F464299

General Info

Members Datasets Scaffolds Average Seq Length
565 304 526 326

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0021790|Ga0495643_0021790_616_1725
Length 369
Sequence LLNDLYNLKPVFFDKICIDFKKLIKIKIKVKFIHSLKIIIKNMEYRKLGNSELEISAITFGAWAAGGWMWGSTDRNEAIEAIKASYDVGVTSIDTAPIYGQGTSEEIVGEAIKDLSRDKVQILTKFGMRWDLAKGDFGFNSFKNNGDAIDVYKYAGKESIIYECEQSLKRLGTDYIDLYQIHWPDSTTPIDETFEAVSRLIEQGKVRFAGVCNYDAQQMAEAEKTLKLVSNQIPFSMVNRGIEEETLPYCIENNKSILAYSPLERGLLTGKIYNGYQFQDGDHRAGHKHFQPEFIEKTNQLLDKIKPIADEHKATLGQLVLRWTLERPGITIALAGARNADQAVQNAKAIEIKLSKEELTKIDELVNNF

Samples

Sample ID Description Type Environment
1 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
2 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
3 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
4 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
5 2738541302 Pedobacter sp. CF074 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2818991444 Filimonas endophytica 3197 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
16 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
17 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
18 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
19 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
20 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
21 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
22 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
23 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
24 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
25 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
26 2914759650 Rhizosphaericola mali Isolate Rhizosphere
27 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
28 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
29 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
30 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
31 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
32 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
33 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
34 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
35 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
36 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
37 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
38 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
39 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
40 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
41 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
42 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
47 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
48 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
56 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
57 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
66 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
67 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
70 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
132 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
192 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
193 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
213 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
214 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
217 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
236 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
271 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
272 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
273 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
274 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
275 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
276 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
277 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
278 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
284 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
292 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
293 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
294 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
295 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
296 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
297 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
298 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
301 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.92
Metatranscriptomes 0
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.2
Nodule 0
Rhizoplane 0.35
Rhizosphere 81.24
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000909 3300001979 Bacteria 13118
2 JGI24737J22298_10000042 3300001990 Bacteria 37008
3 JGI24735J21928_10000014 3300002067 Bacteria 186670
4 JGI25162J39368_1000022 3300002737 Bacteria 239510
5 JGI25154J39366_1000012 3300002738 Bacteria 287601
6 JGI25157J39369_1002623 3300002741 Bacteria 4256
7 JGI25153J46596_10001521 3300003215 Bacteria 13807
8 JGI25153J46596_10030563 3300003215 Bacteria 1830
9 rootH1_10005053 3300003316 Bacteria 4688
10 rootH1_10047104 3300003316 Bacteria 9319
11 rootH1_10060934 3300003316 Bacteria 17837
12 rootH2_10014568 3300003320 Bacteria 37185
13 rootH2_10022576 3300003320 Unclassified 2292
14 rootH2_10053678 3300003320 Bacteria 12869
15 rootH2_10174705 3300003320 Bacteria 1137
16 rootH2_10236519 3300003320 Unclassified 1647
17 rootH2_10238860 3300003320 Bacteria 1459
18 rootH2_10254709 3300003320 Bacteria 2505
19 rootL2_10194357 3300003322 Bacteria 2753
20 rootH1_10000912 3300003316 Bacteria 6959
21 rootH1_10000912 3300003323 Bacteria 9325
22 rootH1_10011906 3300003323 Bacteria 17140
23 rootH1_10015343 3300003323 Bacteria 22999
24 rootH1_10022668 3300003323 Bacteria 1587
25 rootH1_10065401 3300003323 Unclassified 2234
26 rootH1_10135166 3300003323 Bacteria 2295
27 JGI25160J50197_1001408 3300003354 Bacteria 12060
28 JGI25160J50197_1006219 3300003354 Bacteria 4858
29 JGI25160J50197_1012895 3300003354 Bacteria 2876
30 Ga0055535_1002678 3300003761 Bacteria 5816
31 Ga0055526_1019645 3300003771 Bacteria 2451
32 Ga0055528_1001024 3300003790 Bacteria 18512
33 Ga0055530_10001218 3300003791 Bacteria 19831
34 Ga0055531_10000357 3300003794 Bacteria 44649
35 Ga0065165_1000228 3300005262 Bacteria 98736
36 Ga0065714_10007188 3300005288 Bacteria 3165
37 Ga0065714_10064558 3300005288 Bacteria 36374
38 Ga0065714_10064685 3300005288 Bacteria 23720
39 Ga0065714_10092946 3300005288 Bacteria 1836
40 Ga0065704_10073776 3300005289 Bacteria 6797
41 Ga0065707_10009107 3300005295 Bacteria 3253
42 Ga0070683_100002306 3300005329 Bacteria 15135
43 Ga0070683_100006786 3300005329 Bacteria 9622
44 Ga0070683_100015970 3300005329 Bacteria 6606
45 Ga0070690_100111042 3300005330 Bacteria 1829
46 Ga0070690_100199829 3300005330 Bacteria 1390
47 Ga0070670_100021498 3300005331 Bacteria 5550
48 Ga0070670_100054482 3300005331 Bacteria 3434
49 Ga0068869_100017033 3300005334 Bacteria 4916
50 Ga0068869_100028430 3300005334 Bacteria 3907
51 Ga0068869_100179633 3300005334 Unclassified 1659
52 Ga0068869_100186980 3300005334 Bacteria 1627
53 Ga0070666_10046889 3300005335 Bacteria 2900
54 Ga0070666_10047617 3300005335 Bacteria 2879
55 Ga0070682_100014729 3300005337 Bacteria 4523
56 Ga0068868_100007315 3300005338 Bacteria 7858
57 Ga0070660_100020228 3300005339 Bacteria 4889
58 Ga0070689_100005751 3300005340 Bacteria 8503
59 Ga0070689_100106487 3300005340 Unclassified 2225
60 Ga0070691_10031184 3300005341 Unclassified 2499
61 Ga0070691_10189475 3300005341 Bacteria 1075
62 Ga0070661_100000802 3300005344 Bacteria 22567
63 Ga0070661_100009511 3300005344 Bacteria 6733
64 Ga0070661_100050878 3300005344 Bacteria 3032
65 Ga0070661_100139188 3300005344 Bacteria 1828
66 Ga0070668_100276119 3300005347 Unclassified 1402
67 Ga0070669_100006078 3300005353 Bacteria 8714
68 Ga0070675_100002109 3300005354 Bacteria 14701
69 Ga0070675_100210102 3300005354 Unclassified 1691
70 Ga0070674_100147798 3300005356 Bacteria 1770
71 Ga0070673_100003054 3300005364 Bacteria 10359
72 Ga0070673_100112282 3300005364 Bacteria 2262
73 Ga0070688_100037062 3300005365 Unclassified 2970
74 Ga0070659_100022729 3300005366 Bacteria 4790
75 Ga0070667_100170840 3300005367 Bacteria 1919
