F464291
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 373 | 490 | 400 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0000574|Ga0395901_0000574_35788_37212 |
| Length | 474 |
| Sequence | LAGRLFGDFFGCRNLVYFGLEIAASKLCNYYVATKKGLACSPKSVPKQLNRQERNKSMDQPQQTELNQGIKPRSPEAHVTVPHGSAGEVFFAFLKLGVTSFGGPIAHLAYFRTEFVERRRWLDDKSFSDLVALCQFLPGPASSQVGMALGLGRAGWLGALAAWLAFTLPSAIVLILFAFGVAHWAALSQSGAVHGLKVVAVAVVAQAVWGMAKSLCPDRPRAGIAIGAALLVLALPSAAGQILAIAAGGVIGRWGLELKHLPAARHRDYGISKTTGAIALLLFVALLGALPAIAAASHSTWLSAIAVFYKAGALVFGGGHVVLPLLQSGVVPNGWVGNDAFLAGYGAAQAVPGPLFTFAAYLGAVMPSPLGGWTGGLALLVAIFAPAFLLVAGALPFWESLRQRDSVQRAMAGINAAVVGVLAAALYDPVWTSAIHSRADFGLALAAFGLLVHGRLSPFIVVVLAALAGWAMAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 6 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 7 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 8 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 9 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 10 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 11 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 12 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 13 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 14 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 15 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 16 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 17 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 18 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 19 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 20 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 21 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 22 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 23 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 24 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 25 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 26 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 27 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 28 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 29 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 30 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 31 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 32 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 33 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 34 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 35 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 36 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 37 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 38 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 39 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 40 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 41 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 42 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 43 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 44 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 45 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 46 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 47 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 48 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 49 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 50 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 51 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 52 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 53 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 54 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 