F464295

General Info

Members Datasets Scaffolds Average Seq Length
565 341 457 371

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0017855|Ga0495592_0017855_2244_3509
Length 421
Sequence VDFTACPRLVTAPEERPELLADPPALTSISVRRYAVGQSVKELAMSMIRDLRAVVRPALRKSTASYDYGPIHDPAAISAVVDCAVYRDGVRCTDNIGLRQALDAVRDGRPADSCDGSNGFVWIGLHEPTEQEFAGIAEAFGLHPLAVEDAVHAHQRPKLERYDDSLFTVFKTIRYVEHAELTSTSEVVESGEVMVFTGPYFVITVRHGGHGSLRALRHKLQDDPELLAKGPSAVLHAIADQVVDDYLAVTEAVQDDIDEVEIDVFSAGNGKTSRGGDAGRIYQLKREVLEFKRAVSPLLRPMQMLGERPMRLIDPEIQKYFRDVADHVARVHEQVTGFDDLLNSILQANLAQATVVQNEDMRKITAWAAILAVPTMITGVYGMNFTHMPELHWRYGYPAVLCTILAICYAIHRGFRRNGWL

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
8 2643221548 Streptomyces sp. Root55 Isolate Unclassified
9 2643221578 Streptomyces sp. Root63 Isolate Unclassified
10 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
11 2643221647 Streptomyces sp. Root369 Isolate Unclassified
12 2643221670 Streptomyces sp. Root431 Isolate Unclassified
13 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
14 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
15 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
16 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
17 2643221714 Streptomyces sp. Root264 Isolate Unclassified
18 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
19 2687453737 Frankia sp. BMG5.36 Isolate Nodule
20 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
21 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
27 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
28 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
29 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
30 2808606448 Streptomyces sp. 193411 Isolate Unclassified
31 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
32 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
33 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
34 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
35 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
36 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
37 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
38 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
39 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
40 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
41 2862574272 Streptomyces sp. AcE210 Isolate Nodule
42 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
43 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
44 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
45 2867369537 Streptomyces sp. Z26 Isolate Unclassified
46 2867428634 Streptomyces sp. RP5T Isolate Unclassified
47 2867475112 Streptomyces sp. TM32 Isolate Unclassified
48 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
49 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
50 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
51 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
52 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
53 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
54 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
55 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
56 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
57 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
58 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
59 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
60 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
61 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
62 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
63 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
64 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
65 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
66 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
67 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
68 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
69 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
70 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
71 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
72 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
73 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
74 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
75 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
76 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
77 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
78 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
79 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
80 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
81 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
82 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
83 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
84 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
85 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
86 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
87 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
91 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
92 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
147 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
153 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
161 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
162 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
163 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
164 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
165 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
196 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
202 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
300 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
301 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
302 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
303 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
304 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
308 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
309 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
310 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
311 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
314 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
317 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
322 8002775197 Frankia nepalensis CN7 Isolate Nodule
323 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
324 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
325 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
326 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
327 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
328 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
329 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
330 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
331 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
332 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
333 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
334 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
335 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
336 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
337 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
338 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
339 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
340 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
341 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.35
Metatranscriptomes 0.35
Isolates 19.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.14
Nodule 1.77
Rhizoplane 4.25
Rhizosphere 71.33
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10022234 3300001990 Bacteria 2016
2 JGI24738J21930_10008966 3300002075 Bacteria 2266
3 rootH1_10012411 3300003316 Bacteria 9835
4 rootH1_10012411 3300003323 Bacteria 38987
5 rootH2_10018520 3300003320 Bacteria 4597
6 rootH2_10027107 3300003320 Bacteria 2109
7 rootH1_10001118 3300003323 Bacteria 4969
8 JGI25160J50197_1014249 3300003354 Bacteria 2667
9 Ga0006562J51391_1115073 3300003578 Bacteria 1510
10 Ga0068853_100132122 3300005539 Bacteria 2236
11 Ga0068859_100000369 3300005617 Bacteria 44821