76 Ga0070701_10119718 3300005438 Bacteria 1482
77 Ga0070700_100018102 3300005441 Bacteria 4045
78 Ga0070663_100004079 3300005455 Bacteria 8534
79 Ga0070663_100043477 3300005455 Bacteria 3162
80 Ga0070678_100302267 3300005456 Bacteria 1360
81 Ga0070662_100016770 3300005457 Bacteria 4924
82 Ga0070662_100024520 3300005457 Bacteria 4157
83 Ga0068867_100037726 3300005459 Bacteria 3514
84 Ga0070685_10025998 3300005466 Bacteria 3225
85 Ga0070684_100000772 3300005535 Bacteria 22197
86 Ga0070684_100004165 3300005535 Bacteria 10957
87 Ga0070684_100207626 3300005535 Bacteria 1785
88 Ga0068853_100000221 3300005539 Bacteria 40294
89 Ga0068853_100001075 3300005539 Bacteria 19291
90 Ga0070672_100039555 3300005543 Bacteria 3613
91 Ga0070665_100000001 3300005548 Bacteria 1083363
92 Ga0070665_100194688 3300005548 Unclassified 2028
93 Ga0068855_100007948 3300005563 Bacteria 12817
94 Ga0068855_100023148 3300005563 Bacteria 7444
95 Ga0068855_100033805 3300005563 Bacteria 6100
96 Ga0068855_100035233 3300005563 Bacteria 5961
97 Ga0068855_100063792 3300005563 Bacteria 4298
98 Ga0070664_100000505 3300005564 Bacteria 29592
99 Ga0070664_100004719 3300005564 Bacteria 10933
100 Ga0068857_100001366 3300005577 Bacteria 19225
101 Ga0068857_100008009 3300005577 Bacteria 9115
102 Ga0068857_100133251 3300005577 Bacteria 2242
103 Ga0068854_100103001 3300005578 Bacteria 2142
104 Ga0068854_100143748 3300005578 Bacteria 1833
105 Ga0068856_100006256 3300005614 Bacteria 11688
106 Ga0068856_100190443 3300005614 Bacteria 2065
107 Ga0068852_100014969 3300005616 Bacteria 5996
108 Ga0068852_100040745 3300005616 Bacteria 3921
109 Ga0068852_100075513 3300005616 Bacteria 2973
110 Ga0068852_100089662 3300005616 Unclassified 2749
111 Ga0068859_100047563 3300005617 Bacteria 4310
112 Ga0068859_100293501 3300005617 Unclassified 1719
113 Ga0068864_100178408 3300005618 Unclassified 1940
114 Ga0068864_100517558 3300005618 Bacteria 1150
115 Ga0068866_10045689 3300005718 Bacteria 2198
116 Ga0068861_100038817 3300005719 Bacteria 3550
117 Ga0068870_10027862 3300005840 Bacteria 2830
118 Ga0068858_100039810 3300005842 Bacteria 4357
119 Ga0068862_100009062 3300005844 Bacteria 8240
120 Ga0075366_10063410 3300006195 Bacteria 2197
121 Ga0075366_10113063 3300006195 Bacteria 1634
122 Ga0068865_100031844 3300006881 Bacteria 3519
123 Ga0097620_100047568 3300006931 Bacteria 4310
124 Ga0097620_100293523 3300006931 Unclassified 1719
125 Ga0105244_10005167 3300009036 Bacteria 8747
126 Ga0105240_10000074 3300009093 Bacteria 199611
127 Ga0105240_10000598 3300009093 Bacteria 67006
128 Ga0105240_10000626 3300009093 Bacteria 65179
129 Ga0105240_10046632 3300009093 Bacteria 5490
130 Ga0105240_10049831 3300009093 Bacteria 5283
131 Ga0105240_10064747 3300009093 Bacteria 4541
132 Ga0105240_10089362 3300009093 Bacteria 3768
133 Ga0105240_10120518 3300009093 Bacteria 3159
134 Ga0105240_10208513 3300009093 Bacteria 2285
135 Ga0111539_10005613 3300009094 Bacteria 16226
136 Ga0105245_10265861 3300009098 Bacteria 1671
137 Ga0105241_10001201 3300009174 Bacteria 19815
138 Ga0105241_10005621 3300009174 Bacteria 9251
139 Ga0105241_10128316 3300009174 Bacteria 2050
140 Ga0105241_10268337 3300009174 Bacteria 1453
141 Ga0105237_10000755 3300009545 Bacteria 44312
142 Ga0105237_10003416 3300009545 Bacteria 18881
143 Ga0105237_10003671 3300009545 Bacteria 18080
144 Ga0105237_10005269 3300009545 Bacteria 14628
145 Ga0105237_10017271 3300009545 Bacteria 7480
146 Ga0105237_10034771 3300009545 Bacteria 5100
147 Ga0105237_10043473 3300009545 Bacteria 4525
148 Ga0105237_10181761 3300009545 Bacteria 2103
149 Ga0105237_10434593 3300009545 Bacteria 1318
150 Ga0105237_10560317 3300009545 Bacteria 1149
151 Ga0105238_10016556 3300009551 Bacteria 7463
152 Ga0105238_10045789 3300009551 Bacteria 4419
153 Ga0105249_10168771 3300009553 Bacteria 2120
154 Ga0105249_10204203 3300009553 Bacteria 1935
155 Ga0105239_10000887 3300010375 Bacteria 42411
156 Ga0105239_10009010 3300010375 Bacteria 11295
157 Ga0105239_10009893 3300010375 Bacteria 10711
158 Ga0105239_10010680 3300010375 Bacteria 10270
159 Ga0105239_10012494 3300010375 Bacteria 9459
160 Ga0105239_10068748 3300010375 Bacteria 3893
161 Ga0105239_10113490 3300010375 Bacteria 3005
162 Ga0105239_10156444 3300010375 Bacteria 2545
163 Ga0105239_10173188 3300010375 Bacteria 2414
164 Ga0105239_10294072 3300010375 Bacteria 1829
165 Ga0105239_10372322 3300010375 Unclassified 1614
166 Ga0157373_10000028 3300013100 Bacteria 132569
167 Ga0157373_10142070 3300013100 Bacteria 1688
168 Ga0157371_10000296 3300013102 Bacteria 66267
169 Ga0157371_10001612 3300013102 Bacteria 23130
170 Ga0157371_10018212 3300013102 Bacteria 5197
171 Ga0157371_10067722 3300013102 Bacteria 2527
172 Ga0157371_10135080 3300013102 Bacteria 1756
173 Ga0157371_10160213 3300013102 Bacteria 1607
174 Ga0157370_10000383 3300013104 Bacteria 55670
175 Ga0157370_10024155 3300013104 Bacteria 6024
176 Ga0157370_10027807 3300013104 Bacteria 5574
177 Ga0157370_10047960 3300013104 Bacteria 4093
178 Ga0157370_10063597 3300013104 Bacteria 3495
179 Ga0157370_10072977 3300013104 Bacteria 3238
180 Ga0157370_10179644 3300013104 Bacteria 1967
181 Ga0157370_10465677 3300013104 Bacteria 1161
182 Ga0157369_10000164 3300013105 Bacteria 94229
183 Ga0157369_10003409 3300013105 Bacteria 18845
184 Ga0157369_10005014 3300013105 Bacteria 15509
185 Ga0157369_10027687 3300013105 Bacteria 6279
186 Ga0157369_10054459 3300013105 Bacteria 4320
187 Ga0157369_10127803 3300013105 Bacteria 2693
188 Ga0157369_10281565 3300013105 Bacteria 1732
189 Ga0157374_10000001 3300013296 Bacteria 1077351
190 Ga0157374_10007884 3300013296 Bacteria 9090
191 Ga0163162_10000065 3300013306 Bacteria 102191
192 Ga0163162_10006247 3300013306 Bacteria 11551
193 Ga0163162_10011416 3300013306 Bacteria 8663
194 Ga0163162_10035248 3300013306 Bacteria 4982
195 Ga0163162_10075010 3300013306 Bacteria 3442
196 Ga0163162_10076045 3300013306 Bacteria 3419
197 Ga0163162_10126086 3300013306 Bacteria 2666
198 Ga0157372_10000010 3300013307 Bacteria 300658
199 Ga0157372_10002015 3300013307 Bacteria 22086
200 Ga0157372_10008435 3300013307 Bacteria 10940
201 Ga0157372_10015090 3300013307 Bacteria 8269
202 Ga0157372_10122732 3300013307 Bacteria 2985
203 Ga0157372_10226144 3300013307 Bacteria 2169
204 Ga0157375_10000313 3300013308 Bacteria 43467
205 Ga0157375_10010283 3300013308 Bacteria 8233
206 Ga0157375_10026718 3300013308 Bacteria 5385
207 Ga0157375_10197583 3300013308 Bacteria 2166
208 Ga0157375_10446316 3300013308 Bacteria 1459
209 Ga0163163_10008995 3300014325 Bacteria 8899
210 Ga0163163_10102466 3300014325 Bacteria 2886
211 Ga0163163_10341600 3300014325 Unclassified 1552
212 Ga0157380_10002002 3300014326 Bacteria 13580
213 Ga0157380_10002204 3300014326 Bacteria 13099
214 Ga0182008_10000011 3300014497 Bacteria 297770
215 Ga0182008_10000167 3300014497 Bacteria 51397
216 Ga0157377_10002686 3300014745 Bacteria 7898
217 Ga0157377_10006329 3300014745 Bacteria 5639
218 Ga0157377_10020715 3300014745 Bacteria 3450
219 Ga0157377_10130274 3300014745 Unclassified 1535
220 Ga0157379_10021385 3300014968 Bacteria 5727
221 Ga0157376_10018256 3300014969 Bacteria 5372
222 Ga0157376_10019970 3300014969 Bacteria 5174
223 Ga0157376_10096530 3300014969 Bacteria 2573
224 Ga0157376_10194995 3300014969 Unclassified 1860
225 Ga0182006_1000351 3300015261 Bacteria 38720
226 Ga0182006_1000546 3300015261 Bacteria 28457
227 Ga0182007_10000005 3300015262 Bacteria 442702
228 Ga0182005_1000126 3300015265 Bacteria 53914
229 Ga0183373_1002 3300015682 Bacteria 990153
230 Ga0163161_10000539 3300017792 Bacteria 30832
231 Ga0163161_10014139 3300017792 Bacteria 5558
232 Ga0163161_10045003 3300017792 Bacteria 3181
233 Ga0163161_10045496 3300017792 Bacteria 3166
234 Ga0163161_10057670 3300017792 Bacteria 2821
235 Ga0163161_10072486 3300017792 Bacteria 2522
236 Ga0163161_10381493 3300017792 Bacteria 1127
237 Ga0209437_100024 3300025233 Bacteria 592878
238 Ga0209258_100098 3300025242 Bacteria 215216
239 Ga0209646_1000009 3300025246 Bacteria 652154
240 Ga0209026_1000197 3300025250 Bacteria 84123
241 Ga0209148_1000120 3300025254 Bacteria 186836