55 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 56 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 57 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 58 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 59 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 60 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 61 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 62 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 63 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 64 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 65 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 66 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 67 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 68 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 69 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 75 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 84 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 107 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 111 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 113 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 118 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 119 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 120 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 121 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 122 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 125 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 132 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 135 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 159 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 162 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 169 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 235 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 237 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 241 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 242 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 243 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 250 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 251 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 252 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 296 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 299 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 300 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 303 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 304 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 305 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 354 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 355 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 363 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 364 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 365 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 366 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 367 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 368 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 369 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 370 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 371 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 372 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 373 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.73 |
| Metatranscriptomes | 0 |
| Isolates | 13.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 10.27 |
| Nodule | 2.48 |
| Rhizoplane | 3.72 |
| Rhizosphere | 70.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2162838 | 2162886007 | Bacteria | 2840 |
| 2 | SwRhRL2b_contig_2682132 | 2162886007 | Bacteria | 1432 |
| 3 | JGI25151J46595_10000131 | 3300003187 | Bacteria | 100435 |
| 4 | JGI25151J46595_10002410 | 3300003187 | Bacteria | 11285 |
| 5 | JGI25151J46595_10040096 | 3300003187 | Bacteria | 1720 |
| 6 | JGI25165J46597_1000025 | 3300003214 | Bacteria | 333075 |
| 7 | rootL2_10162752 | 3300003322 | Bacteria | 1620 |
| 8 | Ga0055538_1000013 | 3300003751 | Bacteria | 348596 |
| 9 | Ga0055539_1000018 | 3300003752 | Bacteria | 348596 |
| 10 | Ga0055533_1000022 | 3300003756 | Bacteria | 348596 |
| 11 | Ga0055525_1000024 | 3300003759 | Bacteria | 348596 |
| 12 | Ga0055526_1001612 | 3300003771 | Bacteria | 15841 |
| 13 | Ga0055526_1004498 | 3300003771 | Bacteria | 8351 |
| 14 | Ga0055537_1001551 | 3300003773 | Bacteria | 8774 |
| 15 | Ga0055524_1005163 | 3300003775 | Bacteria | 5888 |
| 16 | Ga0055536_1000090 | 3300003781 | Bacteria | 77889 |
| 17 | Ga0055534_1000757 | 3300003784 | Bacteria | 15353 |
| 18 | Ga0055534_1002351 | 3300003784 | Bacteria | 6602 |
| 19 | Ga0055541_1000013 | 3300003841 | Bacteria | 348596 |
| 20 | Ga0065165_1000001 | 3300005262 | Bacteria | 494087 |
| 21 | Ga0065704_10079600 | 3300005289 | Bacteria | 4117 |
| 22 | Ga0065704_10087137 | 3300005289 | Bacteria | 3052 |
| 23 | Ga0070658_10015681 | 3300005327 | Bacteria | 6060 |
| 24 | Ga0070658_10062054 | 3300005327 | Bacteria | 3046 |
| 25 | Ga0070683_100045202 | 3300005329 | Bacteria | 4064 |
| 26 | Ga0068869_100005371 | 3300005334 | Bacteria | 8052 |
| 27 | Ga0068869_100025276 | 3300005334 | Bacteria | 4122 |
| 28 | Ga0070666_10003380 | 3300005335 | Bacteria | 9673 |
| 29 | Ga0068868_100010295 | 3300005338 | Bacteria | 6764 |
| 30 | Ga0070660_100000815 | 3300005339 | Bacteria | 20688 |
| 31 | Ga0070660_100023074 | 3300005339 | Bacteria | 4607 |
| 32 | Ga0070660_100037868 | 3300005339 | Bacteria | 3657 |
| 33 | Ga0070660_100055494 | 3300005339 | Bacteria | 3061 |
| 34 | Ga0070660_100086070 | 3300005339 | Bacteria | 2472 |
| 35 | Ga0070689_100174084 | 3300005340 | Bacteria | 1745 |
| 36 | Ga0070661_100055803 | 3300005344 | Bacteria | 2892 |
| 37 | Ga0070669_100015207 | 3300005353 | Bacteria | 5481 |
| 38 | Ga0070675_100015653 | 3300005354 | Bacteria | 6002 |
| 39 | Ga0070671_100237620 | 3300005355 | Bacteria | 1547 |
| 40 | Ga0070659_100000637 | 3300005366 | Bacteria | 25696 |
| 41 | Ga0070659_100057220 | 3300005366 | Bacteria | 3074 |
| 42 | Ga0070667_100097347 | 3300005367 | Bacteria | 2538 |
| 43 | Ga0070701_10008112 | 3300005438 | Bacteria | 4523 |
| 44 | Ga0070708_100014220 | 3300005445 | Bacteria | 6540 |
| 45 | Ga0070708_100093067 | 3300005445 | Bacteria | 2747 |
| 46 | Ga0070663_100000495 | 3300005455 | Bacteria | 20806 |
| 47 | Ga0070663_100030473 | 3300005455 | Bacteria | 3697 |
| 48 | Ga0070662_100000752 | 3300005457 | Bacteria | 19873 |
| 49 | Ga0070681_10178706 | 3300005458 | Bacteria | 2044 |
| 50 | Ga0070681_10230619 | 3300005458 | Bacteria | 1766 |
| 51 | Ga0070706_100000388 | 3300005467 | Bacteria | 52771 |
| 52 | Ga0070706_100019315 | 3300005467 | Bacteria | 6285 |
| 53 | Ga0070707_100041939 | 3300005468 | Bacteria | 4381 |
| 54 | Ga0070698_100105052 | 3300005471 | Bacteria | 2794 |
| 55 | Ga0070698_100187403 | 3300005471 | Bacteria | 2007 |
| 56 | Ga0070699_100009784 | 3300005518 | Bacteria | 8294 |
| 57 | Ga0070699_100073777 | 3300005518 | Bacteria | 2969 |
| 58 | Ga0070679_100175752 | 3300005530 | Bacteria | 2114 |
