclassified 1590
468 Ga0501038_0237589 3300049574 Unclassified 1448
469 Ga0501039_0038752 3300049575 Bacteria 3680
470 Ga0501039_0049197 3300049575 Bacteria 3259
471 Ga0501040_0099746 3300049576 Bacteria 2024
472 Ga0501040_0265773 3300049576 Bacteria 1224
473 Ga0501042_0007255 3300049578 Bacteria 7251
474 Ga0501042_0209763 3300049578 Bacteria 1405
475 Ga0501042_0486721 3300049578 Unclassified 895
476 Ga0501043_0151646 3300049579 Unclassified 1814
477 Ga0501046_0057152 3300049580 Bacteria 3061
478 Ga0501048_0010191 3300049582 Bacteria 7030
479 Ga0501048_0045104 3300049582 Bacteria 3150
480 Ga0501048_0233782 3300049582 Unclassified 1304
481 Ga0501048_0538730 3300049582 Unclassified 837
482 Ga0501067_0065753 3300049583 Bacteria 2007
483 Ga0501067_0115911 3300049583 Unclassified 1490
484 Ga0501067_0313544 3300049583 Bacteria 874
485 Ga0501068_0221284 3300049584 Bacteria 1203
486 Ga0501068_0341135 3300049584 Bacteria 962
487 Ga0501069_0099181 3300049585 Bacteria 1653
488 Ga0501069_0296242 3300049585 Bacteria 948
489 Ga0501070_0624482 3300049586 Bacteria 857
490 Ga0501070_0688747 3300049586 Unclassified 809
491 Ga0501071_0129332 3300049587 Bacteria 1875
492 Ga0501072_0038909 3300049588 Bacteria 3733
493 Ga0501072_0264770 3300049588 Bacteria 1368
494 Ga0501073_0394435 3300049589 Unclassified 956
495 Ga0501073_0490166 3300049589 Bacteria 850
496 Ga0501074_0039717 3300049590 Bacteria 3408
497 Ga0501074_0466265 3300049590 Unclassified 895
498 Ga0501075_0019563 3300049591 Bacteria 4915
499 Ga0501075_0040303 3300049591 Bacteria 3497
500 Ga0501075_0224194 3300049591 Unclassified 1434
501 Ga0501075_0292286 3300049591 Bacteria 1241
502 Ga0501075_0395292 3300049591 Unclassified 1054
503 Ga0501075_0746503 3300049591 Unclassified 745
504 Ga0501076_0031582 3300049592 Bacteria 4132
505 Ga0501076_0074046 3300049592 Bacteria 2727
506 Ga0501076_0202865 3300049592 Unclassified 1620
507 Ga0501076_0268041 3300049592 Bacteria 1398
508 Ga0501076_0695264 3300049592 Bacteria 839
509 Ga0501077_0167166 3300049593 Unclassified 1397
510 Ga0501209_053423 3300049656 Unclassified 1109
511 Ga0501221_051106 3300049704 Unclassified 931
512 Ga0501079_0019303 3300049741 Bacteria 5207
513 Ga0501079_0474919 3300049741 Bacteria 982
514 Ga0501079_0723288 3300049741 Unclassified 783
515 Ga0501080_0109620 3300049742 Unclassified 2559
516 Ga0501080_0357912 3300049742 Bacteria 1317
517 Ga0501081_0511500 3300049743 Unclassified 895
518 Ga0501083_0369413 3300049744 Unclassified 933
519 Ga0501035_0237599 3300049822 Unclassified 1551
520 Ga0501035_0515250 3300049822 Unclassified 983
521 Ga0501044_0888007 3300049823 Unclassified 767
522 Ga0501045_0007568 3300049824 Bacteria 7550
523 Ga0501045_0142802 3300049824 Bacteria 1780
524 Ga0501045_0189920 3300049824 Bacteria 1531
525 Ga0501045_0567369 3300049824 Unclassified 841
526 nmdc:mga05p37_1019577_c1 3300050507 Bacteria 877
527 nmdc:mga05p37_437072_c1 3300050507 Bacteria 1519
528 nmdc:mga05p37_445961_c1 3300050507 Unclassified 1499
529 nmdc:mga05p37_655724_c1 3300050507 Unclassified 1174