242 Ga0209455_1004216 3300025272 Bacteria 4793
243 Ga0209673_1000016 3300025273 Bacteria 506202
244 Ga0209564_1006770 3300025295 Bacteria 6070
245 Ga0209564_1008008 3300025295 Bacteria 5305
246 Ga0209564_1033005 3300025295 Bacteria 1547
247 Ga0209758_1007651 3300025297 Bacteria 7285
248 Ga0209758_1008975 3300025297 Bacteria 6331
249 Ga0209050_1000124 3300025298 Bacteria 194022
250 Ga0207426_1000019 3300025302 Bacteria 558579
251 Ga0207426_1001572 3300025302 Bacteria 18424
252 Ga0207426_1003785 3300025302 Bacteria 7853
253 Ga0207426_1015343 3300025302 Bacteria 2780
254 Ga0209257_1000013 3300025304 Bacteria 1047305
255 Ga0209257_1004094 3300025304 Bacteria 11673
256 Ga0207697_10019450 3300025315 Bacteria 2782
257 Ga0207710_10000402 3300025900 Bacteria 28743
258 Ga0207647_10108042 3300025904 Bacteria 1646
259 Ga0207647_10109719 3300025904 Bacteria 1632
260 Ga0207685_10044892 3300025905 Bacteria 1673
261 Ga0207645_10018056 3300025907 Bacteria 4650
262 Ga0207645_10021325 3300025907 Bacteria 4225
263 Ga0207643_10018405 3300025908 Bacteria 3825
264 Ga0207654_10016460 3300025911 Bacteria 3851
265 Ga0207654_10018719 3300025911 Unclassified 3639
266 Ga0207695_10000071 3300025913 Bacteria 315568
267 Ga0207695_10000084 3300025913 Bacteria 282392
268 Ga0207695_10000323 3300025913 Bacteria 114265
269 Ga0207695_10003292 3300025913 Bacteria 22934
270 Ga0207695_10008989 3300025913 Bacteria 12432
271 Ga0207695_10019711 3300025913 Bacteria 7756
272 Ga0207695_10021372 3300025913 Bacteria 7384
273 Ga0207695_10051258 3300025913 Bacteria 4336
274 Ga0207695_10069338 3300025913 Bacteria 3608
275 Ga0207695_10098375 3300025913 Bacteria 2925
276 Ga0207671_10002316 3300025914 Bacteria 20539
277 Ga0207671_10002632 3300025914 Bacteria 18878
278 Ga0207671_10003305 3300025914 Bacteria 16215
279 Ga0207671_10015269 3300025914 Bacteria 6027
280 Ga0207671_10023392 3300025914 Bacteria 4660
281 Ga0207671_10049821 3300025914 Bacteria 3101
282 Ga0207671_10163937 3300025914 Bacteria 1722
283 Ga0207671_10188304 3300025914 Bacteria 1608
284 Ga0207649_10001160 3300025920 Bacteria 15873
285 Ga0207649_10007972 3300025920 Bacteria 5762
286 Ga0207652_10096068 3300025921 Bacteria 2611
287 Ga0207681_10006598 3300025923 Bacteria 7127
288 Ga0207681_10052908 3300025923 Bacteria 2755
289 Ga0207694_10025815 3300025924 Bacteria 4466
290 Ga0207694_10037736 3300025924 Bacteria 3713
291 Ga0207650_10181671 3300025925 Bacteria 1676
292 Ga0207659_10044949 3300025926 Bacteria 3110
293 Ga0207690_10131266 3300025932 Bacteria 1834
294 Ga0207706_10028043 3300025933 Bacteria 5030
295 Ga0207706_10047114 3300025933 Bacteria 3815
296 Ga0207706_10057817 3300025933 Bacteria 3416
297 Ga0207686_10034306 3300025934 Bacteria 3036
298 Ga0207669_10105865 3300025937 Bacteria 1872
299 Ga0207704_10071969 3300025938 Unclassified 2196
300 Ga0207691_10043667 3300025940 Bacteria 4129
301 Ga0207691_10313882 3300025940 Unclassified 1345
302 Ga0207689_10023441 3300025942 Bacteria 5181
303 Ga0207689_10038084 3300025942 Bacteria 3984
304 Ga0207689_10104476 3300025942 Bacteria 2327
305 Ga0207689_10160634 3300025942 Bacteria 1852
306 Ga0207661_10000929 3300025944 Bacteria 19227
307 Ga0207661_10003201 3300025944 Bacteria 11343
308 Ga0207661_10006780 3300025944 Bacteria 8110
309 Ga0207661_10086409 3300025944 Bacteria 2603
310 Ga0207679_10000232 3300025945 Bacteria 43046
311 Ga0207679_10006857 3300025945 Bacteria 7217
312 Ga0207679_10111968 3300025945 Unclassified 2156
313 Ga0207667_10000700 3300025949 Bacteria 43461
314 Ga0207667_10016862 3300025949 Bacteria 8239
315 Ga0207667_10019514 3300025949 Bacteria 7565
316 Ga0207651_10104366 3300025960 Unclassified 2112
317 Ga0207651_10256122 3300025960 Bacteria 1434
318 Ga0207712_10031639 3300025961 Bacteria 3566
319 Ga0207640_10015517 3300025981 Bacteria 4412
320 Ga0207658_10084729 3300025986 Bacteria 2440
321 Ga0207677_10061708 3300026023 Unclassified 2597
322 Ga0207677_10099914 3300026023 Unclassified 2132
323 Ga0207703_10187578 3300026035 Unclassified 1829
324 Ga0207639_10001620 3300026041 Bacteria 15141
325 Ga0207639_10008760 3300026041 Bacteria 6951
326 Ga0207678_10003893 3300026067 Bacteria 13425
327 Ga0207702_10095614 3300026078 Bacteria 2611
328 Ga0207648_10001472 3300026089 Bacteria 25920
329 Ga0207648_10114753 3300026089 Unclassified 2367
330 Ga0207648_10143068 3300026089 Bacteria 2109
331 Ga0207674_10004099 3300026116 Bacteria 17649
332 Ga0207674_10009679 3300026116 Bacteria 10985
333 Ga0207674_10018299 3300026116 Bacteria 7618
334 Ga0207674_10174999 3300026116 Bacteria 2099
335 Ga0207675_100000507 3300026118 Bacteria 37845
336 Ga0207675_100109623 3300026118 Bacteria 2605
337 Ga0207675_100413044 3300026118 Bacteria 1332
338 Ga0207683_10009631 3300026121 Bacteria 8233
339 Ga0207698_10037738 3300026142 Bacteria 3562
340 Ga0207698_10161193 3300026142 Unclassified 1962
341 Ga0207428_10011632 3300027907 Bacteria 7767
342 Ga0268266_10000049 3300028379 Bacteria 307763
343 Ga0268266_10087352 3300028379 Unclassified 2728
344 Ga0268266_10156777 3300028379 Unclassified 2057
345 Ga0265336_10008325 3300028666 Bacteria 3644
346 Ga0307517_10072141 3300028786 Bacteria 3082
347 Ga0307515_10000001 3300028794 Bacteria 4259510
348 Ga0307515_10000057 3300028794 Bacteria 261695
349 Ga0265338_10060857 3300028800 Bacteria 3312
350 Ga0316176_1131516 3300030732 Bacteria 7794
351 Ga0316183_1119247 3300030742 Bacteria 31382
352 Ga0316181_1277597 3300030744 Bacteria 16645
353 Ga0265327_10010692 3300031251 Bacteria 6414
354 Ga0265327_10012845 3300031251 Bacteria 5611
355 Ga0265316_10131388 3300031344 Unclassified 1886
356 Ga0307408_100000652 3300031548 Bacteria 29132
357 Ga0307408_100002469 3300031548 Bacteria 12967
358 Ga0307408_100010676 3300031548 Bacteria 6057
359 Ga0316576_10008737 3300031727 Bacteria 6487
360 Ga0316576_10158651 3300031727 Unclassified 1706
361 Ga0316576_10173346 3300031727 Bacteria 1628
362 Ga0316576_10175389 3300031727 Bacteria 1617
363 Ga0316578_10143502 3300031728 Unclassified 1438
364 Ga0307516_10002463 3300031730 Bacteria 24737
365 Ga0307405_10000009 3300031731 Bacteria 259388
366 Ga0307405_10064210 3300031731 Bacteria 2332
367 Ga0316577_10160475 3300031733 Bacteria 1268
368 Ga0307407_10000001 3300031903 Bacteria 570048
369 Ga0307412_10006672 3300031911 Bacteria 6543
370 Ga0307412_10049819 3300031911 Bacteria 2761
371 Ga0307416_100000026 3300032002 Bacteria 172622
372 Ga0307416_100139228 3300032002 Bacteria 2202
373 Ga0307414_10078496 3300032004 Unclassified 2407
374 Ga0316580_10017265 3300032139 Bacteria 2218
375 Ga0307510_10000217 3300033180 Bacteria 51069
376 Ga0373943_0053168 3300035170 Bacteria 1999
377 Ga0316584_0003441 3300036712 Bacteria 10274
378 Ga0316584_0017257 3300036712 Bacteria 5186
379 Ga0316584_0272203 3300036712 Bacteria 1232
380 Ga0395899_0000122 3300037312 Bacteria 123909
381 Ga0395899_0001366 3300037312 Bacteria 20911
382 Ga0395898_0000092 3300037466 Bacteria 235647
383 Ga0400489_82418 3300039093 Bacteria 2550
384 Ga0439431_0000264 3300041997 Bacteria 10760
385 Ga0439431_0020240 3300041997 Bacteria 1588
386 Ga0439445_0001255 3300042004 Bacteria 5494
387 Ga0439445_0012153 3300042004 Bacteria 2065
388 Ga0439449_0013451 3300042007 Bacteria 3080
389 Ga0439462_0001300 3300042015 Bacteria 5491
390 Ga0451577_0015166 3300042876 Bacteria 7172
391 Ga0451577_0015970 3300042876 Bacteria 6967
392 Ga0451577_0029962 3300042876 Bacteria 4916
393 Ga0466969_0021459 3300044656 Bacteria 3339
394 Ga0466972_0000014 3300044658 Bacteria 216776
395 Ga0466972_0003478 3300044658 Bacteria 7814
396 Ga0453683_0000045 3300044673 Bacteria 211088
397 Ga0453683_0000065 3300044673 Bacteria 166630
398 Ga0453683_0009674 3300044673 Bacteria 6428
399 Ga0453683_0040034 3300044673 Bacteria 2944
400 Ga0466965_0017189 3300044683 Bacteria 3454
401 Ga0466965_0058971 3300044683 Bacteria 1915
402 Ga0466966_0015916 3300044684 Bacteria 4970
403 Ga0466961_0005768 3300044693 Bacteria 7837
404 Ga0466964_0087437 3300044706 Bacteria 1350
405 Ga0453684_0000139 3300044712 Bacteria 320330
406 Ga0453684_0001715 3300044712 Bacteria 58849
407 Ga0453684_0009535 3300044712 Bacteria 16959
408 Ga0453684_0015427 3300044712 Bacteria 12089