| 59 | Ga0070684_100041117 | 3300005535 | Bacteria | 3984 |
| 60 | Ga0070697_100019344 | 3300005536 | Bacteria | 5378 |
| 61 | Ga0070697_100196088 | 3300005536 | Bacteria | 1715 |
| 62 | Ga0068853_100003918 | 3300005539 | Bacteria | 11422 |
| 63 | Ga0068853_100028407 | 3300005539 | Bacteria | 4704 |
| 64 | Ga0070696_100058155 | 3300005546 | Bacteria | 2700 |
| 65 | Ga0070696_100159510 | 3300005546 | Bacteria | 1661 |
| 66 | Ga0070693_100052321 | 3300005547 | Bacteria | 2341 |
| 67 | Ga0070704_100028751 | 3300005549 | Bacteria | 3702 |
| 68 | Ga0068855_100025742 | 3300005563 | Bacteria | 7035 |
| 69 | Ga0068855_100110310 | 3300005563 | Bacteria | 3159 |
| 70 | Ga0068855_100171029 | 3300005563 | Bacteria | 2461 |
| 71 | Ga0070664_100010718 | 3300005564 | Bacteria | 7433 |
| 72 | Ga0068857_100007527 | 3300005577 | Bacteria | 9369 |
| 73 | Ga0068857_100010070 | 3300005577 | Bacteria | 8214 |
| 74 | Ga0068854_100030944 | 3300005578 | Bacteria | 3716 |
| 75 | Ga0068854_100035802 | 3300005578 | Bacteria | 3476 |
| 76 | Ga0068854_100167848 | 3300005578 | Bacteria | 1705 |
| 77 | Ga0068852_100022802 | 3300005616 | Bacteria | 5027 |
| 78 | Ga0068852_100045127 | 3300005616 | Bacteria | 3747 |
| 79 | Ga0068852_100090448 | 3300005616 | Bacteria | 2737 |
| 80 | Ga0068859_100006569 | 3300005617 | Bacteria | 11802 |
| 81 | Ga0068864_100008900 | 3300005618 | Bacteria | 8275 |
| 82 | Ga0068861_100001850 | 3300005719 | Bacteria | 13615 |
| 83 | Ga0068851_10020638 | 3300005834 | Bacteria | 3192 |
| 84 | Ga0068851_10029602 | 3300005834 | Bacteria | 2712 |
| 85 | Ga0068863_100032733 | 3300005841 | Bacteria | 4953 |
| 86 | Ga0068858_100034057 | 3300005842 | Bacteria | 4725 |
| 87 | Ga0068860_100156728 | 3300005843 | Bacteria | 2195 |
| 88 | Ga0068862_100043338 | 3300005844 | Bacteria | 3836 |
| 89 | Ga0068862_100080957 | 3300005844 | Bacteria | 2817 |
| 90 | Ga0070717_10011901 | 3300006028 | Bacteria | 6621 |
| 91 | Ga0070717_10173763 | 3300006028 | Bacteria | 1875 |
| 92 | Ga0075364_10000241 | 3300006051 | Bacteria | 26213 |
| 93 | Ga0075364_10019578 | 3300006051 | Bacteria | 4248 |
| 94 | Ga0075364_10053825 | 3300006051 | Bacteria | 2631 |
| 95 | Ga0070716_100083546 | 3300006173 | Bacteria | 1913 |
| 96 | Ga0070712_100009916 | 3300006175 | Bacteria | 6005 |
| 97 | Ga0097621_100007843 | 3300006237 | Bacteria | 7656 |
| 98 | Ga0075370_10069306 | 3300006353 | Bacteria | 2015 |
| 99 | Ga0068871_100027451 | 3300006358 | Bacteria | 4453 |
| 100 | Ga0075428_100097502 | 3300006844 | Bacteria | 3205 |
| 101 | Ga0075428_100098601 | 3300006844 | Bacteria | 3186 |
| 102 | Ga0075431_100000746 | 3300006847 | Bacteria | 28089 |
| 103 | Ga0075429_100089055 | 3300006880 | Bacteria | 2690 |
| 104 | Ga0097620_100006569 | 3300006931 | Bacteria | 11802 |
| 105 | Ga0099824_1030680 | 3300006942 | Bacteria | 2128 |
| 106 | Ga0099822_1003706 | 3300006943 | Bacteria | 19688 |
| 107 | Ga0079104_1001730 | 3300006946 | Bacteria | 13875 |
| 108 | Ga0079104_1007105 | 3300006946 | Bacteria | 4117 |
| 109 | Ga0099826_10000039 | 3300006948 | Bacteria | 99286 |
| 110 | Ga0105250_10002148 | 3300009092 | Bacteria | 10119 |
| 111 | Ga0111539_10020521 | 3300009094 | Bacteria | 8137 |
| 112 | Ga0114129_10001070 | 3300009147 | Bacteria | 35994 |
| 113 | Ga0114129_10100051 | 3300009147 | Bacteria | 4012 |
| 114 | Ga0114129_10144150 | 3300009147 | Bacteria | 3263 |
| 115 | Ga0105248_10004400 | 3300009177 | Bacteria | 15593 |
| 116 | Ga0105248_10005940 | 3300009177 | Bacteria | 13414 |