12 Ga0068859_100006167 3300005617 Bacteria 12183
13 Ga0068859_100006354 3300005617 Bacteria 11992
14 Ga0068863_100002187 3300005841 Bacteria 19398
15 Ga0068858_100015646 3300005842 Bacteria 7135
16 Ga0068862_100000004 3300005844 Bacteria 365124
17 Ga0081455_10000544 3300005937 Bacteria 48955
18 Ga0081455_10003977 3300005937 Bacteria 16770
19 Ga0081455_10048812 3300005937 Bacteria 3654
20 Ga0081455_10052380 3300005937 Bacteria 3494
21 Ga0081539_10027322 3300005985 Bacteria 3617
22 Ga0075365_10012783 3300006038 Bacteria 5000
23 Ga0075365_10023792 3300006038 Bacteria 3857
24 Ga0075368_10034777 3300006042 Bacteria 1965
25 Ga0075363_100026215 3300006048 Bacteria 2980
26 Ga0075428_100070120 3300006844 Bacteria 3832
27 Ga0075431_100084909 3300006847 Bacteria 3268
28 Ga0075429_100109138 3300006880 Bacteria 2419
29 Ga0097620_100000369 3300006931 Bacteria 44821
30 Ga0097620_100006167 3300006931 Bacteria 12183
31 Ga0097620_100006354 3300006931 Bacteria 11992
32 Ga0099826_10031880 3300006948 Bacteria 3806
33 Ga0105251_10004125 3300009011 Bacteria 10144
34 Ga0105245_10086412 3300009098 Bacteria 2876
35 Ga0105247_10001103 3300009101 Bacteria 20106
36 Ga0105247_10051760 3300009101 Bacteria 2530
37 Ga0105248_10000776 3300009177 Bacteria 35865
38 Ga0105249_10001546 3300009553 Bacteria 20185
39 Ga0105246_10004222 3300011119 Bacteria 8737
40 Ga0157369_10023576 3300013105 Bacteria 6854
41 Ga0157372_10222676 3300013307 Bacteria 2187
42 Ga0182008_10002326 3300014497 Bacteria 11974
43 Ga0182006_1047482 3300015261 Bacteria 1664
44 Ga0182007_10000334 3300015262 Bacteria 29904
45 Ga0183367_1002 3300015688 Bacteria 1101531
46 Ga0206353_11392024 3300020082 Bacteria 3197
47 Ga0207426_1000547 3300025302 Bacteria 52775
48 Ga0207426_1004337 3300025302 Bacteria 6979
49 Ga0207426_1024842 3300025302 Bacteria 2027
50 Ga0207713_1043084 3300025735 Bacteria 1868
51 Ga0207710_10003049 3300025900 Bacteria 7527
52 Ga0207647_10005427 3300025904 Bacteria 9345
53 Ga0207647_10133166 3300025904 Bacteria 1460
54 Ga0207654_10100719 3300025911 Bacteria 1780
55 Ga0207687_10009255 3300025927 Bacteria 6443
56 Ga0207687_10075741 3300025927 Bacteria 2415
57 Ga0207711_10000110 3300025941 Bacteria 85801
58 Ga0207703_10015151 3300026035 Bacteria 6017
59 Ga0207702_10107805 3300026078 Bacteria 2471
60 Ga0207641_10003349 3300026088 Bacteria 14246
61 Ga0207641_10304821 3300026088 Bacteria 1506
62 Ga0209371_1004056 3300027312 Bacteria 6618
63 Ga0209371_1019495 3300027312 Bacteria 1690
64 Ga0209813_10018215 3300027866 Bacteria 1937
65 Ga0268266_10220415 3300028379 Bacteria 1744
66 Ga0268265_10000009 3300028380 Bacteria 375889
67 Ga0307517_10005644 3300028786 Bacteria 18766
68 Ga0307517_10023238 3300028786 Bacteria 7718
69 Ga0307517_10034222 3300028786 Bacteria 5794
70 Ga0307515_10000730 3300028794 Bacteria 75859
71 Ga0307515_10083839 3300028794 Bacteria 4103
72 Ga0307515_10217403 3300028794 Bacteria 1738
73 Ga0268256_1003670 3300030500 Bacteria 6781
74 Ga0268256_1022703 3300030500 Bacteria 1641
75 Ga0307511_10001322 3300030521 Bacteria 26289
76 Ga0307511_10036481 3300030521 Bacteria 4267
77 Ga0307511_10072638 3300030521 Bacteria 2497
78 Ga0307512_10014179 3300030522 Bacteria 7438
79 Ga0307513_10003436 3300031456 Bacteria 21459
80 Ga0307513_10182061 3300031456 Bacteria 1963
81 Ga0307509_10016379 3300031507 Bacteria 8581
82 Ga0307509_10054693 3300031507 Bacteria 4247
83 Ga0307508_10007254 3300031616 Bacteria 10326
84 Ga0307508_10179476 3300031616 Bacteria 1719
85 Ga0307508_10222420 3300031616 Bacteria 1487
86 Ga0307514_10005453 3300031649 Bacteria 11334
87 Ga0307514_10012642 3300031649 Bacteria 7018
88 Ga0307514_10040366 3300031649 Bacteria 3679
89 Ga0307514_10049163 3300031649 Bacteria 3281
90 Ga0307516_10044045 3300031730 Bacteria 4418
91 Ga0307516_10131845 3300031730 Bacteria 2278
92 Ga0307516_10155760 3300031730 Bacteria 2040
93 Ga0307518_10093986 3300031838 Bacteria 2154
94 Ga0307411_10105931 3300032005 Bacteria 2000
95 Ga0307415_100143855 3300032126 Bacteria 1825
96 Ga0307507_10124900 3300033179 Bacteria 2041
97 Ga0307510_10015532 3300033180 Bacteria 9006
98 Ga0307510_10019791 3300033180 Bacteria 7884
99 Ga0307510_10057601 3300033180 Bacteria 4031
100 Ga0373947_0038367 3300035725 Bacteria 2846
101 Ga0395899_0097383 3300037312 Bacteria 2127
102 Ga0395898_0001672 3300037466 Bacteria 29724
103 Ga0395898_0007476 3300037466 Bacteria 11602
104 Ga0395898_0054372 3300037466 Bacteria 3907
105 Ga0395901_0016220 3300038443 Bacteria 7589
106 Ga0439436_0000265 3300041404 Bacteria 12596
107 Ga0439439_0005591 3300041406 Bacteria 2877
108 Ga0451853_0698293 3300041512 Bacteria 3957
109 Ga0439433_0003616 3300041999 Bacteria 3324
110 Ga0439433_0007902 3300041999 Bacteria 2300
111 Ga0439449_0000119 3300042007 Bacteria 26018
112 Ga0439449_0004153 3300042007 Bacteria 5603
113 Ga0439455_0003950 3300042012 Bacteria 2892
114 Ga0439457_000793 3300042014 Bacteria 9429
115 Ga0439457_003618 3300042014 Bacteria 4187
116 Ga0439462_0000354 3300042015 Bacteria 8701
117 Ga0450894_000406 3300042131 Bacteria 7403
118 Ga0450898_000245 3300042134 Bacteria 5945
119 Ga0450903_000330 3300042138 Bacteria 10403
120 Ga0450906_001989 3300042145 Bacteria 4467
121 Ga0439458_0004298 3300042157 Bacteria 3281
122 Ga0450901_000975 3300042533 Bacteria 3325
123 Ga0466969_0019899 3300044656 Bacteria 3480
124 Ga0466972_0002489 3300044658 Bacteria 9106
125 Ga0466972_0005954 3300044658 Bacteria 6123
126 Ga0466965_0022601 3300044683 Bacteria 3032
127 Ga0466966_0003730 3300044684 Bacteria 10044
128 Ga0466966_0006650 3300044684 Bacteria 7658
129 Ga0466961_0007021 3300044693 Bacteria 7164
130 Ga0466963_0000757 3300044694 Bacteria 15971
131 Ga0466963_0001060 3300044694 Bacteria 14303
132 Ga0466963_0130412 3300044694 Bacteria 1736
133 Ga0466971_0001164 3300044719 Bacteria 10939
134 Ga0466971_0016733 3300044719 Bacteria 3239
135 Ga0466970_0007417 3300044765 Bacteria 5494
136 Ga0466970_0017354 3300044765 Bacteria 3719
137 Ga0466957_0000680 3300044842 Bacteria 17331
138 Ga0466959_0003366 3300045049 Bacteria 10449
139 Ga0466958_0000521 3300045836 Bacteria 16196
140 Ga0466967_0008154 3300045976 Bacteria 7647
141 Ga0466967_0013001 3300045976 Bacteria 6404
142 Ga0495617_022745 3300046452 Bacteria 2119
143 Ga0495627_024508 3300046453 Bacteria 1966
144 Ga0495627_032673 3300046453 Bacteria 1637
145 Ga0495592_0005464 3300046454 Bacteria 9385
146 Ga0495592_0010355 3300046454 Bacteria 7032
147 Ga0495592_0017855 3300046454 Bacteria 5392
148 Ga0495603_0000105 3300046455 Bacteria 39641
149 Ga0495603_0001024 3300046455 Bacteria 16133
150 Ga0495603_0008884 3300046455 Bacteria 6075
151 Ga0495603_0019886 3300046455 Bacteria 4066
152 Ga0495603_0022423 3300046455 Bacteria 3823
153 Ga0495603_0086323 3300046455 Bacteria 1837
154 Ga0495603_0111062 3300046455 Bacteria 1599
155 Ga0495603_0122040 3300046455 Bacteria 1518
156 Ga0495590_0026622 3300046457 Bacteria 2030
157 Ga0495629_0001788 3300046459 Bacteria 16843
158 Ga0495629_0002406 3300046459 Bacteria 14398
159 Ga0495629_0002439 3300046459 Bacteria 14276
160 Ga0495629_0068138 3300046459 Bacteria 2483
161 Ga0495629_0134525 3300046459 Bacteria 1721
162 Ga0495629_0198994 3300046459 Bacteria 1385
163 Ga0495638_0014454 3300046460 Bacteria 5334
164 Ga0495638_0018513 3300046460 Bacteria 4624
165 Ga0495638_0077912 3300046460 Bacteria 2017
166 Ga0495638_0145452 3300046460 Bacteria 1379
167 Ga0495651_0001482 3300046462 Bacteria 18159
168 Ga0495651_0009326 3300046462 Bacteria 7533
169 Ga0495651_0034026 3300046462 Bacteria 3973
170 Ga0495651_0066870 3300046462 Bacteria 2742
171 Ga0495582_0006539 3300046473 Bacteria 6470
172 Ga0495639_0072453 3300046475 Bacteria 1593
173 Ga0495662_0002634 3300046476 Bacteria 9078
174 Ga0495662_0025698 3300046476 Bacteria 2843
175 Ga0495662_0086629 3300046476 Bacteria 1525
176 Ga0495664_0002684 3300046477 Bacteria 9572
177 Ga0495664_0007453 3300046477 Bacteria 6078
178 Ga0495664_0021999 3300046477 Bacteria 3688
179 Ga0495585_0032000 3300046492 Bacteria 2983
180 Ga0495594_0000767 3300046499 Bacteria 16484
181 Ga0495594_0015260 3300046499 Bacteria 4034
182 Ga0495594_0031174 3300046499 Bacteria 2890