409 Ga0453684_0039853 3300044712 Bacteria 6391
410 Ga0453684_0041296 3300044712 Bacteria 6243
411 Ga0453684_0418672 3300044712 Bacteria 1497
412 Ga0453684_0430841 3300044712 Bacteria 1471
413 Ga0466971_0000017 3300044719 Bacteria 82541
414 Ga0466971_0022892 3300044719 Bacteria 2785
415 Ga0466968_0036113 3300044735 Bacteria 2070
416 Ga0466968_0072231 3300044735 Bacteria 1504
417 Ga0466970_0000497 3300044765 Bacteria 19350
418 Ga0466957_0004508 3300044842 Bacteria 7773
419 Ga0466957_0386269 3300044842 Bacteria 955
420 Ga0466959_0044132 3300045049 Bacteria 3285
421 Ga0451576_0000175 3300045051 Bacteria 161976
422 Ga0451576_0000332 3300045051 Bacteria 114268
423 Ga0451576_0028168 3300045051 Bacteria 6023
424 Ga0451576_0031235 3300045051 Bacteria 5681
425 Ga0451576_0031754 3300045051 Bacteria 5629
426 Ga0451576_0040834 3300045051 Bacteria 4907
427 Ga0451576_0049254 3300045051 Bacteria 4421
428 Ga0451576_0307657 3300045051 Bacteria 1658
429 Ga0451576_0494651 3300045051 Bacteria 1285
430 Ga0495627_014110 3300046453 Bacteria 2797
431 Ga0495638_0087190 3300046460 Bacteria 1886
432 Ga0495650_0000003 3300046471 Bacteria 900730
433 Ga0495650_0000036 3300046471 Bacteria 400633
434 Ga0495585_0000085 3300046492 Bacteria 97836
435 Ga0495607_0048433 3300046501 Unclassified 2485
436 Ga0495607_0108255 3300046501 Bacteria 1477
437 Ga0495606_0000145 3300046507 Bacteria 122857
438 Ga0495606_0007477 3300046507 Bacteria 9762
439 Ga0495606_0051107 3300046507 Bacteria 2699
440 Ga0495610_0000501 3300046512 Bacteria 39971
441 Ga0495610_0002148 3300046512 Bacteria 16763
442 Ga0495616_0000925 3300046513 Bacteria 21108
443 Ga0495616_0002395 3300046513 Bacteria 12476
444 Ga0495632_0008321 3300046519 Bacteria 6385
445 Ga0495643_0021790 3300046522 Bacteria 3668
446 Ga0495644_0029151 3300046523 Bacteria 2086
447 Ga0495648_0003858 3300046524 Bacteria 12999
448 Ga0495663_0000792 3300046525 Bacteria 10811
449 Ga0495587_0019759 3300046536 Bacteria 4165
450 Ga0495609_0000134 3300046538 Bacteria 79757
451 Ga0495633_0000008 3300046558 Bacteria 301830
452 Ga0495633_0000059 3300046558 Bacteria 147552
453 Ga0495633_0018245 3300046558 Bacteria 3568
454 Ga0495611_0000090 3300046648 Bacteria 63531
455 Ga0495625_0000005 3300046660 Bacteria 596135
456 Ga0495625_0004302 3300046660 Bacteria 13547
457 Ga0495625_0014249 3300046660 Bacteria 6356
458 Ga0495625_0060198 3300046660 Bacteria 2691
459 Ga0495625_0159923 3300046660 Bacteria 1510
460 Ga0495661_0000563 3300046665 Bacteria 38406
461 Ga0495661_0006086 3300046665 Bacteria 8503
462 Ga0495671_0085546 3300046692 Bacteria 1545
463 Ga0495649_0000003 3300046694 Bacteria 880817
464 Ga0495672_0033244 3300047320 Bacteria 3197
465 Ga0495687_053978 3300047443 Bacteria 1689
466 Ga0495686_0000004 3300047472 Bacteria 869019
467 Ga0495686_0000367 3300047472 Bacteria 73112
468 Ga0495686_0000416 3300047472 Bacteria 67601
469 Ga0495686_0193243 3300047472 Bacteria 1172
470 Ga0496115_0267909 3300048918 Bacteria 1404
471 Ga0496121_0000007 3300048924 Bacteria 942516
472 Ga0496125_0003355 3300048928 Bacteria 19500
473 Ga0496126_0043806 3300048929 Bacteria 4126
474 Ga0495678_020300 3300049459 Bacteria 2946
475 Ga0495678_021013 3300049459 Bacteria 2881
476 Ga0501298_003226 3300049521 Bacteria 2522
477 Ga0501031_0001157 3300049568 Bacteria 16042
478 Ga0501033_0000271 3300049570 Bacteria 50065
479 Ga0501034_0049620 3300049571 Bacteria 4234
480 Ga0501037_0000116 3300049573 Bacteria 74682
481 Ga0501038_0000976 3300049574 Bacteria 25655
482 Ga0501038_0023894 3300049574 Bacteria 5459
483 Ga0501043_0000342 3300049579 Bacteria 42181
484 Ga0501043_0009056 3300049579 Bacteria 7831
485 Ga0501047_0001211 3300049581 Bacteria 25605
486 Ga0501047_0124423 3300049581 Bacteria 2459
487 Ga0501047_0212029 3300049581 Unclassified 1795
488 Ga0501072_0167356 3300049588 Bacteria 1754
489 Ga0501201_004618 3300049651 Bacteria 1279
490 Ga0501206_004609 3300049653 Bacteria 1758
491 Ga0501207_010837 3300049654 Bacteria 1349
492 Ga0501223_001164 3300049663 Bacteria 6195
493 Ga0501224_000321 3300049664 Bacteria 5610
494 Ga0501243_000295 3300049675 Bacteria 6449
495 Ga0501259_003357 3300049688 Bacteria 2558
496 Ga0501221_002035 3300049704 Bacteria 3367
497 Ga0501245_002439 3300049708 Bacteria 2483
498 Ga0501080_0159161 3300049742 Bacteria 2086
499 Ga0501241_015421 3300049758 Bacteria 1390
500 Ga0501035_0001096 3300049822 Bacteria 28396
501 Ga0501044_0001911 3300049823 Bacteria 24112
502 Ga0501212_008926 3300049851 Bacteria 1402
503 Ga0501284_00021 3300050005 Bacteria 89729
504 nmdc:mga0k408_145968_c1 3300050493 Bacteria 1408
505 nmdc:mga0k408_183016_c1 3300050493 Bacteria 1250
506 nmdc:mga08y16_44554_c1 3300050511 Bacteria 4648
507 Ga0500644_0000456 3300053088 Bacteria 18680
508 Ga0500581_101317 3300053089 Bacteria 1416
509 Ga0500583_0000188 3300053092 Bacteria 24682
510 Ga0500583_0027729 3300053092 Bacteria 2448
511 Ga0500651_0017407 3300053093 Bacteria 4434
512 Ga0500556_0074638 3300053104 Bacteria 1273
513 Ga0500562_000095 3300053108 Bacteria 35281
514 Ga0500569_000462 3300053109 Bacteria 6680
515 Ga0500607_133289 3300053121 Bacteria 1181
516 Ga0500652_030512 3300053131 Bacteria 2109
517 Ga0500658_0042859 3300053134 Bacteria 1820
518 Ga0500568_0000236 3300053139 Bacteria 47278
519 Ga0500577_0002874 3300053142 Bacteria 4434
520 Ga0500616_0031050 3300053153 Bacteria 2929
521 Ga0500622_0000110 3300053156 Bacteria 83911
522 Ga0500622_0001046 3300053156 Bacteria 23113
523 Ga0500622_0004430 3300053156 Bacteria 8826
524 Ga0500624_000158 3300053157 Bacteria 27895
525 Ga0500645_036127 3300053730 Bacteria 1470
526 Ga0466962_0000031 3300061719 Bacteria 68489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026118 Ga0207675_100413044 Ga0207675_1004130441 270
2 3300014326 Ga0157380_10002204 Ga0157380_100022042 288
3 3300036712 Ga0316584_0003441 Ga0316584_0003441_542_1486 288
4 3300046558 Ga0495633_0000008 Ga0495633_0000008_232639_233622 289
5 3300009545 Ga0105237_10434593 Ga0105237_104345931 294
6 3300035170 Ga0373943_0053168 Ga0373943_0053168_44_1042 297
7 3300046536 Ga0495587_0019759 Ga0495587_0019759_266_1264 297
8 3300031548 Ga0307408_100002469 Ga0307408_10000246915 298
9 3300005330 Ga0070690_100111042 Ga0070690_1001110421 299
10 3300005334 Ga0068869_100017033 Ga0068869_1000170333 299
11 3300005335 Ga0070666_10047617 Ga0070666_100476172 299
12 3300005344 Ga0070661_100050878 Ga0070661_1000508783 299
13 3300005364 Ga0070673_100112282 Ga0070673_1001122822 299
14 3300005367 Ga0070667_100170840 Ga0070667_1001708401 299
15 3300005459 Ga0068867_100037726 Ga0068867_1000377262 299
16 3300013102 Ga0157371_10160213 Ga0157371_101602132 299
17 3300013306 Ga0163162_10075010 Ga0163162_100750102 299
18 3300013307 Ga0157372_10226144 Ga0157372_102261442 299
19 3300013308 Ga0157375_10010283 Ga0157375_100102832 299
20 3300014325 Ga0163163_10102466 Ga0163163_101024662 299
21 3300014969 Ga0157376_10018256 Ga0157376_100182563 299
22 3300025905 Ga0207685_10044892 Ga0207685_100448921 299
23 3300025933 Ga0207706_10057817 Ga0207706_100578172 299
24 3300025934 Ga0207686_10034306 Ga0207686_100343062 299
25 3300025942 Ga0207689_10160634 Ga0207689_101606342 299
26 3300026089 Ga0207648_10143068 Ga0207648_101430681 299
27 3300026121 Ga0207683_10009631 Ga0207683_100096315 299
28 3300036712 Ga0316584_0272203 Ga0316584_0272203_227_1147 299
29 3300044842 Ga0466957_0386269 Ga0466957_0386269_12_932 299
30 3300053121 Ga0500607_133289 Ga0500607_133289_37_951 300
31 3300009093 Ga0105240_10000598 Ga0105240_100005983 303
32 3300009545 Ga0105237_10181761 Ga0105237_101817613 303
33 3300005344 Ga0070661_100139188 Ga0070661_1001391882 304
34 3300025913 Ga0207695_10098375 Ga0207695_100983753 304
35 3300031727 Ga0316576_10175389 Ga0316576_101753892 305
36 3300013100 Ga0157373_10142070 Ga0157373_101420702 307
37 3300047472 Ga0495686_0000004 Ga0495686_0000004_445752_446816 308
38 3300003320 rootH2_10174705 rootH2_101747051 309
39 3300003323 rootH1_10022668 rootH1_100226682 309
40 3300013306 Ga0163162_10006247 Ga0163162_1000624710 309
41 3300046471 Ga0495650_0000003 Ga0495650_0000003_111834_112829 309
42 3300046492 Ga0495585_0000085 Ga0495585_0000085_13016_14011 309