| 117 | Ga0105248_10012680 | 3300009177 | Bacteria | 9300 |
| 118 | Ga0105237_10016183 | 3300009545 | Bacteria | 7756 |
| 119 | Ga0105237_10036428 | 3300009545 | Bacteria | 4979 |
| 120 | Ga0105238_10007494 | 3300009551 | Bacteria | 10932 |
| 121 | Ga0105238_10011653 | 3300009551 | Bacteria | 8859 |
| 122 | Ga0105238_10012510 | 3300009551 | Bacteria | 8561 |
| 123 | Ga0105238_10052632 | 3300009551 | Bacteria | 4093 |
| 124 | Ga0105238_10074902 | 3300009551 | Bacteria | 3377 |
| 125 | Ga0099796_10000276 | 3300010159 | Bacteria | 8117 |
| 126 | Ga0099796_10015184 | 3300010159 | Bacteria | 2245 |
| 127 | Ga0105239_10013790 | 3300010375 | Bacteria | 8970 |
| 128 | Ga0105239_10043880 | 3300010375 | Bacteria | 4903 |
| 129 | Ga0105239_10202282 | 3300010375 | Bacteria | 2225 |
| 130 | Ga0157347_1000034 | 3300012502 | Bacteria | 5131 |
| 131 | Ga0157371_10001514 | 3300013102 | Bacteria | 24008 |
| 132 | Ga0157371_10051085 | 3300013102 | Bacteria | 2938 |
| 133 | Ga0157369_10008661 | 3300013105 | Bacteria | 11666 |
| 134 | Ga0157374_10009759 | 3300013296 | Bacteria | 8242 |
| 135 | Ga0157378_10020686 | 3300013297 | Bacteria | 5788 |
| 136 | Ga0157372_10004459 | 3300013307 | Bacteria | 14933 |
| 137 | Ga0157372_10153648 | 3300013307 | Bacteria | 2658 |
| 138 | Ga0157372_10154140 | 3300013307 | Bacteria | 2653 |
| 139 | Ga0157375_10047478 | 3300013308 | Bacteria | 4194 |
| 140 | Ga0163163_10049178 | 3300014325 | Bacteria | 4148 |
| 141 | Ga0157379_10004214 | 3300014968 | Bacteria | 12278 |
| 142 | Ga0157376_10006746 | 3300014969 | Bacteria | 8127 |
| 143 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 144 | Ga0182006_1002448 | 3300015261 | Bacteria | 10147 |
| 145 | Ga0182006_1038981 | 3300015261 | Bacteria | 1877 |
| 146 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 147 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 148 | Ga0163161_10032047 | 3300017792 | Bacteria | 3750 |
| 149 | Ga0213872_10005211 | 3300021361 | Bacteria | 6725 |
| 150 | Ga0213875_10002319 | 3300021388 | Bacteria | 11514 |
| 151 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 152 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 153 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 154 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 155 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 156 | Ga0209233_1000053 | 3300025261 | Bacteria | 444909 |
| 157 | Ga0209565_1000927 | 3300025263 | Bacteria | 15517 |
| 158 | Ga0209565_1003320 | 3300025263 | Bacteria | 5268 |
| 159 | Ga0209673_1000443 | 3300025273 | Bacteria | 71250 |
| 160 | Ga0209673_1010110 | 3300025273 | Bacteria | 4008 |
| 161 | Ga0209675_1000291 | 3300025291 | Bacteria | 46848 |
| 162 | Ga0209675_1001223 | 3300025291 | Bacteria | 15517 |
| 163 | Ga0209675_1002115 | 3300025291 | Bacteria | 10517 |
| 164 | Ga0209676_1000059 | 3300025292 | Bacteria | 344882 |
| 165 | Ga0209025_1000028 | 3300025294 | Bacteria | 490678 |
| 166 | Ga0209025_1000879 | 3300025294 | Bacteria | 47123 |
| 167 | Ga0209025_1002965 | 3300025294 | Bacteria | 16857 |
| 168 | Ga0209025_1010155 | 3300025294 | Bacteria | 6423 |
| 169 | Ga0209564_1000623 | 3300025295 | Bacteria | 53919 |
| 170 | Ga0209564_1002245 | 3300025295 | Bacteria | 15893 |
| 171 | Ga0209564_1002915 | 3300025295 | Bacteria | 12446 |
| 172 | Ga0209564_1004985 | 3300025295 | Bacteria | 7816 |
| 173 | Ga0209256_1000661 | 3300025299 | Bacteria | 46620 |
| 174 | Ga0209256_1003207 | 3300025299 | Bacteria | 11817 |
| 175 | Ga0207656_10019146 | 3300025321 | Bacteria | 2705 |