530 nmdc:mga05p37_686937_c1 3300050507 Unclassified 1140
531 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
532 nmdc:mga05p37_925578_c1 3300050507 Unclassified 936
533 nmdc:mga09592_314374_c1 3300050508 Unclassified 1357
534 nmdc:mga06r32_121945_c1 3300050510 Unclassified 2572
535 nmdc:mga06r32_789410_c1 3300050510 Bacteria 911
536 nmdc:mga08y16_177513_c1 3300050511 Bacteria 2212
537 nmdc:mga08y16_315399_c1 3300050511 Bacteria 1610
538 nmdc:mga08y16_375944_c1 3300050511 Unclassified 1457
539 nmdc:mga0n895_1018814_c1 3300050512 Unclassified 808
540 nmdc:mga0n895_113089_c1 3300050512 Unclassified 2732
541 nmdc:mga0n895_90601_c1 3300050512 Unclassified 3060
542 nmdc:mga0n895_911874_c1 3300050512 Bacteria 864
543 nmdc:mga0n895_927753_c1 3300050512 Unclassified 855
544 nmdc:mga0rr50_112539_c1 3300050513 Bacteria 2156
545 nmdc:mga0a205_261815_c1 3300050515 Bacteria 1607
546 nmdc:mga0a205_299960_c1 3300050515 Bacteria 1480
547 nmdc:mga0a205_308010_c1 3300050515 Unclassified 1456
548 nmdc:mga0a205_40083_c1 3300050515 Bacteria 4508
549 nmdc:mga0a205_847994_c1 3300050515 Unclassified 761
550 Ga0495601_0062570 3300053077 Unclassified 2364
551 Ga0495601_0145709 3300053077 Bacteria 1546
552 Ga0495601_0371285 3300053077 Bacteria 929
553 Ga0495612_0098581 3300053078 Unclassified 1243
554 Ga0495619_0050275 3300053085 Bacteria 2751
555 Ga0501084_0065537 3300054114 Bacteria 3039
556 Ga0501084_0138193 3300054114 Bacteria 2051
557 Ga0501084_0176268 3300054114 Bacteria 1805
558 Ga0501084_0392102 3300054114 Bacteria 1173
559 Ga0501082_0037877 3300060353 Bacteria 4159
560 Ga0501082_0732850 3300060353 Unclassified 865
561 Ga0501082_0830193 3300060353 Unclassified 808
562 Ga0501082_1162702 3300060353 Unclassified 674
563 Ga0530510_0079907 3300061734 Bacteria 2379
564 Ga0530510_0259423 3300061734 Bacteria 1296
565 Ga0530510_0478972 3300061734 Bacteria 943
566 Ga0530510_0605244 3300061734 Bacteria 833
567 Ga0070697_100505675
568 JGI24033J26618_1019346
569 JGI24742J22300_10046340
570 Ga0070683_100181529
571 Ga0070690_100006052
572 Ga0070670_100063583
573 Ga0070670_100421756
574 Ga0068869_100840235
575 Ga0068869_100948979
576 Ga0068868_100109897
577 Ga0068868_100649041
578 Ga0068868_100652690
579 Ga0070660_100139996
580 Ga0070689_100084523
581 Ga0070691_10200114
582 Ga0070687_100086913
583 Ga0070687_100147113
584 Ga0070692_10057583
585 Ga0070692_10108582
586 Ga0070668_100096161
587 Ga0070668_100590141
588 Ga0070669_100427666
589 Ga0070669_100651829
590 Ga0070675_100075539
591 Ga0070675_100413846
592 Ga0070675_100427080
593 Ga0070671_100561216
594 Ga0070674_100005329
595 Ga0070674_100047522
596 Ga0070674_100137478
597 Ga0070674_100276647
598 Ga0070673_100053934
599 Ga0070659_100053371
600 Ga0070659_100495693
601 Ga0070703_10008360
602 Ga0070701_10002027
603 Ga0070701_10361182
604 Ga0070705_100018225
605 Ga0070705_100122629
606 Ga0070705_100135096
607 Ga0070705_100144159
608 Ga0070705_100182854
609 Ga0070705_100601549
610 Ga0070700_100877594
611 Ga0070694_100071786
612 Ga0070694_100135905
613 Ga0070708_100099574
614 Ga0070708_100106216
615 Ga0070708_100623737