43 3300046507 Ga0495606_0000145 Ga0495606_0000145_58188_59183 309
44 3300046512 Ga0495610_0002148 Ga0495610_0002148_11178_12173 309
45 3300046513 Ga0495616_0002395 Ga0495616_0002395_5071_6066 309
46 3300046558 Ga0495633_0018245 Ga0495633_0018245_1642_2637 309
47 3300046660 Ga0495625_0000005 Ga0495625_0000005_228901_229896 309
48 3300046665 Ga0495661_0006086 Ga0495661_0006086_3232_4227 309
49 3300046692 Ga0495671_0085546 Ga0495671_0085546_409_1404 309
50 3300046694 Ga0495649_0000003 Ga0495649_0000003_228923_229918 309
51 3300047443 Ga0495687_053978 Ga0495687_053978_645_1640 309
52 3300003320 rootH2_10014568 rootH2_1001456829 310
53 3300003320 rootH2_10236519 rootH2_102365192 310
54 3300005577 Ga0068857_100008009 Ga0068857_1000080095 310
55 3300009093 Ga0105240_10120518 Ga0105240_101205182 310
56 3300009551 Ga0105238_10045789 Ga0105238_100457892 310
57 3300013105 Ga0157369_10127803 Ga0157369_101278032 310
58 3300025913 Ga0207695_10019711 Ga0207695_100197114 310
59 3300025924 Ga0207694_10025815 Ga0207694_100258156 310
60 3300031731 Ga0307405_10064210 Ga0307405_100642102 311
61 3300044656 Ga0466969_0021459 Ga0466969_0021459_412_1455 311
62 3300044693 Ga0466961_0005768 Ga0466961_0005768_2079_3146 311
63 3300044719 Ga0466971_0022892 Ga0466971_0022892_162_1205 311
64 3300045049 Ga0466959_0044132 Ga0466959_0044132_1063_2106 311
65 3300046501 Ga0495607_0108255 Ga0495607_0108255_264_1259 311
66 3300049521 Ga0501298_003226 Ga0501298_003226_443_1516 311
67 3300049651 Ga0501201_004618 Ga0501201_004618_124_1197 311
68 3300049653 Ga0501206_004609 Ga0501206_004609_48_1121 311
69 3300049654 Ga0501207_010837 Ga0501207_010837_127_1200 311
70 3300049663 Ga0501223_001164 Ga0501223_001164_1079_2071 311
71 3300049664 Ga0501224_000321 Ga0501224_000321_3389_4462 311
72 3300049675 Ga0501243_000295 Ga0501243_000295_209_1282 311
73 3300049688 Ga0501259_003357 Ga0501259_003357_1226_2299 311
74 3300049704 Ga0501221_002035 Ga0501221_002035_742_1740 311
75 3300049708 Ga0501245_002439 Ga0501245_002439_383_1456 311
76 3300049851 Ga0501212_008926 Ga0501212_008926_119_1192 311
77 3300001990 JGI24737J22298_10000042 JGI24737J22298_1000004211 312
78 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001470 312
79 3300003316 rootH1_10060934 rootH1_1006093411 312
80 3300003320 rootH2_10238860 rootH2_102388602 312
81 3300005548 Ga0070665_100000001 Ga0070665_100000001751 312
82 3300005563 Ga0068855_100023148 Ga0068855_1000231486 312
83 3300006195 Ga0075366_10113063 Ga0075366_101130632 312
84 3300009093 Ga0105240_10089362 Ga0105240_100893622 312
85 3300009545 Ga0105237_10000755 Ga0105237_100007558 312
86 3300009545 Ga0105237_10003416 Ga0105237_100034165 312
87 3300009545 Ga0105237_10003671 Ga0105237_100036714 312
88 3300010375 Ga0105239_10294072 Ga0105239_102940722 312
89 3300013102 Ga0157371_10018212 Ga0157371_100182123 312
90 3300013105 Ga0157369_10281565 Ga0157369_102815651 312
91 3300013296 Ga0157374_10000001 Ga0157374_10000001191 312
92 3300013307 Ga0157372_10002015 Ga0157372_100020153 312
93 3300014969 Ga0157376_10019970 Ga0157376_100199701 312
94 3300025914 Ga0207671_10002316 Ga0207671_1000231622 312
95 3300025914 Ga0207671_10002632 Ga0207671_1000263212 312
96 3300025949 Ga0207667_10019514 Ga0207667_100195142 312
97 3300025986 Ga0207658_10084729 Ga0207658_100847291 312
98 3300028379 Ga0268266_10000049 Ga0268266_10000049112 312
99 3300028666 Ga0265336_10008325 Ga0265336_100083252 312
100 3300031548 Ga0307408_100000652 Ga0307408_10000065211 312
101 3300033180 Ga0307510_10000217 Ga0307510_1000021720 312
102 3300046460 Ga0495638_0087190 Ga0495638_0087190_202_1197 312
103 3300046507 Ga0495606_0007477 Ga0495606_0007477_5509_6501 312
104 3300046524 Ga0495648_0003858 Ga0495648_0003858_5852_6847 312
105 3300050493 nmdc:mga0k408_183016_c1 nmdc:mga0k408_183016_c1_242_1237 312
106 3300053156 Ga0500622_0001046 Ga0500622_0001046_6223_7218 312
107 3300003320 rootH2_10053678 rootH2_100536787 313
108 3300005539 Ga0068853_100000221 Ga0068853_1000002216 313
109 3300009093 Ga0105240_10208513 Ga0105240_102085133 313
110 3300009098 Ga0105245_10265861 Ga0105245_102658612 313
111 3300009174 Ga0105241_10268337 Ga0105241_102683372 313
112 3300010375 Ga0105239_10113490 Ga0105239_101134904 313
113 3300025904 Ga0207647_10109719 Ga0207647_101097192 313
114 3300025913 Ga0207695_10021372 Ga0207695_100213726 313
115 3300026041 Ga0207639_10008760 Ga0207639_100087606 313
116 3300031344 Ga0265316_10131388 Ga0265316_101313882 313
117 3300031727 Ga0316576_10008737 Ga0316576_100087373 314
118 3300031733 Ga0316577_10160475 Ga0316577_101604752 314
119 3300032139 Ga0316580_10017265 Ga0316580_100172651 314
120 3300036712 Ga0316584_0017257 Ga0316584_0017257_1502_2497 314
121 iso_pu_bacteria 2523533629 2524005864 314
122 iso_pu_bacteria 2585428115 2587942854 314
123 iso_pu_bacteria 2585428187 2588233411 314
124 iso_pu_bacteria 2890737413 2890738902 314
125 iso_pu_bacteria 2896317667 2896321177 314
126 iso_pu_bacteria 2898713307 2898714728 314
127 iso_pu_bacteria 2977243572 2977246152 314
128 3300010375 Ga0105239_10009893 Ga0105239_100098937 315
129 3300010375 Ga0105239_10173188 Ga0105239_101731883 315
130 3300015265 Ga0182005_1000126 Ga0182005_10001267 315
131 3300031727 Ga0316576_10158651 Ga0316576_101586512 315
132 3300041997 Ga0439431_0020240 Ga0439431_0020240_471_1463 315
133 3300044658 Ga0466972_0000014 Ga0466972_0000014_6962_7963 315
134 3300044765 Ga0466970_0000497 Ga0466970_0000497_8921_9922 315
135 3300049459 Ga0495678_021013 Ga0495678_021013_537_1532 315
136 3300053730 Ga0500645_036127 Ga0500645_036127_265_1272 315
137 iso_pu_bacteria 2910245624 2910249689 315
138 iso_pu_bacteria 2929154850 2929158225 315
139 3300003761 Ga0055535_1002678 Ga0055535_10026782 316
140 3300025242 Ga0209258_100098 Ga0209258_10009862 316
141 3300025254 Ga0209148_1000120 Ga0209148_100012036 316
142 3300025913 Ga0207695_10000323 Ga0207695_1000032399 316
143 3300025914 Ga0207671_10163937 Ga0207671_101639372 316
144 3300026078 Ga0207702_10095614 Ga0207702_100956141 316
145 3300028800 Ga0265338_10060857 Ga0265338_100608572 316
146 3300045051 Ga0451576_0307657 Ga0451576_0307657_305_1303 316
147 3300046453 Ga0495627_014110 Ga0495627_014110_99_1091 316
148 3300046558 Ga0495633_0000059 Ga0495633_0000059_24131_25123 316
149 3300046648 Ga0495611_0000090 Ga0495611_0000090_25741_26733 316
150 3300053088 Ga0500644_0000456 Ga0500644_0000456_643_1635 316
151 3300053092 Ga0500583_0027729 Ga0500583_0027729_1150_2142 316
152 3300053093 Ga0500651_0017407 Ga0500651_0017407_303_1295 316
153 3300053109 Ga0500569_000462 Ga0500569_000462_2476_3468 316
154 3300053142 Ga0500577_0002874 Ga0500577_0002874_3033_4025 316
155 3300053153 Ga0500616_0031050 Ga0500616_0031050_1881_2873 316
156 iso_pu_bacteria 2738541302 2738854996 316
157 iso_pu_bacteria 2739367656 2739614805 316
158 iso_pu_bacteria 2739367663 2739646254 316
159 iso_pu_bacteria 2818991437 2819547352 316
160 iso_pu_bacteria 2842722452 2842727663 316
161 iso_pu_bacteria 2842909656 2842911132 316
162 iso_pu_bacteria 2849281842 2849283086 316
163 iso_pu_bacteria 2857627736 2857631930 316
164 iso_pu_bacteria 2904445276 2904447818 316
165 iso_pu_bacteria 2954016120 2954020208 316
166 iso_pu_bacteria 3003233435 3003234179 316
167 3300005329 Ga0070683_100006786 Ga0070683_1000067862 317
168 3300005563 Ga0068855_100007948 Ga0068855_10000794812 317
169 3300005578 Ga0068854_100143748 Ga0068854_1001437482 317
170 3300005616 Ga0068852_100040745 Ga0068852_1000407452 317
171 3300009093 Ga0105240_10046632 Ga0105240_100466328 317
172 3300010375 Ga0105239_10068748 Ga0105239_100687482 317
173 3300013104 Ga0157370_10024155 Ga0157370_100241552 317
174 3300013105 Ga0157369_10054459 Ga0157369_100544593 317
175 3300025913 Ga0207695_10000071 Ga0207695_10000071267 317
176 3300025944 Ga0207661_10003201 Ga0207661_1000320112 317
177 3300025949 Ga0207667_10000700 Ga0207667_1000070040 317
178 3300026142 Ga0207698_10037738 Ga0207698_100377382 317
179 3300044712 Ga0453684_0000139 Ga0453684_0000139_207521_208519 317
180 3300045051 Ga0451576_0028168 Ga0451576_0028168_4530_5528 317
181 3300048924 Ga0496121_0000007 Ga0496121_0000007_679289_680281 317