| 176 | Ga0207696_1003576 | 3300025711 | Bacteria | 7019 |
| 177 | Ga0207688_10005778 | 3300025901 | Bacteria | 6735 |
| 178 | Ga0207680_10007805 | 3300025903 | Bacteria | 5229 |
| 179 | Ga0207684_10010691 | 3300025910 | Bacteria | 8061 |
| 180 | Ga0207684_10174831 | 3300025910 | Bacteria | 1851 |
| 181 | Ga0207707_10126088 | 3300025912 | Bacteria | 2239 |
| 182 | Ga0207695_10000573 | 3300025913 | Bacteria | 75332 |
| 183 | Ga0207671_10031935 | 3300025914 | Bacteria | 3921 |
| 184 | Ga0207693_10006671 | 3300025915 | Bacteria | 9536 |
| 185 | Ga0207693_10035719 | 3300025915 | Bacteria | 3918 |
| 186 | Ga0207657_10000137 | 3300025919 | Bacteria | 74712 |
| 187 | Ga0207657_10003404 | 3300025919 | Bacteria | 16996 |
| 188 | Ga0207657_10023220 | 3300025919 | Bacteria | 5781 |
| 189 | Ga0207657_10026864 | 3300025919 | Bacteria | 5280 |
| 190 | Ga0207657_10037213 | 3300025919 | Bacteria | 4348 |
| 191 | Ga0207652_10101333 | 3300025921 | Bacteria | 2543 |
| 192 | Ga0207652_10137820 | 3300025921 | Bacteria | 2180 |
| 193 | Ga0207646_10016047 | 3300025922 | Bacteria | 7039 |
| 194 | Ga0207681_10055000 | 3300025923 | Bacteria | 2709 |
| 195 | Ga0207694_10119344 | 3300025924 | Bacteria | 2104 |
| 196 | Ga0207690_10000013 | 3300025932 | Bacteria | 266156 |
| 197 | Ga0207706_10001109 | 3300025933 | Bacteria | 27405 |
| 198 | Ga0207711_10005616 | 3300025941 | Bacteria | 10604 |
| 199 | Ga0207689_10000605 | 3300025942 | Bacteria | 34379 |
| 200 | Ga0207689_10002130 | 3300025942 | Bacteria | 18622 |
| 201 | Ga0207679_10149315 | 3300025945 | Bacteria | 1900 |
| 202 | Ga0207667_10023248 | 3300025949 | Bacteria | 6825 |
| 203 | Ga0207667_10027384 | 3300025949 | Bacteria | 6205 |
| 204 | Ga0207667_10091394 | 3300025949 | Bacteria | 3144 |
| 205 | Ga0207667_10179673 | 3300025949 | Bacteria | 2173 |
| 206 | Ga0207651_10000815 | 3300025960 | Bacteria | 13452 |
| 207 | Ga0207640_10088754 | 3300025981 | Bacteria | 2135 |
| 208 | Ga0207658_10103211 | 3300025986 | Bacteria | 2238 |
| 209 | Ga0207677_10002600 | 3300026023 | Bacteria | 9491 |
| 210 | Ga0207639_10071657 | 3300026041 | Bacteria | 2711 |
| 211 | Ga0207639_10094938 | 3300026041 | Bacteria | 2395 |
| 212 | Ga0207678_10000119 | 3300026067 | Bacteria | 65478 |
| 213 | Ga0207678_10000497 | 3300026067 | Bacteria | 35757 |
| 214 | Ga0207702_10173163 | 3300026078 | Bacteria | 1981 |
| 215 | Ga0207648_10066129 | 3300026089 | Bacteria | 3153 |
| 216 | Ga0207676_10011899 | 3300026095 | Bacteria | 6225 |
| 217 | Ga0207674_10004838 | 3300026116 | Bacteria | 16125 |
| 218 | Ga0207674_10015373 | 3300026116 | Bacteria | 8409 |
| 219 | Ga0207674_10028948 | 3300026116 | Bacteria | 5839 |
| 220 | Ga0207674_10029689 | 3300026116 | Bacteria | 5754 |
| 221 | Ga0207675_100000926 | 3300026118 | Bacteria | 29286 |
| 222 | Ga0207698_10015729 | 3300026142 | Bacteria | 5078 |
| 223 | Ga0207698_10059749 | 3300026142 | Bacteria | 2961 |
| 224 | Ga0209281_1001457 | 3300027111 | Bacteria | 13898 |
| 225 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 226 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 227 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 228 | Ga0209282_1000058 | 3300027666 | Bacteria | 99152 |
| 229 | Ga0316181_1070820 | 3300030744 | Bacteria | 2748 |
| 230 | Ga0265330_10011296 | 3300031235 | Bacteria | 4194 |
| 231 | Ga0265320_10002374 | 3300031240 | Bacteria | 13161 |
| 232 | Ga0265325_10004104 | 3300031241 | Bacteria | 9278 |
| 233 | Ga0265325_10013704 | 3300031241 | Bacteria | 4604 |
| 234 | Ga0265339_10000425 | 3300031249 | Bacteria | 33388 |