616 Ga0070663_100176456
617 Ga0070663_100343922
618 Ga0070678_100009562
619 Ga0070678_100306341
620 Ga0070678_100992178
621 Ga0070662_100060908
622 Ga0070662_100440658
623 Ga0070681_10121250
624 Ga0068867_100003110
625 Ga0068867_100249960
626 Ga0070685_10003033
627 Ga0070706_100000164
628 Ga0070706_100042536
629 Ga0070706_100315707
630 Ga0070706_100693316
631 Ga0070707_100003168
632 Ga0070707_100026008
633 Ga0070707_100471544
634 Ga0070698_100291663
635 Ga0070698_100308439
636 Ga0070698_100413617
637 Ga0070699_100026807
638 Ga0070699_100081160
639 Ga0070699_100132148
640 Ga0070699_100870194
641 Ga0070679_100532513
642 Ga0070684_100080087
643 Ga0070684_100092907
644 Ga0070697_100028779
645 Ga0070697_100042273
646 Ga0070697_100069364
647 Ga0070697_100650035
648 Ga0068853_100906549
649 Ga0070672_100074560
650 Ga0070672_100707038
651 Ga0070686_100008576
652 Ga0070686_100041124
653 Ga0070686_100155118
654 Ga0070695_100006210
655 Ga0070695_100025166
656 Ga0070695_100029684
657 Ga0070696_100019385
658 Ga0070696_100034086
659 Ga0070696_100156648
660 Ga0070696_100335845
661 Ga0070696_100342339
662 Ga0070693_100022566
663 Ga0070693_100036710
664 Ga0070693_100079057
665 Ga0070693_100357139
666 Ga0070693_100392519
667 Ga0070693_100453152
668 Ga0070693_100506890
669 Ga0070704_100061353
670 Ga0068855_100283517
671 Ga0068855_101069666
672 Ga0070664_100007312
673 Ga0068857_100071295
674 Ga0068857_100429517
675 Ga0068854_100070326
676 Ga0068854_100177445
677 Ga0068856_100377330
678 Ga0068856_101198697
679 Ga0068856_101276396
680 Ga0070702_100000577
681 Ga0070702_100143545
682 Ga0068852_100193542
683 Ga0068859_100014014
684 Ga0068864_100057005
685 Ga0068866_10041868
686 Ga0068861_100395617
687 Ga0068861_100478354
688 Ga0068870_10014405
689 Ga0068863_100037025
690 Ga0068863_100178789
691 Ga0068863_100756687
692 Ga0068860_100012515
693 Ga0068862_100109182
694 Ga0068862_100443922
695 Ga0081539_10020557
696 Ga0075365_10583478
697 Ga0075432_10046438
698 Ga0070716_100229624
699 Ga0097621_100591274
700 Ga0068871_100676663
701 Ga0075428_100042054
702 Ga0075431_100132292
703 Ga0075433_10046899
704 Ga0075433_10062481
705 Ga0075433_10274355
706 Ga0075434_100058875
707 Ga0075434_100122503
708 Ga0075434_100360634
709 Ga0075434_101447790
710 Ga0068865_100038498
711 Ga0068865_100183731
712 Ga0097620_100014013
713 Ga0075435_100107080
714 Ga0075435_100308079
715 Ga0075435_100356567
716 Ga0105244_10178334
717 Ga0105240_10519070
718 Ga0105240_10994280
719 Ga0111539_10016989
720 Ga0111539_10415244
721 Ga0105245_10049291
722 Ga0105245_10110638
723 Ga0105245_10129355
724 Ga0105245_10413403
725 Ga0105245_10421894
726 Ga0105245_10518709
727 Ga0114129_10016528
728 Ga0114129_10035974
729 Ga0114129_10050093
730 Ga0114129_10180502
731 Ga0114129_10342736
732 Ga0114129_10938063
733 Ga0114129_11124331
734 Ga0114129_11559512
735 Ga0105243_10115796
736 Ga0105243_10155387
737 Ga0105243_10415599
738 Ga0105243_10475112
739 Ga0105243_10499229
740 Ga0105243_10714084
741 Ga0105241_10742243
742 Ga0105242_10041148
743 Ga0105242_10908781
744 Ga0105248_10053794