183 Ga0495594_0065667 3300046499 Bacteria 2012
184 Ga0495594_0073883 3300046499 Bacteria 1899
185 Ga0495607_0073418 3300046501 Bacteria 1901
186 Ga0495606_0016647 3300046507 Bacteria 5596
187 Ga0495608_0059383 3300046511 Bacteria 2520
188 Ga0495616_0004779 3300046513 Bacteria 8485
189 Ga0495620_0028129 3300046515 Bacteria 2618
190 Ga0495628_0020604 3300046516 Bacteria 5436
191 Ga0495628_0108167 3300046516 Bacteria 2140
192 Ga0495630_0032322 3300046517 Bacteria 3899
193 Ga0495631_0016938 3300046518 Bacteria 3458
194 Ga0495632_0039439 3300046519 Bacteria 2384
195 Ga0495637_0025007 3300046520 Bacteria 2697
196 Ga0495643_0003534 3300046522 Bacteria 11363
197 Ga0495666_0038989 3300046526 Bacteria 2309
198 Ga0495666_0078525 3300046526 Bacteria 1563
199 Ga0495652_0071286 3300046529 Bacteria 2901
200 Ga0495652_0159754 3300046529 Bacteria 1751
201 Ga0495654_0004499 3300046530 Bacteria 8256
202 Ga0495640_0006165 3300046533 Bacteria 9503
203 Ga0495640_0066475 3300046533 Bacteria 2431
204 Ga0495640_0145415 3300046533 Bacteria 1525
205 Ga0495609_0018136 3300046538 Bacteria 3264
206 Ga0495597_0047717 3300046542 Bacteria 1895
207 Ga0495645_0004412 3300046543 Bacteria 9616
208 Ga0495645_0021795 3300046543 Bacteria 4632
209 Ga0495622_0005213 3300046557 Bacteria 6027
210 Ga0495622_0013017 3300046557 Bacteria 3861
211 Ga0495622_0015045 3300046557 Bacteria 3597
212 Ga0495622_0039809 3300046557 Bacteria 2188
213 Ga0495633_0020015 3300046558 Bacteria 3373
214 Ga0495667_0036534 3300046559 Bacteria 3279
215 Ga0495667_0070176 3300046559 Bacteria 2286
216 Ga0495656_0022559 3300046615 Bacteria 2467
217 Ga0495656_0042104 3300046615 Bacteria 1911
218 Ga0495656_0057066 3300046615 Bacteria 1689
219 Ga0495634_0005830 3300046642 Bacteria 9401
220 Ga0495634_0032201 3300046642 Bacteria 3606
221 Ga0495634_0056583 3300046642 Bacteria 2619
222 Ga0495611_0006196 3300046648 Bacteria 5103
223 Ga0495611_0052938 3300046648 Bacteria 1831
224 Ga0495625_0046065 3300046660 Bacteria 3148
225 Ga0495625_0058642 3300046660 Bacteria 2734
226 Ga0495625_0143401 3300046660 Bacteria 1610
227 Ga0495635_0001059 3300046663 Bacteria 18224
228 Ga0495635_0043822 3300046663 Bacteria 3086
229 Ga0495661_0035753 3300046665 Bacteria 3115
230 Ga0495661_0091157 3300046665 Bacteria 1733
231 Ga0495588_0008445 3300046674 Bacteria 4727
232 Ga0495588_0028429 3300046674 Bacteria 2798
233 Ga0495657_0002555 3300046675 Bacteria 15272
234 Ga0495657_0019276 3300046675 Bacteria 4923
235 Ga0495657_0048584 3300046675 Bacteria 2861
236 Ga0495646_0072259 3300046680 Bacteria 2029
237 Ga0495658_0059556 3300046683 Bacteria 2187
238 Ga0495613_0000527 3300046689 Bacteria 31977
239 Ga0495613_0021363 3300046689 Bacteria 4826
240 Ga0495613_0021832 3300046689 Bacteria 4771
241 Ga0495624_0019007 3300046690 Bacteria 4590
242 Ga0495670_0011680 3300046691 Bacteria 4323
243 Ga0495670_0016314 3300046691 Bacteria 3649
244 Ga0495670_0016687 3300046691 Bacteria 3611
245 Ga0495671_0088082 3300046692 Bacteria 1520
246 Ga0495649_0068862 3300046694 Bacteria 1898
247 Ga0495589_0019825 3300046794 Bacteria 3441
248 Ga0495589_0025044 3300046794 Bacteria 3029
249 Ga0495589_0033458 3300046794 Bacteria 2581
250 Ga0495600_0076102 3300046809 Bacteria 2191
251 Ga0495600_0094940 3300046809 Bacteria 1944
252 Ga0495660_0029346 3300046810 Bacteria 3104
253 Ga0495581_0032516 3300047315 Bacteria 3020
254 Ga0495604_0037006 3300047317 Bacteria 3845
255 Ga0495604_0041679 3300047317 Bacteria 3600
256 Ga0495636_0002641 3300047318 Bacteria 6909
257 Ga0495676_0001537 3300047321 Bacteria 19990
258 Ga0495676_0003037 3300047321 Bacteria 15181
259 Ga0495676_0005482 3300047321 Bacteria 11634
260 Ga0495676_0006123 3300047321 Bacteria 11069
261 Ga0495676_0033467 3300047321 Bacteria 4327
262 Ga0495680_0122059 3300047322 Bacteria 1922
263 Ga0495683_0054570 3300047323 Bacteria 1991
264 Ga0495687_000878 3300047443 Bacteria 31877
265 Ga0495687_001781 3300047443 Bacteria 19021
266 Ga0495687_018912 3300047443 Bacteria 3393
267 Ga0495675_0059963 3300047444 Bacteria 2412
268 Ga0495685_000551 3300047447 Bacteria 11592
269 Ga0495685_001287 3300047447 Bacteria 7658
270 Ga0495685_001744 3300047447 Bacteria 6704
271 Ga0495685_002112 3300047447 Bacteria 6175
272 Ga0495685_014846 3300047447 Bacteria 2651
273 Ga0495685_037747 3300047447 Bacteria 1655
274 Ga0495673_0048726 3300047469 Bacteria 1867
275 Ga0495681_0000813 3300047470 Bacteria 23988
276 Ga0495681_0000877 3300047470 Bacteria 23215
277 Ga0495681_0000904 3300047470 Bacteria 22924
278 Ga0495681_0002885 3300047470 Bacteria 12152
279 Ga0495686_0009561 3300047472 Bacteria 6969
280 Ga0495686_0019676 3300047472 Bacteria 4509
281 Ga0495686_0026465 3300047472 Bacteria 3794
282 Ga0495686_0085604 3300047472 Bacteria 1919
283 Ga0495593_0000891 3300047673 Bacteria 17356
284 Ga0495593_0013261 3300047673 Bacteria 4705
285 Ga0495602_0012356 3300048088 Bacteria 8784
286 Ga0495614_0000088 3300048089 Bacteria 30664
287 Ga0495614_0075713 3300048089 Bacteria 1454
288 Ga0495614_0079172 3300048089 Bacteria 1422
289 Ga0496100_0003431 3300048903 Bacteria 8265
290 Ga0496101_0017264 3300048904 Bacteria 4893
291 Ga0496101_0031692 3300048904 Bacteria 3718
292 Ga0496102_0000059 3300048905 Bacteria 168633
293 Ga0496102_0026270 3300048905 Bacteria 5192
294 Ga0496103_0000063 3300048906 Bacteria 128503
295 Ga0496103_0117461 3300048906 Bacteria 1693
296 Ga0496104_0036909 3300048907 Bacteria 4569
297 Ga0496104_0158288 3300048907 Bacteria 2173
298 Ga0496105_0028919 3300048908 Bacteria 4535
299 Ga0496107_0004108 3300048910 Bacteria 9808
300 Ga0496107_0026592 3300048910 Bacteria 4103
301 Ga0496108_0011058 3300048911 Bacteria 7328
302 Ga0496109_0000461 3300048912 Bacteria 34811
303 Ga0496110_0002545 3300048913 Bacteria 13703
304 Ga0496110_0055917 3300048913 Bacteria 3472
305 Ga0496111_0002517 3300048914 Bacteria 11049
306 Ga0496111_0163985 3300048914 Bacteria 1650
307 Ga0496112_0080401 3300048915 Bacteria 3223
308 Ga0496113_0022784 3300048916 Bacteria 4435
309 Ga0496113_0091262 3300048916 Bacteria 2348
310 Ga0496114_0248725 3300048917 Bacteria 1564
311 Ga0496115_0067277 3300048918 Bacteria 2897
312 Ga0496118_0020756 3300048921 Bacteria 5816
313 Ga0496118_0035631 3300048921 Bacteria 4037
314 Ga0496119_0036267 3300048922 Bacteria 3221
315 Ga0501031_0018462 3300049568 Bacteria 4538
316 Ga0501031_0019079 3300049568 Bacteria 4464
317 Ga0501031_0031782 3300049568 Bacteria 3443
318 Ga0501032_0003339 3300049569 Bacteria 12314
319 Ga0501032_0005708 3300049569 Bacteria 9212
320 Ga0501032_0013740 3300049569 Bacteria 5746
321 Ga0501032_0031390 3300049569 Bacteria 3642
322 Ga0501032_0036871 3300049569 Bacteria 3336
323 Ga0501033_0002346 3300049570 Bacteria 16141
324 Ga0501033_0036736 3300049570 Bacteria 3669
325 Ga0501033_0050027 3300049570 Bacteria 3101
326 Ga0501033_0115523 3300049570 Bacteria 1950
327 Ga0501034_0004359 3300049571 Bacteria 15775
328 Ga0501034_0018217 3300049571 Bacteria 7204
329 Ga0501034_0030121 3300049571 Bacteria 5516
330 Ga0501034_0073429 3300049571 Bacteria 3429
331 Ga0501034_0193782 3300049571 Bacteria 1993
332 Ga0501036_0007006 3300049572 Bacteria 9177
333 Ga0501036_0020832 3300049572 Bacteria 5507
334 Ga0501036_0032785 3300049572 Bacteria 4391
335 Ga0501036_0067018 3300049572 Bacteria 3037
336 Ga0501036_0119231 3300049572 Bacteria 2228
337 Ga0501036_0173628 3300049572 Bacteria 1815
338 Ga0501037_0004467 3300049573 Bacteria 10161
339 Ga0501037_0007823 3300049573 Bacteria 7828
340 Ga0501037_0011562 3300049573 Bacteria 6497
341 Ga0501037_0017590 3300049573 Bacteria 5262
342 Ga0501037_0030999 3300049573 Bacteria 3948
343 Ga0501037_0064808 3300049573 Bacteria 2662
344 Ga0501038_0002533 3300049574 Bacteria 17039
345 Ga0501038_0002584 3300049574 Bacteria 16897
346 Ga0501038_0006625 3300049574 Bacteria 10712
347 Ga0501038_0028091 3300049574 Bacteria 4998
348 Ga0501038_0043335 3300049574 Bacteria 3913
349 Ga0501038_0046992 3300049574 Bacteria 3740
350 Ga0501038_0072970 3300049574 Bacteria 2907
351 Ga0501038_0092057 3300049574 Bacteria 2539
352 Ga0501038_0142703 3300049574 Bacteria 1958
353 Ga0501039_0004452 3300049575 Bacteria 10576