| 235 | Ga0265316_10136146 | 3300031344 | Bacteria | 1848 |
| 236 | Ga0307408_100028832 | 3300031548 | Bacteria | 3839 |
| 237 | Ga0265313_10000107 | 3300031595 | Bacteria | 83816 |
| 238 | Ga0265314_10025974 | 3300031711 | Bacteria | 4408 |
| 239 | Ga0307516_10001128 | 3300031730 | Bacteria | 37196 |
| 240 | Ga0307406_10022582 | 3300031901 | Bacteria | 3734 |
| 241 | Ga0307406_10053404 | 3300031901 | Bacteria | 2574 |
| 242 | Ga0307412_10212565 | 3300031911 | Bacteria | 1477 |
| 243 | Ga0316215_1001466 | 3300033544 | Bacteria | 2272 |
| 244 | Ga0373931_0006912 | 3300035691 | Bacteria | 5338 |
| 245 | Ga0373925_0077596 | 3300037068 | Bacteria | 2522 |
| 246 | Ga0395899_0008100 | 3300037312 | Bacteria | 8092 |
| 247 | Ga0395900_0006777 | 3300037418 | Bacteria | 11891 |
| 248 | Ga0395900_0079503 | 3300037418 | Bacteria | 3370 |
| 249 | Ga0395898_0043891 | 3300037466 | Bacteria | 4404 |
| 250 | Ga0395898_0097958 | 3300037466 | Bacteria | 2816 |
| 251 | Ga0395905_0000353 | 3300037471 | Bacteria | 65228 |
| 252 | Ga0395905_0013434 | 3300037471 | Bacteria | 7846 |
| 253 | Ga0395905_0068361 | 3300037471 | Bacteria | 3327 |
| 254 | Ga0436364_0616684 | 3300037853 | Bacteria | 34041 |
| 255 | Ga0395901_0000574 | 3300038443 | Bacteria | 42766 |
| 256 | Ga0395901_0205259 | 3300038443 | Bacteria | 2065 |
| 257 | Ga0436361_0439571 | 3300039447 | Bacteria | 4790 |
| 258 | Ga0436361_1211686 | 3300039447 | Bacteria | 8622 |
| 259 | Ga0439447_000627 | 3300041407 | Bacteria | 13144 |
| 260 | Ga0439447_005618 | 3300041407 | Bacteria | 4151 |
| 261 | Ga0451793_1587026 | 3300041452 | Bacteria | 1598 |
| 262 | Ga0451797_1457614 | 3300041453 | Bacteria | 3551 |
| 263 | Ga0439432_023781 | 3300042006 | Bacteria | 2016 |
| 264 | Ga0439432_025387 | 3300042006 | Bacteria | 1944 |
| 265 | Ga0439452_005096 | 3300042010 | Bacteria | 4284 |
| 266 | Ga0439456_004556 | 3300042013 | Bacteria | 2802 |
| 267 | Ga0439463_011493 | 3300042016 | Bacteria | 2174 |
| 268 | Ga0450890_002362 | 3300042127 | Bacteria | 2603 |
| 269 | Ga0450907_001201 | 3300042146 | Bacteria | 5860 |
| 270 | Ga0439460_0011782 | 3300042461 | Bacteria | 2259 |
| 271 | Ga0451577_0021805 | 3300042876 | Bacteria | 5858 |
| 272 | Ga0451577_0065911 | 3300042876 | Bacteria | 3229 |
| 273 | Ga0466961_0011072 | 3300044693 | Bacteria | 5765 |
| 274 | Ga0466971_0023990 | 3300044719 | Bacteria | 2719 |
| 275 | Ga0466957_0009939 | 3300044842 | Bacteria | 5443 |
| 276 | Ga0466957_0095449 | 3300044842 | Bacteria | 1867 |
| 277 | Ga0466957_0149432 | 3300044842 | Bacteria | 1510 |
| 278 | Ga0466959_0102528 | 3300045049 | Bacteria | 2048 |
| 279 | Ga0451576_0096489 | 3300045051 | Bacteria | 3075 |
| 280 | Ga0466958_0000187 | 3300045836 | Bacteria | 22479 |
| 281 | Ga0466958_0056301 | 3300045836 | Bacteria | 2388 |
| 282 | Ga0466967_0021844 | 3300045976 | Bacteria | 5208 |
| 283 | Ga0495638_0000145 | 3300046460 | Bacteria | 112275 |
| 284 | Ga0495638_0023560 | 3300046460 | Bacteria | 4025 |
| 285 | Ga0495605_0006921 | 3300046474 | Bacteria | 6478 |
| 286 | Ga0495585_0008730 | 3300046492 | Bacteria | 6128 |
| 287 | Ga0495596_0000738 | 3300046500 | Bacteria | 20164 |
| 288 | Ga0495607_0008050 | 3300046501 | Bacteria | 7238 |
| 289 | Ga0495607_0023097 | 3300046501 | Bacteria | 3896 |
| 290 | Ga0495583_0017814 | 3300046506 | Bacteria | 3759 |
| 291 | Ga0495583_0029329 | 3300046506 | Bacteria | 2693 |
| 292 | Ga0495606_0004680 | 3300046507 | Bacteria | 13523 |
| 293 | Ga0495608_0168422 | 3300046511 | Bacteria | 1390 |