182 iso_pu_bacteria 2599185184 2599477720 317
183 iso_pu_bacteria 2818991444 2819590940 317
184 iso_pu_bacteria 2821136567 2821138240 317
185 iso_pu_bacteria 2842903701 2842905518 317
186 iso_pu_bacteria 2881247448 2881248749 317
187 iso_pu_bacteria 2884791551 2884796379 317
188 iso_pu_bacteria 2896085136 2896088552 317
189 iso_pu_bacteria 2904467357 2904469036 317
190 iso_pu_bacteria 2911138879 2911140970 317
191 iso_pu_bacteria 2914759650 2914763161 317
192 iso_pu_bacteria 2919437846 2919441677 317
193 iso_pu_bacteria 2928078545 2928079636 317
194 iso_pu_bacteria 2928147474 2928147887 317
195 iso_pu_bacteria 2929154850 2929156048 317
196 iso_pu_bacteria 2929239360 2929242919 317
197 iso_pu_bacteria 2929921140 2929924401 317
198 iso_pu_bacteria 2932082852 2932086738 317
199 iso_pu_bacteria 2958512119 2958515497 317
200 iso_pu_bacteria 2965320100 2965320390 317
201 iso_pu_bacteria 8003151029 8003155371 317
202 3300005288 Ga0065714_10064685 Ga0065714_100646855 318
203 3300005289 Ga0065704_10073776 Ga0065704_100737766 318
204 3300009093 Ga0105240_10000626 Ga0105240_1000062662 318
205 3300013100 Ga0157373_10000028 Ga0157373_10000028107 318
206 3300013104 Ga0157370_10027807 Ga0157370_100278073 318
207 3300013104 Ga0157370_10072977 Ga0157370_100729773 318
208 3300013105 Ga0157369_10027687 Ga0157369_100276876 318
209 3300013308 Ga0157375_10000313 Ga0157375_100003138 318
210 3300013308 Ga0157375_10197583 Ga0157375_101975832 318
211 3300014497 Ga0182008_10000011 Ga0182008_10000011107 318
212 3300025272 Ga0209455_1004216 Ga0209455_10042164 318
213 3300025913 Ga0207695_10000084 Ga0207695_10000084253 318
214 3300031911 Ga0307412_10006672 Ga0307412_100066722 318
215 3300042004 Ga0439445_0001255 Ga0439445_0001255_66_1049 318
216 3300044683 Ga0466965_0058971 Ga0466965_0058971_83_1075 318
217 3300044712 Ga0453684_0041296 Ga0453684_0041296_2619_3617 318
218 3300046507 Ga0495606_0051107 Ga0495606_0051107_1482_2465 318
219 3300046519 Ga0495632_0008321 Ga0495632_0008321_1611_2696 318
220 3300046522 Ga0495643_0021790 Ga0495643_0021790_616_1725 318
221 3300046525 Ga0495663_0000792 Ga0495663_0000792_4681_5730 318
222 3300046538 Ga0495609_0000134 Ga0495609_0000134_22261_23244 318
223 3300046660 Ga0495625_0004302 Ga0495625_0004302_8451_9434 318
224 3300047472 Ga0495686_0000416 Ga0495686_0000416_35928_37037 318
225 3300048928 Ga0496125_0003355 Ga0496125_0003355_13912_14895 318
226 3300049571 Ga0501034_0049620 Ga0501034_0049620_124_1107 318
227 3300053108 Ga0500562_000095 Ga0500562_000095_24531_25538 318
228 3300039093 Ga0400489_82418 Ga0400489_82418_492_1490 319
229 3300044712 Ga0453684_0418672 Ga0453684_0418672_55_1053 319
230 3300049588 Ga0501072_0167356 Ga0501072_0167356_113_1114 319
231 3300049742 Ga0501080_0159161 Ga0501080_0159161_1014_2015 319
232 3300053156 Ga0500622_0004430 Ga0500622_0004430_2403_3404 319
233 3300003323 rootH1_10015343 rootH1_1001534322 320
234 3300005288 Ga0065714_10007188 Ga0065714_100071883 320
235 3300005288 Ga0065714_10064558 Ga0065714_1006455821 320
236 3300005288 Ga0065714_10092946 Ga0065714_100929462 320
237 3300009036 Ga0105244_10005167 Ga0105244_100051672 320
238 3300009553 Ga0105249_10204203 Ga0105249_102042032 320
239 3300013102 Ga0157371_10000296 Ga0157371_1000029644 320
240 3300013102 Ga0157371_10135080 Ga0157371_101350802 320
241 3300013104 Ga0157370_10000383 Ga0157370_1000038321 320
242 3300013105 Ga0157369_10000164 Ga0157369_1000016448 320
243 3300013306 Ga0163162_10000065 Ga0163162_1000006547 320
244 3300013307 Ga0157372_10008435 Ga0157372_100084357 320
245 3300013307 Ga0157372_10122732 Ga0157372_101227324 320
246 3300014497 Ga0182008_10000167 Ga0182008_100001674 320
247 3300015261 Ga0182006_1000351 Ga0182006_100035125 320
248 3300015261 Ga0182006_1000546 Ga0182006_100054621 320
249 3300015262 Ga0182007_10000005 Ga0182007_1000000546 320
250 3300015682 Ga0183373_1002 Ga0183373_1002632 320
251 3300017792 Ga0163161_10000539 Ga0163161_1000053922 320
252 3300017792 Ga0163161_10045003 Ga0163161_100450032 320
253 3300017792 Ga0163161_10045496 Ga0163161_100454961 320
254 3300017792 Ga0163161_10072486 Ga0163161_100724863 320
255 3300017792 Ga0163161_10381493 Ga0163161_103814931 320
256 3300025900 Ga0207710_10000402 Ga0207710_1000040224 320
257 3300025961 Ga0207712_10031639 Ga0207712_100316393 320
258 3300031548 Ga0307408_100010676 Ga0307408_1000106765 320
259 3300031731 Ga0307405_10000009 Ga0307405_10000009232 320
260 3300031903 Ga0307407_10000001 Ga0307407_10000001408 320
261 3300032002 Ga0307416_100000026 Ga0307416_100000026145 320
262 3300032004 Ga0307414_10078496 Ga0307414_100784963 320
263 3300037312 Ga0395899_0000122 Ga0395899_0000122_4074_5072 320
264 3300037466 Ga0395898_0000092 Ga0395898_0000092_166726_167727 320
265 3300041997 Ga0439431_0000264 Ga0439431_0000264_2355_3347 320
266 3300042004 Ga0439445_0012153 Ga0439445_0012153_1011_2003 320
267 3300042007 Ga0439449_0013451 Ga0439449_0013451_306_1313 320
268 3300042876 Ga0451577_0015970 Ga0451577_0015970_5122_6117 320
269 3300044673 Ga0453683_0000065 Ga0453683_0000065_133625_134623 320
270 3300044673 Ga0453683_0009674 Ga0453683_0009674_665_1663 320
271 3300044683 Ga0466965_0017189 Ga0466965_0017189_1731_2732 320
272 3300044706 Ga0466964_0087437 Ga0466964_0087437_141_1145 320
273 3300044712 Ga0453684_0009535 Ga0453684_0009535_13795_14787 320
274 3300044712 Ga0453684_0015427 Ga0453684_0015427_4367_5416 320
275 3300044719 Ga0466971_0000017 Ga0466971_0000017_10140_11141 320
276 3300044842 Ga0466957_0004508 Ga0466957_0004508_2287_3291 320
277 3300045051 Ga0451576_0000332 Ga0451576_0000332_81263_82261 320
278 3300045051 Ga0451576_0031235 Ga0451576_0031235_218_1210 320
279 3300045051 Ga0451576_0040834 Ga0451576_0040834_1741_2739 320
280 3300045051 Ga0451576_0494651 Ga0451576_0494651_12_1007 320
281 3300046512 Ga0495610_0000501 Ga0495610_0000501_38349_39338 320
282 3300048918 Ga0496115_0267909 Ga0496115_0267909_182_1171 320
283 3300049568 Ga0501031_0001157 Ga0501031_0001157_1468_2466 320
284 3300049570 Ga0501033_0000271 Ga0501033_0000271_31765_32766 320
285 3300049573 Ga0501037_0000116 Ga0501037_0000116_22934_23932 320
286 3300049574 Ga0501038_0000976 Ga0501038_0000976_22231_23232 320
287 3300049574 Ga0501038_0023894 Ga0501038_0023894_3329_4327 320
288 3300049579 Ga0501043_0000342 Ga0501043_0000342_13022_14020 320
289 3300049579 Ga0501043_0009056 Ga0501043_0009056_4111_5109 320
290 3300049581 Ga0501047_0001211 Ga0501047_0001211_1613_2611 320
291 3300049581 Ga0501047_0212029 Ga0501047_0212029_263_1261 320
292 3300049822 Ga0501035_0001096 Ga0501035_0001096_1635_2633 320
293 3300049823 Ga0501044_0001911 Ga0501044_0001911_20039_21037 320
294 3300050005 Ga0501284_00021 Ga0501284_00021_19849_20838 320
295 3300053089 Ga0500581_101317 Ga0500581_101317_129_1121 320
296 3300053156 Ga0500622_0000110 Ga0500622_0000110_59619_60611 320
297 3300061719 Ga0466962_0000031 Ga0466962_0000031_62546_63547 320
298 3300001979 JGI24740J21852_10000909 JGI24740J21852_100009097 321
299 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022169 321
300 3300002738 JGI25154J39366_1000012 JGI25154J39366_100001280 321
301 3300002741 JGI25157J39369_1002623 JGI25157J39369_10026231 321
302 3300003215 JGI25153J46596_10001521 JGI25153J46596_100015218 321
303 3300003215 JGI25153J46596_10030563 JGI25153J46596_100305632 321
304 3300003316 rootH1_10005053 rootH1_100050534 321
305 3300003316 rootH1_10047104 rootH1_100471049 321
306 3300003320 rootH2_10022576 rootH2_100225761 321
307 3300003320 rootH2_10254709 rootH2_102547093 321
308 3300003322 rootL2_10194357 rootL2_101943573 321
309 3300003323 rootH1_10000912 rootH1_100009124 321
310 3300003323 rootH1_10011906 rootH1_1001190611 321
311 3300003323 rootH1_10065401 rootH1_100654011 321
312 3300003323 rootH1_10135166 rootH1_101351661 321
313 3300003354 JGI25160J50197_1001408 JGI25160J50197_10014088 321
314 3300003354 JGI25160J50197_1006219 JGI25160J50197_10062192 321
315 3300003354 JGI25160J50197_1012895 JGI25160J50197_10128952 321
316 3300003771 Ga0055526_1019645 Ga0055526_10196453 321
317 3300003790 Ga0055528_1001024 Ga0055528_100102410 321