745 Ga0105248_10742675
746 Ga0105237_10834966
747 Ga0105249_10017826
748 Ga0105249_10292370
749 Ga0105249_10301195
750 Ga0105249_11173700
751 Ga0105239_10061689
752 Ga0105239_10228511
753 Ga0105239_10856345
754 Ga0105246_10075633
755 Ga0157374_10265656
756 Ga0157378_10060257
757 Ga0157378_10162224
758 Ga0157378_10368336
759 Ga0157378_10540300
760 Ga0163162_10185537
761 Ga0163162_10487076
762 Ga0163162_11005035
763 Ga0157375_10011240
764 Ga0157375_12004631
765 Ga0163163_10012043
766 Ga0163163_10120086
767 Ga0163163_10724389
768 Ga0157380_10007654
769 Ga0157380_10038215
770 Ga0157380_10125526
771 Ga0157380_10149462
772 Ga0157380_11494754
773 Ga0157377_10017934
774 Ga0157379_10847453
775 Ga0157376_10632303
776 Ga0163161_10030104
777 Ga0207653_10032437
778 Ga0207642_10378858
779 Ga0207688_10014768
780 Ga0207688_10260211
781 Ga0207680_10527806
782 Ga0207645_10301945
783 Ga0207643_10000609
784 Ga0207643_10464417
785 Ga0207684_10001080
786 Ga0207684_10033892
787 Ga0207684_10051529
788 Ga0207684_10540566
789 Ga0207654_10458070
790 Ga0207707_10454193
791 Ga0207707_10726690
792 Ga0207663_10562693
793 Ga0207660_10278321
794 Ga0207662_10004351
795 Ga0207662_10109702
796 Ga0207657_10070948
797 Ga0207652_10521723
798 Ga0207646_10023209
799 Ga0207646_10042566
800 Ga0207646_10084925
801 Ga0207681_10364452
802 Ga0207650_10184675
803 Ga0207650_10545776
804 Ga0207659_10043124
805 Ga0207659_10381369
806 Ga0207687_10085282
807 Ga0207687_10166743
808 Ga0207644_10922503
809 Ga0207690_10035912
810 Ga0207690_10370229
811 Ga0207690_10737089
812 Ga0207706_10031776
813 Ga0207706_10125644
814 Ga0207706_11122333
815 Ga0207709_10070497
816 Ga0207709_10301122
817 Ga0207670_10024961
818 Ga0207669_10268269
819 Ga0207704_10139968
820 Ga0207704_10593735
821 Ga0207665_10393205
822 Ga0207691_10015057
823 Ga0207691_10532986
824 Ga0207711_10237094
825 Ga0207711_10316332
826 Ga0207689_10099794
827 Ga0207661_10206167
828 Ga0207661_10426226
829 Ga0207679_10323413
830 Ga0207679_10775941
831 Ga0207651_10089926
832 Ga0207712_10098267
833 Ga0207712_10180854
834 Ga0207712_10282926
835 Ga0207712_10344566
836 Ga0207712_10789843
837 Ga0207668_10066899
838 Ga0207677_10295432
839 Ga0207677_10725646
840 Ga0207639_10652278
841 Ga0207678_10012791
842 Ga0207708_10002055
843 Ga0207708_10213321
844 Ga0207708_10313827
845 Ga0207708_10767274
846 Ga0207702_10398627
847 Ga0207641_10140146
848 Ga0207641_10357817
849 Ga0207641_10471408
850 Ga0207648_10016811
851 Ga0207648_10200092
852 Ga0207648_10221425
853 Ga0207648_10616360
854 Ga0207676_10062376
855 Ga0207674_10010314
856 Ga0207674_10350177
857 Ga0207674_10650365
858 Ga0207675_100066315
859 Ga0207675_100901411
860 Ga0207683_10029482
861 Ga0207683_10090675
862 Ga0207683_10362131
863 Ga0207683_10743825
864 Ga0207698_10892551
865 Ga0209998_10020478
866 Ga0209974_10088749
867 Ga0207428_10044126
868 Ga0207428_10179784
869 Ga0268265_10063232
870 Ga0268265_10366579
871 Ga0268265_10981591
872 Ga0268264_11015935
873 Ga0265337_1076474
874 Ga0265319_1001119
875 Ga0265334_10018895
876 Ga0265318_10164571
877 Ga0265318_10209998