354 Ga0501039_0010236 3300049575 Bacteria 7145
355 Ga0501039_0024332 3300049575 Bacteria 4650
356 Ga0501039_0032929 3300049575 Bacteria 3998
357 Ga0501039_0058002 3300049575 Bacteria 2998
358 Ga0501041_0002172 3300049577 Bacteria 11067
359 Ga0501042_0029437 3300049578 Bacteria 3872
360 Ga0501042_0038573 3300049578 Bacteria 3392
361 Ga0501043_0004540 3300049579 Bacteria 11285
362 Ga0501043_0005172 3300049579 Bacteria 10557
363 Ga0501043_0019120 3300049579 Bacteria 5377
364 Ga0501043_0033211 3300049579 Bacteria 4058
365 Ga0501043_0061426 3300049579 Bacteria 2951
366 Ga0501043_0076751 3300049579 Bacteria 2625
367 Ga0501043_0099216 3300049579 Bacteria 2289
368 Ga0501043_0239643 3300049579 Bacteria 1399
369 Ga0501046_0007048 3300049580 Bacteria 9901
370 Ga0501046_0023462 3300049580 Bacteria 5075
371 Ga0501046_0110473 3300049580 Bacteria 2101
372 Ga0501047_0000064 3300049581 Bacteria 136110
373 Ga0501047_0006747 3300049581 Bacteria 10791
374 Ga0501047_0008036 3300049581 Bacteria 9952
375 Ga0501047_0011894 3300049581 Bacteria 8235
376 Ga0501047_0013511 3300049581 Bacteria 7741
377 Ga0501047_0081399 3300049581 Bacteria 3112
378 Ga0501047_0091287 3300049581 Bacteria 2923
379 Ga0501047_0259128 3300049581 Bacteria 1587
380 Ga0501048_0005365 3300049582 Bacteria 9748
381 Ga0501048_0012241 3300049582 Bacteria 6385
382 Ga0501048_0035993 3300049582 Bacteria 3560
383 Ga0501067_0009327 3300049583 Bacteria 5438
384 Ga0501068_0005748 3300049584 Bacteria 6801
385 Ga0501069_0032258 3300049585 Bacteria 2882
386 Ga0501070_0000534 3300049586 Bacteria 34857
387 Ga0501070_0015355 3300049586 Bacteria 6444
388 Ga0501070_0023561 3300049586 Bacteria 5157
389 Ga0501070_0126976 3300049586 Bacteria 2107
390 Ga0501071_0003685 3300049587 Bacteria 9613
391 Ga0501072_0009784 3300049588 Bacteria 7289
392 Ga0501073_0033117 3300049589 Bacteria 3681
393 Ga0501074_0000721 3300049590 Bacteria 20738
394 Ga0501076_0047011 3300049592 Bacteria 3411
395 Ga0501077_0023223 3300049593 Bacteria 3932
396 Ga0501079_0009315 3300049741 Bacteria 7443
397 Ga0501080_0022361 3300049742 Bacteria 5858
398 Ga0501083_0001156 3300049744 Bacteria 17773
399 Ga0501035_0002605 3300049822 Bacteria 17611
400 Ga0501035_0044294 3300049822 Bacteria 4007
401 Ga0501035_0081641 3300049822 Bacteria 2853
402 Ga0501035_0089981 3300049822 Bacteria 2702
403 Ga0501035_0142230 3300049822 Bacteria 2085
404 Ga0501044_0000847 3300049823 Bacteria 36738
405 Ga0501044_0012617 3300049823 Bacteria 9150
406 Ga0501044_0016144 3300049823 Bacteria 8026
407 Ga0501044_0016446 3300049823 Bacteria 7940
408 Ga0501044_0046434 3300049823 Bacteria 4496
409 Ga0501044_0078369 3300049823 Bacteria 3348
410 Ga0501044_0080261 3300049823 Bacteria 3304
411 Ga0501044_0094916 3300049823 Bacteria 3006
412 Ga0501044_0117519 3300049823 Bacteria 2663
413 Ga0501045_0068664 3300049824 Bacteria 2604
414 Ga0501045_0158447 3300049824 Bacteria 1684
415 nmdc:mga06z11_3856_c1 3300050494 Bacteria 5843
416 nmdc:mga04h51_4305_c1 3300050495 Bacteria 3529
417 nmdc:mga09592_106205_c1 3300050508 Bacteria 2408
418 nmdc:mga06r32_131476_c1 3300050510 Bacteria 2475
419 Ga0500578_0015688 3300053086 Bacteria 4865
420 Ga0500646_0050061 3300053090 Bacteria 1203
421 Ga0500566_0009744 3300053094 Bacteria 5671
422 Ga0500566_0055413 3300053094 Bacteria 2258
423 Ga0500640_007360 3300053095 Bacteria 4276
424 Ga0500654_015775 3300053099 Bacteria 4982
425 Ga0500553_062819 3300053101 Bacteria 1736
426 Ga0500553_076443 3300053101 Bacteria 1522
427 Ga0500560_018339 3300053107 Bacteria 1948
428 Ga0500560_024114 3300053107 Bacteria 1772
429 Ga0500560_050765 3300053107 Bacteria 1330
430 Ga0500569_006987 3300053109 Bacteria 2509
431 Ga0500652_001311 3300053131 Bacteria 7855
432 Ga0500652_001764 3300053131 Bacteria 6561
433 Ga0500652_006328 3300053131 Bacteria 3805
434 Ga0500658_0006593 3300053134 Bacteria 4305
435 Ga0500658_0017109 3300053134 Bacteria 2705
436 Ga0500561_0000837 3300053137 Bacteria 4921
437 Ga0500561_0001803 3300053137 Bacteria 3531
438 Ga0500573_0005625 3300053140 Bacteria 6726
439 Ga0500573_0139008 3300053140 Bacteria 1339
440 Ga0500579_028611 3300053143 Bacteria 3585
441 Ga0500588_0024039 3300053146 Bacteria 1678
442 Ga0500600_0005069 3300053149 Bacteria 7757
443 Ga0500600_0006238 3300053149 Bacteria 7095
444 Ga0500600_0023917 3300053149 Bacteria 3646
445 Ga0500616_0005010 3300053153 Bacteria 9178
446 Ga0500616_0034631 3300053153 Bacteria 2749
447 Ga0500624_001891 3300053157 Bacteria 3024
448 Ga0500634_0105484 3300053161 Bacteria 1401
449 Ga0500636_0066723 3300053177 Bacteria 2092
450 Ga0500656_001238 3300053732 Bacteria 2160
451 Ga0500587_000141 3300053739 Bacteria 6863
452 Ga0500587_001729 3300053739 Bacteria 3099
453 Ga0500587_003696 3300053739 Bacteria 2126
454 Ga0501084_0001950 3300054114 Bacteria 16472
455 Ga0501082_0006599 3300060353 Bacteria 10039
456 Ga0466962_0000989 3300061719 Bacteria 12955
457 Ga0530510_0195871 3300061734 Bacteria 1500

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0198994 Ga0495629_0198994_138_1232 285
2 3300046499 Ga0495594_0073883 Ga0495594_0073883_586_1647 285
3 3300003323 rootH1_10001118 rootH1_100011183 294
4 3300053107 Ga0500560_050765 Ga0500560_050765_20_910 294
5 3300053094 Ga0500566_0055413 Ga0500566_0055413_239_1333 302
6 3300033179 Ga0307507_10124900 Ga0307507_101249002 303
7 3300046460 Ga0495638_0077912 Ga0495638_0077912_20_1081 311
8 3300028786 Ga0307517_10034222 Ga0307517_100342222 313
9 3300030521 Ga0307511_10072638 Ga0307511_100726382 313
10 3300031730 Ga0307516_10155760 Ga0307516_101557602 313
11 3300046519 Ga0495632_0039439 Ga0495632_0039439_1262_2356 313
12 3300047447 Ga0495685_001744 Ga0495685_001744_1663_2757 313
13 3300047470 Ga0495681_0002885 Ga0495681_0002885_6826_7920 313
14 3300053086 Ga0500578_0015688 Ga0500578_0015688_2188_3282 313
15 3300053090 Ga0500646_0050061 Ga0500646_0050061_36_1130 313
16 3300053131 Ga0500652_001764 Ga0500652_001764_1692_2786 313
17 3300053134 Ga0500658_0017109 Ga0500658_0017109_1570_2664 313
18 3300053146 Ga0500588_0024039 Ga0500588_0024039_286_1380 313
19 3300053149 Ga0500600_0023917 Ga0500600_0023917_1079_2173 313
20 3300053153 Ga0500616_0005010 Ga0500616_0005010_5710_6804 313
21 3300053739 Ga0500587_003696 Ga0500587_003696_499_1593 313
22 3300025911 Ga0207654_10100719 Ga0207654_101007192 316
23 3300053732 Ga0500656_001238 Ga0500656_001238_43_1038 319
24 3300053101 Ga0500553_076443 Ga0500553_076443_231_1325 322
25 3300053107 Ga0500560_018339 Ga0500560_018339_459_1553 322
26 3300035725 Ga0373947_0038367 Ga0373947_0038367_1509_2537 324
27 3300046518 Ga0495631_0016938 Ga0495631_0016938_2424_3431 325
28 3300046692 Ga0495671_0088082 Ga0495671_0088082_487_1494 325
29 3300048904 Ga0496101_0017264 Ga0496101_0017264_3144_4244 326
30 3300048906 Ga0496103_0117461 Ga0496103_0117461_133_1233 326
31 3300048910 Ga0496107_0004108 Ga0496107_0004108_7819_8919 326
32 3300048917 Ga0496114_0248725 Ga0496114_0248725_257_1357 326
33 3300048918 Ga0496115_0067277 Ga0496115_0067277_1035_2135 326
34 3300053140 Ga0500573_0139008 Ga0500573_0139008_226_1308 326
35 3300005937 Ga0081455_10000544 Ga0081455_1000054431 327
36 3300026088 Ga0207641_10304821 Ga0207641_103048212 327
37 3300032126 Ga0307415_100143855 Ga0307415_1001438552 327
38 3300046533 Ga0495640_0145415 Ga0495640_0145415_394_1428 327
39 3300048905 Ga0496102_0026270 Ga0496102_0026270_3462_4526 327
40 3300048907 Ga0496104_0036909 Ga0496104_0036909_1688_2752 327
41 3300048907 Ga0496104_0158288 Ga0496104_0158288_136_1200 327
42 3300048908 Ga0496105_0028919 Ga0496105_0028919_1015_2079 327
43 3300048910 Ga0496107_0026592 Ga0496107_0026592_642_1706 327
44 3300048911 Ga0496108_0011058 Ga0496108_0011058_431_1495 327
45 3300048912 Ga0496109_0000461 Ga0496109_0000461_11736_12800 327
46 3300048913 Ga0496110_0002545 Ga0496110_0002545_3579_4643 327
47 3300048913 Ga0496110_0055917 Ga0496110_0055917_1893_2957 327
48 3300048914 Ga0496111_0002517 Ga0496111_0002517_9168_10232 327
49 3300048914 Ga0496111_0163985 Ga0496111_0163985_186_1250 327
50 3300048915 Ga0496112_0080401 Ga0496112_0080401_621_1685 327
51 3300048916 Ga0496113_0022784 Ga0496113_0022784_3346_4410 327