318 3300003791 Ga0055530_10001218 Ga0055530_1000121811 321
319 3300003794 Ga0055531_10000357 Ga0055531_1000035737 321
320 3300005262 Ga0065165_1000228 Ga0065165_100022844 321
321 3300005295 Ga0065707_10009107 Ga0065707_100091074 321
322 3300005329 Ga0070683_100002306 Ga0070683_1000023066 321
323 3300005329 Ga0070683_100015970 Ga0070683_1000159703 321
324 3300005330 Ga0070690_100199829 Ga0070690_1001998292 321
325 3300005331 Ga0070670_100021498 Ga0070670_1000214985 321
326 3300005331 Ga0070670_100054482 Ga0070670_1000544824 321
327 3300005334 Ga0068869_100028430 Ga0068869_1000284302 321
328 3300005334 Ga0068869_100179633 Ga0068869_1001796332 321
329 3300005334 Ga0068869_100186980 Ga0068869_1001869801 321
330 3300005335 Ga0070666_10046889 Ga0070666_100468892 321
331 3300005337 Ga0070682_100014729 Ga0070682_1000147292 321
332 3300005338 Ga0068868_100007315 Ga0068868_10000731511 321
333 3300005339 Ga0070660_100020228 Ga0070660_1000202285 321
334 3300005340 Ga0070689_100005751 Ga0070689_1000057513 321
335 3300005340 Ga0070689_100106487 Ga0070689_1001064872 321
336 3300005341 Ga0070691_10031184 Ga0070691_100311842 321
337 3300005341 Ga0070691_10189475 Ga0070691_101894751 321
338 3300005344 Ga0070661_100000802 Ga0070661_10000080212 321
339 3300005344 Ga0070661_100009511 Ga0070661_1000095118 321
340 3300005347 Ga0070668_100276119 Ga0070668_1002761191 321
341 3300005353 Ga0070669_100006078 Ga0070669_1000060785 321
342 3300005354 Ga0070675_100002109 Ga0070675_10000210910 321
343 3300005354 Ga0070675_100210102 Ga0070675_1002101022 321
344 3300005356 Ga0070674_100147798 Ga0070674_1001477982 321
345 3300005364 Ga0070673_100003054 Ga0070673_1000030547 321
346 3300005365 Ga0070688_100037062 Ga0070688_1000370623 321
347 3300005366 Ga0070659_100022729 Ga0070659_1000227293 321
348 3300005438 Ga0070701_10119718 Ga0070701_101197182 321
349 3300005441 Ga0070700_100018102 Ga0070700_1000181023 321
350 3300005455 Ga0070663_100004079 Ga0070663_1000040793 321
351 3300005455 Ga0070663_100043477 Ga0070663_1000434772 321
352 3300005456 Ga0070678_100302267 Ga0070678_1003022672 321
353 3300005457 Ga0070662_100016770 Ga0070662_1000167704 321
354 3300005457 Ga0070662_100024520 Ga0070662_1000245203 321
355 3300005466 Ga0070685_10025998 Ga0070685_100259982 321
356 3300005535 Ga0070684_100000772 Ga0070684_10000077210 321
357 3300005535 Ga0070684_100004165 Ga0070684_1000041658 321
358 3300005535 Ga0070684_100207626 Ga0070684_1002076261 321
359 3300005539 Ga0068853_100001075 Ga0068853_1000010759 321
360 3300005543 Ga0070672_100039555 Ga0070672_1000395552 321
361 3300005548 Ga0070665_100194688 Ga0070665_1001946882 321
362 3300005563 Ga0068855_100033805 Ga0068855_1000338054 321
363 3300005563 Ga0068855_100035233 Ga0068855_1000352339 321
364 3300005563 Ga0068855_100063792 Ga0068855_1000637923 321
365 3300005564 Ga0070664_100000505 Ga0070664_10000050526 321
366 3300005564 Ga0070664_100004719 Ga0070664_10000471915 321
367 3300005577 Ga0068857_100001366 Ga0068857_1000013668 321
368 3300005577 Ga0068857_100133251 Ga0068857_1001332511 321
369 3300005578 Ga0068854_100103001 Ga0068854_1001030012 321
370 3300005614 Ga0068856_100006256 Ga0068856_1000062568 321
371 3300005614 Ga0068856_100190443 Ga0068856_1001904432 321
372 3300005616 Ga0068852_100014969 Ga0068852_1000149692 321
373 3300005616 Ga0068852_100075513 Ga0068852_1000755133 321
374 3300005616 Ga0068852_100089662 Ga0068852_1000896623 321
375 3300005617 Ga0068859_100047563 Ga0068859_1000475633 321
376 3300005617 Ga0068859_100293501 Ga0068859_1002935011 321
377 3300005618 Ga0068864_100178408 Ga0068864_1001784084 321
378 3300005618 Ga0068864_100517558 Ga0068864_1005175581 321
379 3300005718 Ga0068866_10045689 Ga0068866_100456892 321
380 3300005719 Ga0068861_100038817 Ga0068861_1000388173 321
381 3300005840 Ga0068870_10027862 Ga0068870_100278621 321
382 3300005842 Ga0068858_100039810 Ga0068858_1000398105 321
383 3300005844 Ga0068862_100009062 Ga0068862_1000090622 321
384 3300006195 Ga0075366_10063410 Ga0075366_100634103 321
385 3300006881 Ga0068865_100031844 Ga0068865_1000318443 321
386 3300006931 Ga0097620_100047568 Ga0097620_1000475683 321
387 3300006931 Ga0097620_100293523 Ga0097620_1002935231 321
388 3300009093 Ga0105240_10000074 Ga0105240_10000074158 321
389 3300009093 Ga0105240_10049831 Ga0105240_100498313 321
390 3300009093 Ga0105240_10064747 Ga0105240_100647473 321
391 3300009094 Ga0111539_10005613 Ga0111539_100056134 321
392 3300009174 Ga0105241_10001201 Ga0105241_1000120110 321
393 3300009174 Ga0105241_10005621 Ga0105241_100056215 321
394 3300009174 Ga0105241_10128316 Ga0105241_101283161 321
395 3300009545 Ga0105237_10005269 Ga0105237_100052694 321
396 3300009545 Ga0105237_10017271 Ga0105237_100172712 321
397 3300009545 Ga0105237_10034771 Ga0105237_100347714 321
398 3300009545 Ga0105237_10043473 Ga0105237_100434734 321
399 3300009545 Ga0105237_10560317 Ga0105237_105603171 321
400 3300009551 Ga0105238_10016556 Ga0105238_100165566 321
401 3300009553 Ga0105249_10168771 Ga0105249_101687712 321
402 3300010375 Ga0105239_10000887 Ga0105239_1000088725 321
403 3300010375 Ga0105239_10009010 Ga0105239_100090104 321
404 3300010375 Ga0105239_10010680 Ga0105239_100106809 321
405 3300010375 Ga0105239_10012494 Ga0105239_100124942 321
406 3300010375 Ga0105239_10156444 Ga0105239_101564442 321
407 3300010375 Ga0105239_10372322 Ga0105239_103723222 321
408 3300013102 Ga0157371_10001612 Ga0157371_100016129 321
409 3300013102 Ga0157371_10067722 Ga0157371_100677221 321
410 3300013104 Ga0157370_10047960 Ga0157370_100479602 321
411 3300013104 Ga0157370_10063597 Ga0157370_100635972 321
412 3300013104 Ga0157370_10179644 Ga0157370_101796442 321
413 3300013104 Ga0157370_10465677 Ga0157370_104656771 321
414 3300013105 Ga0157369_10003409 Ga0157369_1000340911 321
415 3300013105 Ga0157369_10005014 Ga0157369_100050148 321
416 3300013296 Ga0157374_10007884 Ga0157374_100078847 321
417 3300013306 Ga0163162_10011416 Ga0163162_1001141612 321
418 3300013306 Ga0163162_10035248 Ga0163162_100352481 321
419 3300013306 Ga0163162_10076045 Ga0163162_100760452 321
420 3300013306 Ga0163162_10126086 Ga0163162_101260862 321
421 3300013307 Ga0157372_10000010 Ga0157372_10000010233 321
422 3300013307 Ga0157372_10015090 Ga0157372_100150905 321
423 3300013308 Ga0157375_10026718 Ga0157375_100267187 321
424 3300013308 Ga0157375_10446316 Ga0157375_104463162 321
425 3300014325 Ga0163163_10008995 Ga0163163_100089955 321
426 3300014325 Ga0163163_10341600 Ga0163163_103416002 321
427 3300014326 Ga0157380_10002002 Ga0157380_1000200213 321
428 3300014745 Ga0157377_10002686 Ga0157377_100026862 321
429 3300014745 Ga0157377_10006329 Ga0157377_100063295 321
430 3300014745 Ga0157377_10020715 Ga0157377_100207152 321
431 3300014745 Ga0157377_10130274 Ga0157377_101302742 321
432 3300014968 Ga0157379_10021385 Ga0157379_100213855 321
433 3300014969 Ga0157376_10096530 Ga0157376_100965302 321
434 3300014969 Ga0157376_10194995 Ga0157376_101949952 321
435 3300017792 Ga0163161_10014139 Ga0163161_100141395 321
436 3300017792 Ga0163161_10057670 Ga0163161_100576704 321
437 3300025233 Ga0209437_100024 Ga0209437_100024483 321
438 3300025246 Ga0209646_1000009 Ga0209646_1000009195 321
439 3300025250 Ga0209026_1000197 Ga0209026_100019721 321
440 3300025273 Ga0209673_1000016 Ga0209673_1000016168 321
441 3300025295 Ga0209564_1006770 Ga0209564_10067704 321
442 3300025295 Ga0209564_1008008 Ga0209564_10080084 321
443 3300025295 Ga0209564_1033005 Ga0209564_10330052 321
444 3300025297 Ga0209758_1007651 Ga0209758_10076514 321
445 3300025297 Ga0209758_1008975 Ga0209758_10089754 321
446 3300025298 Ga0209050_1000124 Ga0209050_100012411 321
447 3300025302 Ga0207426_1000019 Ga0207426_100001954 321
448 3300025302 Ga0207426_1001572 Ga0207426_100157214 321
449 3300025302 Ga0207426_1003785 Ga0207426_10037852 321
450 3300025302 Ga0207426_1015343 Ga0207426_10153432 321
451 3300025304 Ga0209257_1000013 Ga0209257_1000013596 321
452 3300025304 Ga0209257_1004094 Ga0209257_10040946 321
453 3300025315 Ga0207697_10019450 Ga0207697_100194501 321
454 3300025904 Ga0207647_10108042 Ga0207647_101080422 321
455 3300025907 Ga0207645_10018056 Ga0207645_100180562 321