878 Ga0265336_10024181
879 Ga0265336_10046887
880 Ga0265338_10010690
881 Ga0265338_10158172
882 Ga0265324_10000707
883 Ga0265330_10076577
884 Ga0265330_10120540
885 Ga0265332_10049027
886 Ga0265320_10003363
887 Ga0265320_10170932
888 Ga0265325_10050757
889 Ga0265325_10149276
890 Ga0265325_10165759
891 Ga0265329_10015055
892 Ga0265340_10004720
893 Ga0265339_10041434
894 Ga0265331_10036125
895 Ga0265316_10065219
896 Ga0265316_10274692
897 Ga0307408_100208808
898 Ga0307408_100825785
899 Ga0265313_10019947
900 Ga0316575_10267397
901 Ga0265314_10001767
902 Ga0265314_10319128
903 Ga0307405_10546985
904 Ga0307406_10250552
905 Ga0307407_10086190
906 Ga0307409_100249291
907 Ga0307409_100574614
908 Ga0307416_100007885
909 Ga0307416_100119127
910 Ga0307416_100708183
911 Ga0307411_10570803
912 Ga0307415_100009989
913 Ga0307415_100114150
914 Ga0373930_0084589
915 Ga0373952_0025646
916 Ga0373939_0039573
917 Ga0373941_0034565
918 Ga0373945_0203636
919 Ga0373943_0116072
920 Ga0373961_0162630
921 Ga0373931_0041923
922 Ga0373931_0145096
923 Ga0373925_0112132
924 Ga0395905_0153520
925 Ga0395905_0582063
926 Ga0395901_0088623
927 Ga0395901_1094527
928 Ga0395901_1341568
929 Ga0436365_1434494
930 Ga0451833_0701987
931 Ga0451839_1489197
932 Ga0451853_2085397
933 Ga0450923_112362
934 Ga0451577_0272604
935 Ga0453684_0555696
936 Ga0466960_0198811
937 Ga0466960_0511220
938 Ga0451576_0836549
939 Ga0495592_0194295
940 Ga0495603_0376683
941 Ga0495629_0332341
942 Ga0495629_0602484
943 Ga0495641_0194926
944 Ga0495653_0082734
945 Ga0495639_0066108
946 Ga0495664_0513357
947 Ga0495594_0330816
948 Ga0495594_0381943
949 Ga0495618_0697979
950 Ga0495628_0875247
951 Ga0495630_0177450
952 Ga0495663_0190598
953 Ga0495663_0244422
954 Ga0495666_0102691
955 Ga0495640_0223000
956 Ga0495640_0378028
957 Ga0495586_0124797
958 Ga0495587_0449050
959 Ga0495645_0245049
960 Ga0495656_0327105
961 Ga0495634_0429930
962 Ga0495635_0158364
963 Ga0495659_0169401
964 Ga0495657_0255478
965 Ga0495599_0161515
966 Ga0495599_0365705
967 Ga0495647_0184408
968 Ga0495647_0282701
969 Ga0495658_0119030
970 Ga0495658_0249338
971 Ga0495658_0423882
972 Ga0495613_0511377
973 Ga0495604_0505793
974 Ga0495674_0879335
975 Ga0495680_0476613
976 Ga0495675_0202732
977 Ga0495684_0814421
978 Ga0495593_0523231
979 Ga0496100_1135447
980 Ga0496101_0061236
981 Ga0496102_0036687
982 Ga0496102_0112135
983 Ga0496102_0281353
984 Ga0496102_0423797
985 Ga0496102_0578600
986 Ga0496102_0719991
987 Ga0496102_1244974
988 Ga0496103_0100232
989 Ga0496103_0196085
990 Ga0496103_0309434
991 Ga0496104_0018099
992 Ga0496104_0732316
993 Ga0496105_0353296
994 Ga0496105_0558797
995 Ga0496106_0022372
996 Ga0496106_0191773
997 Ga0496106_0382376
998 Ga0496106_0700813
999 Ga0496107_0100366
1000 Ga0496107_0149399
1001 Ga0496107_0557395
1002 Ga0496107_0705668
1003 Ga0496108_0065030
1004 Ga0496108_0350811
1005 Ga0496109_0026593
1006 Ga0496109_0051970
1007 Ga0496109_0926754
1008 Ga0496109_1023415
1009 Ga0496110_0144304
1010 Ga0496110_0417167
1011 Ga0496110_0541211
1012 Ga0496111_0035466
1013 Ga0496111_0427866