52 3300048916 Ga0496113_0091262 Ga0496113_0091262_1220_2284 327
53 3300049822 Ga0501035_0089981 Ga0501035_0089981_1609_2631 327
54 3300049823 Ga0501044_0000847 Ga0501044_0000847_19810_20925 327
55 3300006048 Ga0075363_100026215 Ga0075363_1000262153 328
56 3300009177 Ga0105248_10000776 Ga0105248_1000077632 329
57 3300048921 Ga0496118_0020756 Ga0496118_0020756_3039_4055 329
58 3300006038 Ga0075365_10012783 Ga0075365_100127833 330
59 3300005937 Ga0081455_10003977 Ga0081455_100039779 332
60 3300005937 Ga0081455_10048812 Ga0081455_100488123 332
61 3300005985 Ga0081539_10027322 Ga0081539_100273223 332
62 3300006844 Ga0075428_100070120 Ga0075428_1000701203 332
63 3300006847 Ga0075431_100084909 Ga0075431_1000849092 332
64 3300006880 Ga0075429_100109138 Ga0075429_1001091382 332
65 3300025927 Ga0207687_10075741 Ga0207687_100757412 332
66 3300046455 Ga0495603_0122040 Ga0495603_0122040_297_1409 332
67 3300046615 Ga0495656_0022559 Ga0495656_0022559_1280_2389 332
68 3300048903 Ga0496100_0003431 Ga0496100_0003431_3440_4540 332
69 3300050508 nmdc:mga09592_106205_c1 nmdc:mga09592_106205_c1_125_1150 332
70 3300050510 nmdc:mga06r32_131476_c1 nmdc:mga06r32_131476_c1_345_1370 332
71 3300046683 Ga0495658_0059556 Ga0495658_0059556_890_1984 333
72 3300053094 Ga0500566_0009744 Ga0500566_0009744_3848_4942 333
73 iso_pu_bacteria 2862705112 2862711262 333
74 3300009098 Ga0105245_10086412 Ga0105245_100864122 334
75 3300025927 Ga0207687_10009255 Ga0207687_100092554 334
76 3300028786 Ga0307517_10005644 Ga0307517_1000564414 335
77 3300031616 Ga0307508_10222420 Ga0307508_102224201 335
78 3300031730 Ga0307516_10131845 Ga0307516_101318452 335
79 3300046459 Ga0495629_0134525 Ga0495629_0134525_552_1694 335
80 3300046522 Ga0495643_0003534 Ga0495643_0003534_6411_7553 335
81 3300046526 Ga0495666_0038989 Ga0495666_0038989_373_1530 335
82 3300046691 Ga0495670_0011680 Ga0495670_0011680_464_1606 335
83 3300046794 Ga0495589_0019825 Ga0495589_0019825_2014_3156 335
84 3300046810 Ga0495660_0029346 Ga0495660_0029346_886_2028 335
85 3300047470 Ga0495681_0000877 Ga0495681_0000877_3937_5079 335
86 3300047472 Ga0495686_0019676 Ga0495686_0019676_1103_2245 335
87 3300053109 Ga0500569_006987 Ga0500569_006987_320_1462 335
88 3300053131 Ga0500652_006328 Ga0500652_006328_1493_2635 335
89 3300053137 Ga0500561_0001803 Ga0500561_0001803_1044_2186 335
90 3300053149 Ga0500600_0006238 Ga0500600_0006238_5870_7012 335
91 3300053739 Ga0500587_001729 Ga0500587_001729_1826_2968 335
92 3300031616 Ga0307508_10007254 Ga0307508_100072544 336
93 3300031649 Ga0307514_10049163 Ga0307514_100491632 336
94 3300046453 Ga0495627_032673 Ga0495627_032673_475_1569 336
95 3300046615 Ga0495656_0057066 Ga0495656_0057066_430_1524 336
96 3300046691 Ga0495670_0016314 Ga0495670_0016314_1037_2131 336
97 3300046794 Ga0495589_0025044 Ga0495589_0025044_129_1223 336
98 3300047447 Ga0495685_000551 Ga0495685_000551_8504_9598 336
99 3300047470 Ga0495681_0000813 Ga0495681_0000813_17644_18738 336
100 3300047472 Ga0495686_0085604 Ga0495686_0085604_710_1804 336
101 3300053099 Ga0500654_015775 Ga0500654_015775_658_1752 336
102 3300053131 Ga0500652_001311 Ga0500652_001311_1340_2434 336
103 3300053134 Ga0500658_0006593 Ga0500658_0006593_21_1115 336
104 3300053137 Ga0500561_0000837 Ga0500561_0000837_3647_4741 336
105 3300053143 Ga0500579_028611 Ga0500579_028611_986_2080 336
106 3300053149 Ga0500600_0005069 Ga0500600_0005069_3647_4741 336
107 3300053153 Ga0500616_0034631 Ga0500616_0034631_20_1114 336
108 3300053161 Ga0500634_0105484 Ga0500634_0105484_44_1138 336
109 3300053739 Ga0500587_000141 Ga0500587_000141_3231_4325 336
110 3300003316 rootH1_10012411 rootH1_100124118 338
111 3300003320 rootH2_10027107 rootH2_100271072 338
112 3300046557 Ga0495622_0015045 Ga0495622_0015045_1065_2195 338
113 3300049573 Ga0501037_0030999 Ga0501037_0030999_610_1749 338
114 3300049578 Ga0501042_0038573 Ga0501042_0038573_1771_2910 338
115 3300049581 Ga0501047_0000064 Ga0501047_0000064_49844_50983 338
116 3300053107 Ga0500560_024114 Ga0500560_024114_17_1171 338
117 iso_pu_bacteria 2616644814 2616697081 338
118 iso_pu_bacteria 2784132148 2784590199 338
119 iso_pu_bacteria 2784746763 2785341419 338
120 iso_pu_bacteria 2808606448 2809233873 338
121 iso_pu_bacteria 2811994879 2812356226 338
122 iso_pu_bacteria 2852635781 2852642049 338
123 iso_pu_bacteria 2862382967 2862386074 338
124 iso_pu_bacteria 2862507626 2862513270 338
125 iso_pu_bacteria 2863404153 2863408388 338
126 iso_pu_bacteria 2912715099 2912717941 338
127 iso_pu_bacteria 2946064051 2946069630 338
128 iso_pu_bacteria 2947224130 2947227181 338
129 iso_pu_bacteria 2954002825 2954005231 338
130 iso_pu_bacteria 2990059506 2990065292 338
131 iso_pu_bacteria 3006493962 3006494810 338
132 iso_pu_bacteria 8008558824 8008562560 338
133 iso_pu_bacteria 8023623736 8023625074 338
134 iso_pu_bacteria 8048406513 8048406677 338
135 3300009011 Ga0105251_10004125 Ga0105251_100041259 339
136 3300025735 Ga0207713_1043084 Ga0207713_10430841 339
137 3300027312 Ga0209371_1019495 Ga0209371_10194952 339
138 3300028794 Ga0307515_10083839 Ga0307515_100838394 339
139 3300030500 Ga0268256_1022703 Ga0268256_10227032 339
140 3300030522 Ga0307512_10014179 Ga0307512_100141793 339
141 3300031456 Ga0307513_10003436 Ga0307513_1000343617 339
142 3300031456 Ga0307513_10182061 Ga0307513_101820612 339
143 3300041404 Ga0439436_0000265 Ga0439436_0000265_3731_4849 339
144 3300041406 Ga0439439_0005591 Ga0439439_0005591_1612_2724 339
145 3300041512 Ga0451853_0698293 Ga0451853_0698293_752_1876 339
146 3300041999 Ga0439433_0003616 Ga0439433_0003616_526_1644 339
147 3300041999 Ga0439433_0007902 Ga0439433_0007902_932_2056 339
148 3300042007 Ga0439449_0000119 Ga0439449_0000119_13824_14936 339
149 3300042007 Ga0439449_0004153 Ga0439449_0004153_1691_2803 339
150 3300042014 Ga0439457_000793 Ga0439457_000793_737_1861 339
151 3300042014 Ga0439457_003618 Ga0439457_003618_2147_3265 339
152 3300042015 Ga0439462_0000354 Ga0439462_0000354_914_2026 339
153 3300042131 Ga0450894_000406 Ga0450894_000406_2125_3249 339
154 3300042134 Ga0450898_000245 Ga0450898_000245_4514_5638 339
155 3300042145 Ga0450906_001989 Ga0450906_001989_2259_3383 339
156 3300044658 Ga0466972_0005954 Ga0466972_0005954_838_1953 339
157 3300044683 Ga0466965_0022601 Ga0466965_0022601_1507_2622 339
158 3300044684 Ga0466966_0006650 Ga0466966_0006650_6149_7264 339
159 3300044694 Ga0466963_0000757 Ga0466963_0000757_12076_13194 339
160 3300044694 Ga0466963_0001060 Ga0466963_0001060_11756_12871 339
161 3300044694 Ga0466963_0130412 Ga0466963_0130412_477_1592 339
162 3300044719 Ga0466971_0001164 Ga0466971_0001164_5878_6993 339
163 3300044765 Ga0466970_0007417 Ga0466970_0007417_523_1638 339
164 3300044842 Ga0466957_0000680 Ga0466957_0000680_8500_9615 339
165 3300045049 Ga0466959_0003366 Ga0466959_0003366_2668_3783 339
166 3300045836 Ga0466958_0000521 Ga0466958_0000521_7948_9063 339
167 3300045976 Ga0466967_0008154 Ga0466967_0008154_1501_2616 339
168 3300046452 Ga0495617_022745 Ga0495617_022745_79_1191 339
169 3300046453 Ga0495627_024508 Ga0495627_024508_284_1396 339
170 3300046454 Ga0495592_0010355 Ga0495592_0010355_167_1273 339
171 3300046455 Ga0495603_0008884 Ga0495603_0008884_1737_2849 339
172 3300046455 Ga0495603_0022423 Ga0495603_0022423_760_1866 339
173 3300046460 Ga0495638_0014454 Ga0495638_0014454_3114_4226 339
174 3300046462 Ga0495651_0066870 Ga0495651_0066870_1253_2365 339
175 3300046475 Ga0495639_0072453 Ga0495639_0072453_106_1218 339
176 3300046476 Ga0495662_0002634 Ga0495662_0002634_4896_6008 339
177 3300046476 Ga0495662_0025698 Ga0495662_0025698_370_1482 339
178 3300046477 Ga0495664_0021999 Ga0495664_0021999_2428_3534 339
179 3300046501 Ga0495607_0073418 Ga0495607_0073418_642_1754 339
180 3300046507 Ga0495606_0016647 Ga0495606_0016647_3883_4995 339
181 3300046511 Ga0495608_0059383 Ga0495608_0059383_484_1590 339
182 3300046513 Ga0495616_0004779 Ga0495616_0004779_3843_4955 339
183 3300046515 Ga0495620_0028129 Ga0495620_0028129_598_1710 339
184 3300046516 Ga0495628_0108167 Ga0495628_0108167_770_1876 339
185 3300046520 Ga0495637_0025007 Ga0495637_0025007_1443_2555 339