456 3300025907 Ga0207645_10021325 Ga0207645_100213252 321
457 3300025908 Ga0207643_10018405 Ga0207643_100184053 321
458 3300025911 Ga0207654_10016460 Ga0207654_100164601 321
459 3300025911 Ga0207654_10018719 Ga0207654_100187193 321
460 3300025913 Ga0207695_10003292 Ga0207695_1000329222 321
461 3300025913 Ga0207695_10008989 Ga0207695_100089895 321
462 3300025913 Ga0207695_10051258 Ga0207695_100512584 321
463 3300025913 Ga0207695_10069338 Ga0207695_100693383 321
464 3300025914 Ga0207671_10003305 Ga0207671_100033059 321
465 3300025914 Ga0207671_10015269 Ga0207671_100152695 321
466 3300025914 Ga0207671_10023392 Ga0207671_100233922 321
467 3300025914 Ga0207671_10049821 Ga0207671_100498215 321
468 3300025914 Ga0207671_10188304 Ga0207671_101883041 321
469 3300025920 Ga0207649_10001160 Ga0207649_1000116010 321
470 3300025920 Ga0207649_10007972 Ga0207649_100079722 321
471 3300025921 Ga0207652_10096068 Ga0207652_100960681 321
472 3300025923 Ga0207681_10006598 Ga0207681_100065985 321
473 3300025923 Ga0207681_10052908 Ga0207681_100529082 321
474 3300025924 Ga0207694_10037736 Ga0207694_100377361 321
475 3300025925 Ga0207650_10181671 Ga0207650_101816712 321
476 3300025926 Ga0207659_10044949 Ga0207659_100449492 321
477 3300025932 Ga0207690_10131266 Ga0207690_101312662 321
478 3300025933 Ga0207706_10028043 Ga0207706_100280432 321
479 3300025933 Ga0207706_10047114 Ga0207706_100471143 321
480 3300025937 Ga0207669_10105865 Ga0207669_101058652 321
481 3300025938 Ga0207704_10071969 Ga0207704_100719693 321
482 3300025940 Ga0207691_10043667 Ga0207691_100436672 321
483 3300025940 Ga0207691_10313882 Ga0207691_103138821 321
484 3300025942 Ga0207689_10023441 Ga0207689_100234412 321
485 3300025942 Ga0207689_10038084 Ga0207689_100380843 321
486 3300025942 Ga0207689_10104476 Ga0207689_101044762 321
487 3300025944 Ga0207661_10000929 Ga0207661_100009299 321
488 3300025944 Ga0207661_10006780 Ga0207661_100067808 321
489 3300025944 Ga0207661_10086409 Ga0207661_100864092 321
490 3300025945 Ga0207679_10000232 Ga0207679_1000023210 321
491 3300025945 Ga0207679_10006857 Ga0207679_100068574 321
492 3300025945 Ga0207679_10111968 Ga0207679_101119682 321
493 3300025949 Ga0207667_10016862 Ga0207667_1001686211 321
494 3300025960 Ga0207651_10104366 Ga0207651_101043661 321
495 3300025960 Ga0207651_10256122 Ga0207651_102561221 321
496 3300025981 Ga0207640_10015517 Ga0207640_100155172 321
497 3300026023 Ga0207677_10061708 Ga0207677_100617081 321
498 3300026023 Ga0207677_10099914 Ga0207677_100999141 321
499 3300026035 Ga0207703_10187578 Ga0207703_101875782 321
500 3300026041 Ga0207639_10001620 Ga0207639_100016208 321
501 3300026067 Ga0207678_10003893 Ga0207678_100038938 321
502 3300026089 Ga0207648_10001472 Ga0207648_1000147220 321
503 3300026089 Ga0207648_10114753 Ga0207648_101147533 321
504 3300026116 Ga0207674_10004099 Ga0207674_100040993 321
505 3300026116 Ga0207674_10009679 Ga0207674_1000967912 321
506 3300026116 Ga0207674_10018299 Ga0207674_100182995 321
507 3300026116 Ga0207674_10174999 Ga0207674_101749992 321
508 3300026118 Ga0207675_100000507 Ga0207675_10000050724 321
509 3300026118 Ga0207675_100109623 Ga0207675_1001096232 321
510 3300026142 Ga0207698_10161193 Ga0207698_101611931 321
511 3300027907 Ga0207428_10011632 Ga0207428_100116326 321
512 3300028379 Ga0268266_10087352 Ga0268266_100873523 321
513 3300028379 Ga0268266_10156777 Ga0268266_101567772 321
514 3300028786 Ga0307517_10072141 Ga0307517_100721412 321
515 3300028794 Ga0307515_10000001 Ga0307515_100000012947 321
516 3300028794 Ga0307515_10000057 Ga0307515_10000057254 321
517 3300030732 Ga0316176_1131516 Ga0316176_11315164 321
518 3300030742 Ga0316183_1119247 Ga0316183_111924714 321
519 3300030744 Ga0316181_1277597 Ga0316181_12775979 321
520 3300031251 Ga0265327_10010692 Ga0265327_100106925 321
521 3300031251 Ga0265327_10012845 Ga0265327_100128453 321
522 3300031727 Ga0316576_10173346 Ga0316576_101733461 321
523 3300031728 Ga0316578_10143502 Ga0316578_101435021 321
524 3300031730 Ga0307516_10002463 Ga0307516_100024632 321
525 3300031911 Ga0307412_10049819 Ga0307412_100498193 321
526 3300032002 Ga0307416_100139228 Ga0307416_1001392281 321
527 3300037312 Ga0395899_0001366 Ga0395899_0001366_141_1133 321
528 3300042015 Ga0439462_0001300 Ga0439462_0001300_3750_4745 321
529 3300042876 Ga0451577_0015166 Ga0451577_0015166_565_1563 321
530 3300042876 Ga0451577_0029962 Ga0451577_0029962_1687_2682 321
531 3300044658 Ga0466972_0003478 Ga0466972_0003478_6543_7538 321
532 3300044673 Ga0453683_0000045 Ga0453683_0000045_51035_52030 321
533 3300044673 Ga0453683_0040034 Ga0453683_0040034_1012_2007 321
534 3300044684 Ga0466966_0015916 Ga0466966_0015916_233_1225 321
535 3300044712 Ga0453684_0001715 Ga0453684_0001715_16613_17608 321
536 3300044712 Ga0453684_0039853 Ga0453684_0039853_2485_3483 321
537 3300044712 Ga0453684_0430841 Ga0453684_0430841_99_1094 321
538 3300044735 Ga0466968_0036113 Ga0466968_0036113_632_1630 321
539 3300044735 Ga0466968_0072231 Ga0466968_0072231_79_1074 321
540 3300045051 Ga0451576_0000175 Ga0451576_0000175_16614_17609 321
541 3300045051 Ga0451576_0031754 Ga0451576_0031754_823_1821 321
542 3300045051 Ga0451576_0049254 Ga0451576_0049254_1465_2460 321
543 3300046471 Ga0495650_0000036 Ga0495650_0000036_201961_202956 321
544 3300046501 Ga0495607_0048433 Ga0495607_0048433_1023_2018 321
545 3300046513 Ga0495616_0000925 Ga0495616_0000925_4695_5693 321
546 3300046523 Ga0495644_0029151 Ga0495644_0029151_29_1027 321
547 3300046660 Ga0495625_0014249 Ga0495625_0014249_1289_2284 321
548 3300046660 Ga0495625_0060198 Ga0495625_0060198_967_1962 321
549 3300046660 Ga0495625_0159923 Ga0495625_0159923_31_1029 321
550 3300046665 Ga0495661_0000563 Ga0495661_0000563_27618_28613 321
551 3300047320 Ga0495672_0033244 Ga0495672_0033244_507_1514 321
552 3300047472 Ga0495686_0000367 Ga0495686_0000367_63306_64301 321
553 3300047472 Ga0495686_0193243 Ga0495686_0193243_149_1144 321
554 3300048929 Ga0496126_0043806 Ga0496126_0043806_403_1395 321
555 3300049459 Ga0495678_020300 Ga0495678_020300_557_1555 321
556 3300049581 Ga0501047_0124423 Ga0501047_0124423_1394_2386 321
557 3300049758 Ga0501241_015421 Ga0501241_015421_243_1235 321
558 3300050493 nmdc:mga0k408_145968_c1 nmdc:mga0k408_145968_c1_330_1328 321
559 3300050511 nmdc:mga08y16_44554_c1 nmdc:mga08y16_44554_c1_1024_2022 321
560 3300053092 Ga0500583_0000188 Ga0500583_0000188_19692_20690 321
561 3300053104 Ga0500556_0074638 Ga0500556_0074638_181_1185 321
562 3300053131 Ga0500652_030512 Ga0500652_030512_1088_2080 321
563 3300053134 Ga0500658_0042859 Ga0500658_0042859_149_1153 321
564 3300053139 Ga0500568_0000236 Ga0500568_0000236_9438_10436 321
565 3300053157 Ga0500624_000158 Ga0500624_000158_11307_12302 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

57

367

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9176 2 315
3n2t-assembly1.cif.gz_A structure of the glycerol dehydrogenase akr11b4 from gluconobacter oxydans 0.9083 3 318
6ow0-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with nad+ and peg 0.9081 1 315
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9066 2 315
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.9056 1 315
ID Description Score Start End Superfamily
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9279 1 319 3.20.20.100
af_P77256_1_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9195 1 319 3.20.20.100
3n2tA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9083 3 318 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9064 2 315 3.20.20.100
af_Q2G0G6_3_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9008 2 315 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9903 129 212 GO:0004033
GO:0005737
AF-A0A7J8U949-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9818 104 212 GO:0004033
GO:0005737
GO:0016020
AF-A0A3N5LA91-F1-model_v4 Aldo/keto reductase 0.97 107 318 GO:0005829
GO:0016491
AF-A0A7K3IUI4-F1-model_v4 Aldo/keto reductase 0.9655 1 178 GO:0005829
AF-A0A660TTQ9-F1-model_v4 Aldo/keto reductase 0.9613 1 321 GO:0005829
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.51 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map