1014 Ga0496112_0000001
1015 Ga0496112_0013312
1016 Ga0496112_0290255
1017 Ga0496112_0390276
1018 Ga0496113_0028942
1019 Ga0496113_0125217
1020 Ga0496113_0182405
1021 Ga0496114_0285258
1022 Ga0496114_0697779
1023 Ga0496114_0941099
1024 Ga0501031_0015897
1025 Ga0501031_0026546
1026 Ga0501032_0223460
1027 Ga0501032_0239915
1028 Ga0501033_0507510
1029 Ga0501036_0071487
1030 Ga0501036_0194290
1031 Ga0501037_0187378
1032 Ga0501038_0069477
1033 Ga0501038_0202898
1034 Ga0501038_0237589
1035 Ga0501039_0038752
1036 Ga0501039_0049197
1037 Ga0501040_0099746
1038 Ga0501040_0265773
1039 Ga0501042_0007255
1040 Ga0501042_0209763
1041 Ga0501042_0486721
1042 Ga0501043_0151646
1043 Ga0501046_0057152
1044 Ga0501048_0010191
1045 Ga0501048_0045104
1046 Ga0501048_0233782
1047 Ga0501048_0538730
1048 Ga0501067_0065753
1049 Ga0501067_0115911
1050 Ga0501067_0313544
1051 Ga0501068_0221284
1052 Ga0501068_0341135
1053 Ga0501069_0099181
1054 Ga0501069_0296242
1055 Ga0501070_0624482
1056 Ga0501070_0688747
1057 Ga0501071_0129332
1058 Ga0501072_0038909
1059 Ga0501072_0264770
1060 Ga0501073_0394435
1061 Ga0501073_0490166
1062 Ga0501074_0039717
1063 Ga0501074_0466265
1064 Ga0501075_0019563
1065 Ga0501075_0040303
1066 Ga0501075_0224194
1067 Ga0501075_0292286
1068 Ga0501075_0395292
1069 Ga0501075_0746503
1070 Ga0501076_0031582
1071 Ga0501076_0074046
1072 Ga0501076_0202865
1073 Ga0501076_0268041
1074 Ga0501076_0695264
1075 Ga0501077_0167166
1076 Ga0501209_053423
1077 Ga0501221_051106
1078 Ga0501079_0019303
1079 Ga0501079_0474919
1080 Ga0501079_0723288
1081 Ga0501080_0109620
1082 Ga0501080_0357912
1083 Ga0501081_0511500
1084 Ga0501083_0369413
1085 Ga0501035_0237599
1086 Ga0501035_0515250
1087 Ga0501044_0888007
1088 Ga0501045_0007568
1089 Ga0501045_0142802
1090 Ga0501045_0189920
1091 Ga0501045_0567369
1092 nmdc:mga05p37_1019577_c1
1093 nmdc:mga05p37_437072_c1
1094 nmdc:mga05p37_445961_c1
1095 nmdc:mga05p37_655724_c1
1096 nmdc:mga05p37_686937_c1
1097 nmdc:mga05p37_7_c1
1098 nmdc:mga05p37_925578_c1
1099 nmdc:mga09592_314374_c1
1100 nmdc:mga06r32_121945_c1
1101 nmdc:mga06r32_789410_c1
1102 nmdc:mga08y16_177513_c1
1103 nmdc:mga08y16_315399_c1
1104 nmdc:mga08y16_375944_c1
1105 nmdc:mga0n895_1018814_c1
1106 nmdc:mga0n895_113089_c1
1107 nmdc:mga0n895_90601_c1
1108 nmdc:mga0n895_911874_c1
1109 nmdc:mga0n895_927753_c1
1110 nmdc:mga0rr50_112539_c1
1111 nmdc:mga0a205_261815_c1
1112 nmdc:mga0a205_299960_c1
1113 nmdc:mga0a205_308010_c1
1114 nmdc:mga0a205_40083_c1
1115 nmdc:mga0a205_847994_c1
1116 Ga0495601_0062570
1117 Ga0495601_0145709
1118 Ga0495601_0371285
1119 Ga0495612_0098581
1120 Ga0495619_0050275
1121 Ga0501084_0065537
1122 Ga0501084_0138193
1123 Ga0501084_0176268
1124 Ga0501084_0392102
1125 Ga0501082_0037877
1126 Ga0501082_0732850
1127 Ga0501082_0830193
1128 Ga0501082_1162702
1129 Ga0530510_0079907
1130 Ga0530510_0259423
1131 Ga0530510_0478972
1132 Ga0530510_0605244

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

13

65

0.96

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

13

61

0.89

PF13560

HTH_31

Helix-turn-helix domain

11

69

0.87

Map