186 3300046526 Ga0495666_0078525 Ga0495666_0078525_331_1443 339
187 3300046529 Ga0495652_0159754 Ga0495652_0159754_524_1636 339
188 3300046530 Ga0495654_0004499 Ga0495654_0004499_3802_4914 339
189 3300046533 Ga0495640_0066475 Ga0495640_0066475_508_1620 339
190 3300046538 Ga0495609_0018136 Ga0495609_0018136_1016_2128 339
191 3300046542 Ga0495597_0047717 Ga0495597_0047717_224_1336 339
192 3300046543 Ga0495645_0021795 Ga0495645_0021795_1361_2473 339
193 3300046557 Ga0495622_0039809 Ga0495622_0039809_261_1373 339
194 3300046558 Ga0495633_0020015 Ga0495633_0020015_1932_3044 339
195 3300046559 Ga0495667_0070176 Ga0495667_0070176_10_1122 339
196 3300046642 Ga0495634_0032201 Ga0495634_0032201_1548_2660 339
197 3300046648 Ga0495611_0052938 Ga0495611_0052938_459_1571 339
198 3300046660 Ga0495625_0058642 Ga0495625_0058642_1604_2716 339
199 3300046663 Ga0495635_0043822 Ga0495635_0043822_816_1928 339
200 3300046665 Ga0495661_0091157 Ga0495661_0091157_338_1450 339
201 3300046674 Ga0495588_0028429 Ga0495588_0028429_107_1213 339
202 3300046675 Ga0495657_0048584 Ga0495657_0048584_823_1935 339
203 3300046689 Ga0495613_0021832 Ga0495613_0021832_2718_3824 339
204 3300046694 Ga0495649_0068862 Ga0495649_0068862_618_1730 339
205 3300046794 Ga0495589_0033458 Ga0495589_0033458_890_2002 339
206 3300046809 Ga0495600_0094940 Ga0495600_0094940_689_1801 339
207 3300047317 Ga0495604_0037006 Ga0495604_0037006_2210_3322 339
208 3300047321 Ga0495676_0033467 Ga0495676_0033467_2331_3443 339
209 3300047322 Ga0495680_0122059 Ga0495680_0122059_92_1204 339
210 3300047443 Ga0495687_001781 Ga0495687_001781_6509_7621 339
211 3300047443 Ga0495687_018912 Ga0495687_018912_1529_2641 339
212 3300047447 Ga0495685_002112 Ga0495685_002112_3424_4536 339
213 3300047447 Ga0495685_037747 Ga0495685_037747_158_1270 339
214 3300047472 Ga0495686_0009561 Ga0495686_0009561_1728_2840 339
215 3300047472 Ga0495686_0026465 Ga0495686_0026465_1580_2695 339
216 3300049568 Ga0501031_0019079 Ga0501031_0019079_707_1852 339
217 3300049569 Ga0501032_0003339 Ga0501032_0003339_5976_7091 339
218 3300049571 Ga0501034_0004359 Ga0501034_0004359_7984_9099 339
219 3300049571 Ga0501034_0193782 Ga0501034_0193782_576_1685 339
220 3300049572 Ga0501036_0007006 Ga0501036_0007006_1431_2546 339
221 3300049572 Ga0501036_0067018 Ga0501036_0067018_860_1975 339
222 3300049573 Ga0501037_0004467 Ga0501037_0004467_5026_6141 339
223 3300049573 Ga0501037_0017590 Ga0501037_0017590_3204_4319 339
224 3300049574 Ga0501038_0006625 Ga0501038_0006625_5250_6365 339
225 3300049574 Ga0501038_0092057 Ga0501038_0092057_1257_2366 339
226 3300049575 Ga0501039_0004452 Ga0501039_0004452_1458_2573 339
227 3300049579 Ga0501043_0004540 Ga0501043_0004540_7047_8162 339
228 3300049579 Ga0501043_0033211 Ga0501043_0033211_1632_2747 339
229 3300049579 Ga0501043_0239643 Ga0501043_0239643_12_1127 339
230 3300049580 Ga0501046_0023462 Ga0501046_0023462_2649_3764 339
231 3300049581 Ga0501047_0006747 Ga0501047_0006747_3660_4775 339
232 3300049582 Ga0501048_0005365 Ga0501048_0005365_4613_5728 339
233 3300049586 Ga0501070_0000534 Ga0501070_0000534_25731_26846 339
234 3300049590 Ga0501074_0000721 Ga0501074_0000721_16176_17291 339
235 3300049822 Ga0501035_0002605 Ga0501035_0002605_7066_8181 339
236 3300061719 Ga0466962_0000989 Ga0466962_0000989_8022_9137 339
237 iso_pu_bacteria 2582581313 2585307025 339
238 iso_pu_bacteria 2582581314 2585320544 339
239 iso_pu_bacteria 2643221587 2643941547 339
240 iso_pu_bacteria 2643221647 2644263692 339
241 iso_pu_bacteria 2643221670 2644386683 339
242 iso_pu_bacteria 2643221677 2644428631 339
243 iso_pu_bacteria 2784746768 2785371256 339
244 iso_pu_bacteria 2786546132 2786672443 339
245 iso_pu_bacteria 2808606982 2811844665 339
246 iso_pu_bacteria 2811994917 2812478974 339
247 iso_pu_bacteria 2862281513 2862284987 339
248 iso_pu_bacteria 2862574272 2862577745 339
249 iso_pu_bacteria 2867428634 2867431651 339
250 iso_pu_bacteria 2877676314 2877679346 339
251 iso_pu_bacteria 2918501144 2918506264 339
252 iso_pu_bacteria 2935390628 2935394454 339
253 iso_pu_bacteria 2954380949 2954384234 339
254 iso_pu_bacteria 2954673503 2954678715 339
255 iso_pu_bacteria 2954682443 2954685441 339
256 iso_pu_bacteria 2954691527 2954695056 339
257 iso_pu_bacteria 2954701450 2954710230 339
258 iso_pu_bacteria 2954711539 2954714547 339
259 iso_pu_bacteria 2954721474 2954724492 339
260 iso_pu_bacteria 2954731030 2954737327 339
261 iso_pu_bacteria 2954740390 2954743414 339
262 iso_pu_bacteria 2954749733 2954756177 339
263 iso_pu_bacteria 2954759201 2954762371 339
264 iso_pu_bacteria 3006486233 3006493885 339
265 iso_pu_bacteria 8025530807 8025537491 339
266 iso_pu_bacteria 8033684223 8033684420 339
267 3300002075 JGI24738J21930_10008966 JGI24738J21930_100089663 340
268 3300003320 rootH2_10018520 rootH2_100185201 340
269 3300003578 Ga0006562J51391_1115073 Ga0006562J51391_11150731 340
270 3300005539 Ga0068853_100132122 Ga0068853_1001321221 340
271 3300005937 Ga0081455_10052380 Ga0081455_100523803 340
272 3300006038 Ga0075365_10023792 Ga0075365_100237921 340
273 3300006042 Ga0075368_10034777 Ga0075368_100347772 340
274 3300006948 Ga0099826_10031880 Ga0099826_100318802 340
275 3300011119 Ga0105246_10004222 Ga0105246_100042225 340
276 3300013307 Ga0157372_10222676 Ga0157372_102226762 340
277 3300014497 Ga0182008_10002326 Ga0182008_100023268 340
278 3300015261 Ga0182006_1047482 Ga0182006_10474822 340
279 3300015262 Ga0182007_10000334 Ga0182007_1000033430 340
280 3300015688 Ga0183367_1002 Ga0183367_1002271 340
281 3300025302 Ga0207426_1024842 Ga0207426_10248422 340
282 3300025904 Ga0207647_10005427 Ga0207647_100054274 340
283 3300026078 Ga0207702_10107805 Ga0207702_101078052 340
284 3300027312 Ga0209371_1004056 Ga0209371_10040564 340
285 3300027866 Ga0209813_10018215 Ga0209813_100182151 340
286 3300028379 Ga0268266_10220415 Ga0268266_102204152 340
287 3300028786 Ga0307517_10023238 Ga0307517_100232384 340
288 3300028794 Ga0307515_10000730 Ga0307515_100007309 340
289 3300028794 Ga0307515_10217403 Ga0307515_102174032 340
290 3300030500 Ga0268256_1003670 Ga0268256_10036706 340
291 3300030521 Ga0307511_10001322 Ga0307511_1000132216 340
292 3300030521 Ga0307511_10036481 Ga0307511_100364813 340
293 3300031507 Ga0307509_10016379 Ga0307509_100163794 340
294 3300031507 Ga0307509_10054693 Ga0307509_100546934 340
295 3300031649 Ga0307514_10005453 Ga0307514_1000545310 340
296 3300031649 Ga0307514_10040366 Ga0307514_100403662 340
297 3300031730 Ga0307516_10044045 Ga0307516_100440454 340
298 3300031838 Ga0307518_10093986 Ga0307518_100939862 340
299 3300033180 Ga0307510_10015532 Ga0307510_100155329 340
300 3300033180 Ga0307510_10019791 Ga0307510_100197917 340
301 3300033180 Ga0307510_10057601 Ga0307510_100576013 340
302 3300037466 Ga0395898_0007476 Ga0395898_0007476_5813_6931 340
303 3300042012 Ga0439455_0003950 Ga0439455_0003950_1718_2836 340
304 3300042138 Ga0450903_000330 Ga0450903_000330_1930_3048 340
305 3300042157 Ga0439458_0004298 Ga0439458_0004298_885_1997 340
306 3300042533 Ga0450901_000975 Ga0450901_000975_440_1558 340
307 3300044656 Ga0466969_0019899 Ga0466969_0019899_2230_3345 340
308 3300044684 Ga0466966_0003730 Ga0466966_0003730_1146_2261 340
309 3300044693 Ga0466961_0007021 Ga0466961_0007021_4996_6111 340
310 3300044719 Ga0466971_0016733 Ga0466971_0016733_1117_2232 340
311 3300046454 Ga0495592_0005464 Ga0495592_0005464_2100_3314 340
312 3300046455 Ga0495603_0019886 Ga0495603_0019886_2515_3630 340
313 3300046460 Ga0495638_0018513 Ga0495638_0018513_1093_2235 340
314 3300046460 Ga0495638_0145452 Ga0495638_0145452_227_1342 340
315 3300046462 Ga0495651_0001482 Ga0495651_0001482_15643_16857 340
316 3300046473 Ga0495582_0006539 Ga0495582_0006539_4428_5642 340
317 3300046476 Ga0495662_0086629 Ga0495662_0086629_338_1480 340
318 3300046477 Ga0495664_0002684 Ga0495664_0002684_2897_4111 340
319 3300046499 Ga0495594_0015260 Ga0495594_0015260_222_1337 340
320 3300046499 Ga0495594_0031174 Ga0495594_0031174_1488_2597 340
321 3300046517 Ga0495630_0032322 Ga0495630_0032322_1804_3018 340
322 3300046543 Ga0495645_0004412 Ga0495645_0004412_1219_2433 340
323 3300046557 Ga0495622_0013017 Ga0495622_0013017_2446_3660 340
324 3300046615 Ga0495656_0042104 Ga0495656_0042104_344_1459 340
325 3300046642 Ga0495634_0005830 Ga0495634_0005830_1410_2624 340
326 3300046660 Ga0495625_0046065 Ga0495625_0046065_678_1820 340
327 3300046660 Ga0495625_0143401 Ga0495625_0143401_357_1466 340
328 3300046663 Ga0495635_0001059 Ga0495635_0001059_2920_4134 340
329 3300046665 Ga0495661_0035753 Ga0495661_0035753_1675_2829 340
330 3300046674 Ga0495588_0008445 Ga0495588_0008445_1885_3000 340
331 3300046675 Ga0495657_0019276 Ga0495657_0019276_869_2083 340
332 3300046691 Ga0495670_0016687 Ga0495670_0016687_2304_3458 340
333 3300047315 Ga0495581_0032516 Ga0495581_0032516_1265_2479 340
334 3300047318 Ga0495636_0002641 Ga0495636_0002641_56_1165 340
335 3300047321 Ga0495676_0003037 Ga0495676_0003037_8996_10210 340
336 3300047323 Ga0495683_0054570 Ga0495683_0054570_423_1532 340
337 3300047443 Ga0495687_000878 Ga0495687_000878_27344_28558 340
338 3300047447 Ga0495685_001287 Ga0495685_001287_4376_5494 340
339 3300047470 Ga0495681_0000904 Ga0495681_0000904_14248_15462 340
340 3300047673 Ga0495593_0000891 Ga0495593_0000891_13063_14277 340
341 3300048088 Ga0495602_0012356 Ga0495602_0012356_2670_3884 340
342 3300048089 Ga0495614_0075713 Ga0495614_0075713_136_1251 340
343 3300048089 Ga0495614_0079172 Ga0495614_0079172_57_1271 340
344 3300049570 Ga0501033_0002346 Ga0501033_0002346_7573_8697 340
345 3300049571 Ga0501034_0030121 Ga0501034_0030121_240_1358 340
346 3300049574 Ga0501038_0002584 Ga0501038_0002584_14308_15426 340
347 3300049579 Ga0501043_0076751 Ga0501043_0076751_369_1487 340
348 3300049581 Ga0501047_0091287 Ga0501047_0091287_35_1147 340
349 3300049822 Ga0501035_0142230 Ga0501035_0142230_939_2057 340
350 3300049823 Ga0501044_0080261 Ga0501044_0080261_1802_2920 340
351 3300049823 Ga0501044_0094916 Ga0501044_0094916_69_1187 340
352 3300050494 nmdc:mga06z11_3856_c1 nmdc:mga06z11_3856_c1_2309_3436 340
353 3300050495 nmdc:mga04h51_4305_c1 nmdc:mga04h51_4305_c1_892_2019 340
354 3300053095 Ga0500640_007360 Ga0500640_007360_669_1883 340
355 3300053101 Ga0500553_062819 Ga0500553_062819_292_1506 340
356 3300053157 Ga0500624_001891 Ga0500624_001891_566_1780 340
357 3300053177 Ga0500636_0066723 Ga0500636_0066723_734_1876 340
358 iso_pu_bacteria 2554235005 2554256425 340
359 iso_pu_bacteria 2582581312 2585296378 340
360 iso_pu_bacteria 2616644941 2616900132 340
361 iso_pu_bacteria 2643221548 2643763795 340
362 iso_pu_bacteria 2643221578 2643902487 340
363 iso_pu_bacteria 2643221673 2644404058 340
364 iso_pu_bacteria 2643221678 2644439810 340
365 iso_pu_bacteria 2643221682 2644461769 340
366 iso_pu_bacteria 2643221714 2644632863 340
367 iso_pu_bacteria 2675902999 2676203473 340
368 iso_pu_bacteria 2687453737 2689956178 340
369 iso_pu_bacteria 2773857921 2774848049 340
370 iso_pu_bacteria 2802429296 2804847699 340
371 iso_pu_bacteria 2808606359 2808843818 340
372 iso_pu_bacteria 2808606375 2808913360 340
373 iso_pu_bacteria 2818991463 2819694832 340
374 iso_pu_bacteria 2862178590 2862179195 340
375 iso_pu_bacteria 2862290372 2862293916 340
376 iso_pu_bacteria 2875391855 2875396468 340
377 iso_pu_bacteria 2912723979 2912730368 340
378 iso_pu_bacteria 2912757875 2912762538 340
379 iso_pu_bacteria 2919468124 2919474323 340
380 iso_pu_bacteria 2946045630 2946048089 340
381 iso_pu_bacteria 2946072368 2946077529 340
382 iso_pu_bacteria 2966598605 2966601068 340
383 iso_pu_bacteria 3006321560 3006323874 340
384 iso_pu_bacteria 3006393351 3006395765 340
385 iso_pu_bacteria 8008574985 8008577381 340
386 iso_pu_bacteria 8025413630 8025416505 340
387 3300005617 Ga0068859_100000369 Ga0068859_10000036938 341
388 3300005617 Ga0068859_100006167 Ga0068859_10000616717 341
389 3300005841 Ga0068863_100002187 Ga0068863_1000021874 341
390 3300005842 Ga0068858_100015646 Ga0068858_1000156465 341
391 3300005844 Ga0068862_100000004 Ga0068862_100000004194 341
392 3300006931 Ga0097620_100000369 Ga0097620_10000036938 341
393 3300006931 Ga0097620_100006167 Ga0097620_10000616717 341
394 3300009101 Ga0105247_10001103 Ga0105247_1000110310 341
395 3300009101 Ga0105247_10051760 Ga0105247_100517601 341
396 3300009553 Ga0105249_10001546 Ga0105249_100015462 341
397 3300025941 Ga0207711_10000110 Ga0207711_1000011068 341
398 3300026035 Ga0207703_10015151 Ga0207703_100151515 341
399 3300026088 Ga0207641_10003349 Ga0207641_100033493 341
400 3300028380 Ga0268265_10000009 Ga0268265_10000009156 341
401 3300037466 Ga0395898_0054372 Ga0395898_0054372_1436_2560 341
402 3300044765 Ga0466970_0017354 Ga0466970_0017354_1315_2445 341
403 3300046454 Ga0495592_0017855 Ga0495592_0017855_2244_3509 341
404 3300046455 Ga0495603_0000105 Ga0495603_0000105_21805_22920 341
405 3300046455 Ga0495603_0001024 Ga0495603_0001024_10478_11593 341
406 3300046455 Ga0495603_0111062 Ga0495603_0111062_53_1318 341
407 3300046459 Ga0495629_0001788 Ga0495629_0001788_4824_5939 341
408 3300046459 Ga0495629_0002406 Ga0495629_0002406_7887_9152 341
409 3300046459 Ga0495629_0002439 Ga0495629_0002439_2376_3491 341
410 3300046459 Ga0495629_0068138 Ga0495629_0068138_223_1398 341
411 3300046462 Ga0495651_0034026 Ga0495651_0034026_2260_3525 341
412 3300046477 Ga0495664_0007453 Ga0495664_0007453_4214_5479 341
413 3300046492 Ga0495585_0032000 Ga0495585_0032000_137_1252 341
414 3300046499 Ga0495594_0000767 Ga0495594_0000767_10808_11923 341
415 3300046499 Ga0495594_0065667 Ga0495594_0065667_311_1576 341
416 3300046516 Ga0495628_0020604 Ga0495628_0020604_3473_4738 341
417 3300046529 Ga0495652_0071286 Ga0495652_0071286_1406_2671 341
418 3300046533 Ga0495640_0006165 Ga0495640_0006165_6721_7986 341
419 3300046557 Ga0495622_0005213 Ga0495622_0005213_1831_2946 341
420 3300046559 Ga0495667_0036534 Ga0495667_0036534_1476_2741 341
421 3300046642 Ga0495634_0056583 Ga0495634_0056583_319_1584 341
422 3300046648 Ga0495611_0006196 Ga0495611_0006196_2941_4056 341
423 3300046675 Ga0495657_0002555 Ga0495657_0002555_11563_12828 341
424 3300046689 Ga0495613_0000527 Ga0495613_0000527_3033_4148 341
425 3300046689 Ga0495613_0021363 Ga0495613_0021363_232_1497 341
426 3300046690 Ga0495624_0019007 Ga0495624_0019007_2612_3877 341
427 3300046809 Ga0495600_0076102 Ga0495600_0076102_169_1434 341
428 3300047317 Ga0495604_0041679 Ga0495604_0041679_653_1831 341
429 3300047321 Ga0495676_0001537 Ga0495676_0001537_9190_10305 341
430 3300047321 Ga0495676_0005482 Ga0495676_0005482_4302_5417 341
431 3300047321 Ga0495676_0006123 Ga0495676_0006123_6385_7650 341
432 3300047444 Ga0495675_0059963 Ga0495675_0059963_546_1811 341
433 3300047447 Ga0495685_014846 Ga0495685_014846_792_1922 341
434 3300048089 Ga0495614_0000088 Ga0495614_0000088_17988_19103 341
435 3300049568 Ga0501031_0018462 Ga0501031_0018462_1122_2300 341
436 3300049568 Ga0501031_0031782 Ga0501031_0031782_500_1660 341
437 3300049569 Ga0501032_0013740 Ga0501032_0013740_1657_2817 341
438 3300049569 Ga0501032_0031390 Ga0501032_0031390_1343_2521 341
439 3300049570 Ga0501033_0036736 Ga0501033_0036736_1570_2730 341
440 3300049570 Ga0501033_0050027 Ga0501033_0050027_1578_2756 341
441 3300049571 Ga0501034_0073429 Ga0501034_0073429_1084_2262 341
442 3300049572 Ga0501036_0032785 Ga0501036_0032785_2130_3308 341
443 3300049572 Ga0501036_0119231 Ga0501036_0119231_977_2137 341
444 3300049573 Ga0501037_0007823 Ga0501037_0007823_4476_5654 341
445 3300049574 Ga0501038_0028091 Ga0501038_0028091_2571_3749 341
446 3300049574 Ga0501038_0046992 Ga0501038_0046992_1681_2841 341
447 3300049575 Ga0501039_0024332 Ga0501039_0024332_2130_3308 341
448 3300049575 Ga0501039_0058002 Ga0501039_0058002_539_1699 341
449 3300049577 Ga0501041_0002172 Ga0501041_0002172_1166_2344 341
450 3300049578 Ga0501042_0029437 Ga0501042_0029437_1587_2765 341
451 3300049579 Ga0501043_0005172 Ga0501043_0005172_9234_10412 341
452 3300049579 Ga0501043_0099216 Ga0501043_0099216_940_2100 341
453 3300049580 Ga0501046_0007048 Ga0501046_0007048_7640_8818 341
454 3300049580 Ga0501046_0110473 Ga0501046_0110473_942_2087 341
455 3300049581 Ga0501047_0008036 Ga0501047_0008036_7383_8561 341
456 3300049581 Ga0501047_0259128 Ga0501047_0259128_146_1324 341
457 3300049582 Ga0501048_0035993 Ga0501048_0035993_1090_2268 341
458 3300049583 Ga0501067_0009327 Ga0501067_0009327_1881_3059 341
459 3300049584 Ga0501068_0005748 Ga0501068_0005748_799_1977 341
460 3300049585 Ga0501069_0032258 Ga0501069_0032258_354_1532 341
461 3300049586 Ga0501070_0023561 Ga0501070_0023561_2185_3363 341
462 3300049587 Ga0501071_0003685 Ga0501071_0003685_1632_2810 341
463 3300049588 Ga0501072_0009784 Ga0501072_0009784_4944_6122 341
464 3300049589 Ga0501073_0033117 Ga0501073_0033117_939_2117 341
465 3300049592 Ga0501076_0047011 Ga0501076_0047011_796_1974 341
466 3300049593 Ga0501077_0023223 Ga0501077_0023223_143_1321 341
467 3300049741 Ga0501079_0009315 Ga0501079_0009315_474_1652 341
468 3300049742 Ga0501080_0022361 Ga0501080_0022361_1484_2662 341
469 3300049744 Ga0501083_0001156 Ga0501083_0001156_473_1651 341
470 3300049823 Ga0501044_0016144 Ga0501044_0016144_5765_6943 341
471 3300049823 Ga0501044_0046434 Ga0501044_0046434_2784_3959 341
472 3300049824 Ga0501045_0158447 Ga0501045_0158447_346_1524 341
473 3300053140 Ga0500573_0005625 Ga0500573_0005625_4409_5512 341
474 3300054114 Ga0501084_0001950 Ga0501084_0001950_1484_2662 341
475 3300060353 Ga0501082_0006599 Ga0501082_0006599_7696_8874 341
476 3300061734 Ga0530510_0195871 Ga0530510_0195871_274_1452 341
477 iso_pu_bacteria 2508501039 2508677946 341
478 iso_pu_bacteria 2687453737 2689958912 341
479 iso_pu_bacteria 2867369537 2867373655 341
480 iso_pu_bacteria 2873151551 2873154268 341
481 iso_pu_bacteria 2935390628 2935393035 341
482 iso_pu_bacteria 3006486233 3006492409 341
483 iso_pu_bacteria 8002775197 8002779426 341
484 iso_pu_bacteria 8056829672 8056831926 341
485 3300032005 Ga0307411_10105931 Ga0307411_101059312 342
486 3300037312 Ga0395899_0097383 Ga0395899_0097383_777_1907 342
487 3300037466 Ga0395898_0001672 Ga0395898_0001672_8141_9271 342
488 3300038443 Ga0395901_0016220 Ga0395901_0016220_5844_6974 342
489 3300044658 Ga0466972_0002489 Ga0466972_0002489_576_1700 342
490 3300045976 Ga0466967_0013001 Ga0466967_0013001_105_1235 342
491 3300049569 Ga0501032_0036871 Ga0501032_0036871_2121_3305 342
492 3300049571 Ga0501034_0018217 Ga0501034_0018217_945_2129 342
493 3300049572 Ga0501036_0173628 Ga0501036_0173628_613_1797 342
494 3300049574 Ga0501038_0072970 Ga0501038_0072970_734_1870 342
495 3300049575 Ga0501039_0032929 Ga0501039_0032929_1808_2992 342
496 3300049579 Ga0501043_0061426 Ga0501043_0061426_1089_2273 342
497 3300049581 Ga0501047_0013511 Ga0501047_0013511_768_1952 342
498 3300049822 Ga0501035_0044294 Ga0501035_0044294_1103_2239 342
499 3300049823 Ga0501044_0012617 Ga0501044_0012617_7653_8783 342
500 3300049823 Ga0501044_0078369 Ga0501044_0078369_1524_2708 342
501 iso_pu_bacteria 2767802112 2768644166 342
502 iso_pu_bacteria 2791355406 2793980852 342
503 iso_pu_bacteria 2808606982 2811845598 342
504 iso_pu_bacteria 2990044586 2990047451 342
505 iso_pu_bacteria 2990088156 2990089396 342
506 iso_pu_bacteria 2997600082 2997603088 342
507 iso_pu_bacteria 3006425503 3006430089 342
508 iso_pu_bacteria 8008485437 8008490435 342
509 iso_pu_bacteria 8025478263 8025481614 342
510 iso_pu_bacteria 8025524527 8025529737 342
511 iso_pu_bacteria 8033684223 8033688603 342
512 iso_pu_bacteria 8047893842 8047896357 342
513 iso_pu_bacteria 8048127548 8048133767 342
514 iso_pu_bacteria 8048356638 8048362579 342
515 iso_pu_bacteria 8048369669 8048373366 342
516 iso_pu_bacteria 8048379754 8048384876 342
517 iso_pu_bacteria 8056447290 8056450278 342
518 iso_pu_bacteria 8056667051 8056669036 342
519 3300025302 Ga0207426_1000547 Ga0207426_100054732 343
520 3300031616 Ga0307508_10179476 Ga0307508_101794762 343
521 3300031649 Ga0307514_10012642 Ga0307514_100126425 343
522 3300049572 Ga0501036_0020832 Ga0501036_0020832_576_1733 343
523 3300049573 Ga0501037_0064808 Ga0501037_0064808_180_1337 343
524 3300049574 Ga0501038_0043335 Ga0501038_0043335_1385_2542 343
525 3300049575 Ga0501039_0010236 Ga0501039_0010236_4548_5705 343
526 3300049581 Ga0501047_0011894 Ga0501047_0011894_6977_8134 343
527 3300049586 Ga0501070_0126976 Ga0501070_0126976_152_1309 343
528 3300049823 Ga0501044_0016446 Ga0501044_0016446_5174_6331 343
529 3300049824 Ga0501045_0068664 Ga0501045_0068664_387_1544 343
530 iso_pu_bacteria 2867346516 2867351601 343
531 iso_pu_bacteria 2990088156 2990091226 343
532 iso_pu_bacteria 8054160619 8054161218 343
533 3300046455 Ga0495603_0086323 Ga0495603_0086323_159_1253 344
534 3300046457 Ga0495590_0026622 Ga0495590_0026622_648_1745 344
535 3300046462 Ga0495651_0009326 Ga0495651_0009326_432_1529 344
536 3300046680 Ga0495646_0072259 Ga0495646_0072259_570_1667 344
537 3300047469 Ga0495673_0048726 Ga0495673_0048726_324_1418 344
538 3300047673 Ga0495593_0013261 Ga0495593_0013261_3239_4336 344
539 3300003354 JGI25160J50197_1014249 JGI25160J50197_10142491 345
540 iso_pu_bacteria 2867475112 2867478369 345
541 iso_pu_bacteria 2997451912 2997453282 345
542 3300025302 Ga0207426_1004337 Ga0207426_10043377 346
543 3300005617 Ga0068859_100006354 Ga0068859_10000635413 351
544 3300006931 Ga0097620_100006354 Ga0097620_1000063542 351
545 3300025900 Ga0207710_10003049 Ga0207710_100030495 351
546 3300048904 Ga0496101_0031692 Ga0496101_0031692_1331_2428 351
547 3300048905 Ga0496102_0000059 Ga0496102_0000059_155887_156984 351
548 3300048906 Ga0496103_0000063 Ga0496103_0000063_70991_72088 351
549 3300048921 Ga0496118_0035631 Ga0496118_0035631_827_1924 351
550 3300048922 Ga0496119_0036267 Ga0496119_0036267_300_1397 351
551 3300049569 Ga0501032_0005708 Ga0501032_0005708_2258_3364 353
552 3300049570 Ga0501033_0115523 Ga0501033_0115523_243_1349 353
553 3300049573 Ga0501037_0011562 Ga0501037_0011562_3680_4786 353
554 3300049574 Ga0501038_0002533 Ga0501038_0002533_14358_15464 353
555 3300049579 Ga0501043_0019120 Ga0501043_0019120_320_1426 353
556 3300049581 Ga0501047_0081399 Ga0501047_0081399_1986_3092 353
557 3300049582 Ga0501048_0012241 Ga0501048_0012241_1817_2923 353
558 3300049586 Ga0501070_0015355 Ga0501070_0015355_5149_6255 353
559 3300049822 Ga0501035_0081641 Ga0501035_0081641_1308_2414 353
560 3300049823 Ga0501044_0117519 Ga0501044_0117519_261_1367 353
561 3300001990 JGI24737J22298_10022234 JGI24737J22298_100222343 354
562 3300013105 Ga0157369_10023576 Ga0157369_100235764 354
563 3300020082 Ga0206353_11392024 Ga0206353_113920244 354
564 3300025904 Ga0207647_10133166 Ga0207647_101331662 354
565 3300049574 Ga0501038_0142703 Ga0501038_0142703_10_1116 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

117

417

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yny-assembly1.cif.gz_A structure of house dust mite allergen der f 21 in peg2kmme 0.8348 169 278
3nvo-assembly1.cif.gz_A the soluble domain structure of the zntb zn2+ efflux system 0.8298 26 291
8slb-assembly1.cif.gz_A x-ray structure of cora n-terminal domain in complex with conformation-specific synthetic antibody c12 0.8181 29 261
3nvo-assembly2.cif.gz_B-2 the soluble domain structure of the zntb zn2+ efflux system 0.8137 26 285
5n9y-assembly1.cif.gz_E the full-length structure of zntb 0.8017 25 354
ID Description Score Start End Superfamily
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9524 167 280 1.20.58.340
af_O50455_180_293_1.20.58.340 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9362 167 280 1.20.58.340
5jtgA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9065 169 275 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.904 169 275 1.20.58.340
4i0uE02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9009 171 275 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A850D7Y4-F1-model_v4 deleted 0.9453 26 299
AF-A0A529L5Y1-F1-model_v4 Magnesium transporter 0.9444 58 275 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A850D7Y4-F1-model_v4 deleted 0.9316 26 299
AF-A0A7Y3G1W9-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9291 26 322 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-A0A346Y4V1-F1-model_v4 Magnesium and cobalt transport protein CorA 0.929 26 354 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Feature Viewer

pLDDT pTM Quality
81.5 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map