| 294 | Ga0495610_0002945 | 3300046512 | Bacteria | 13742 |
| 295 | Ga0495618_0098689 | 3300046514 | Bacteria | 1869 |
| 296 | Ga0495620_0027151 | 3300046515 | Bacteria | 2683 |
| 297 | Ga0495631_0001207 | 3300046518 | Bacteria | 15935 |
| 298 | Ga0495632_0006023 | 3300046519 | Bacteria | 7881 |
| 299 | Ga0495637_0027844 | 3300046520 | Bacteria | 2525 |
| 300 | Ga0495643_0034274 | 3300046522 | Bacteria | 2802 |
| 301 | Ga0495648_0002842 | 3300046524 | Bacteria | 15591 |
| 302 | Ga0495648_0090617 | 3300046524 | Bacteria | 1713 |
| 303 | Ga0495666_0012358 | 3300046526 | Bacteria | 4256 |
| 304 | Ga0495642_0006479 | 3300046528 | Bacteria | 4492 |
| 305 | Ga0495642_0017735 | 3300046528 | Bacteria | 2781 |
| 306 | Ga0495609_0000943 | 3300046538 | Bacteria | 21055 |
| 307 | Ga0495609_0019502 | 3300046538 | Bacteria | 3137 |
| 308 | Ga0495597_0000167 | 3300046542 | Bacteria | 58157 |
| 309 | Ga0495597_0018990 | 3300046542 | Bacteria | 3221 |
| 310 | Ga0495645_0036425 | 3300046543 | Bacteria | 3586 |
| 311 | Ga0495633_0001624 | 3300046558 | Bacteria | 16970 |
| 312 | Ga0495656_0001352 | 3300046615 | Bacteria | 8004 |
| 313 | Ga0495668_0008800 | 3300046616 | Bacteria | 6257 |
| 314 | Ga0495611_0002205 | 3300046648 | Bacteria | 9054 |
| 315 | Ga0495625_0000467 | 3300046660 | Bacteria | 60730 |
| 316 | Ga0495659_0002637 | 3300046664 | Bacteria | 5786 |
| 317 | Ga0495661_0003823 | 3300046665 | Bacteria | 11016 |
| 318 | Ga0495661_0010519 | 3300046665 | Bacteria | 6310 |
| 319 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 320 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 321 | Ga0495671_0001086 | 3300046692 | Bacteria | 18821 |
| 322 | Ga0495600_0151529 | 3300046809 | Bacteria | 1501 |
| 323 | Ga0495660_0003780 | 3300046810 | Bacteria | 9283 |
| 324 | Ga0495604_0005176 | 3300047317 | Bacteria | 10329 |
| 325 | Ga0495672_0002271 | 3300047320 | Bacteria | 17861 |
| 326 | Ga0495672_0012359 | 3300047320 | Bacteria | 5960 |
| 327 | Ga0495685_025804 | 3300047447 | Bacteria | 2022 |
| 328 | Ga0495593_0010951 | 3300047673 | Bacteria | 5223 |
| 329 | Ga0496101_0084325 | 3300048904 | Bacteria | 2353 |
| 330 | Ga0496102_0017089 | 3300048905 | Bacteria | 6351 |
| 331 | Ga0496102_0178839 | 3300048905 | Bacteria | 1998 |
| 332 | Ga0496103_0126082 | 3300048906 | Bacteria | 1633 |
| 333 | Ga0496104_0055042 | 3300048907 | Bacteria | 3761 |
| 334 | Ga0496104_0241225 | 3300048907 | Bacteria | 1720 |
| 335 | Ga0496107_0120045 | 3300048910 | Bacteria | 1936 |
| 336 | Ga0496110_0000148 | 3300048913 | Bacteria | 41684 |
| 337 | Ga0496110_0089697 | 3300048913 | Bacteria | 2748 |
| 338 | Ga0496111_0006204 | 3300048914 | Bacteria | 7744 |
| 339 | Ga0496111_0054707 | 3300048914 | Unclassified | 2886 |
| 340 | Ga0496113_0037116 | 3300048916 | Bacteria | 3574 |
| 341 | Ga0496114_0010521 | 3300048917 | Bacteria | 7362 |
| 342 | Ga0496115_0027875 | 3300048918 | Bacteria | 4422 |
| 343 | Ga0496116_0014321 | 3300048919 | Bacteria | 6339 |
| 344 | Ga0496116_0047596 | 3300048919 | Bacteria | 2886 |
| 345 | Ga0496116_0079465 | 3300048919 | Unclassified | 2041 |
| 346 | Ga0496117_0000156 | 3300048920 | Bacteria | 145285 |
| 347 | Ga0496118_0000005 | 3300048921 | Bacteria | 697350 |
| 348 | Ga0496118_0148913 | 3300048921 | Bacteria | 1468 |
| 349 | Ga0496119_0000133 | 3300048922 | Bacteria | 104400 |
| 350 | Ga0496119_0008959 | 3300048922 | Bacteria | 8688 |
| 351 | Ga0496119_0026819 | 3300048922 | Bacteria | 3982 |
| 352 | Ga0496120_0013066 | 3300048923 | Bacteria | 5614 |
| 353 | Ga0496120_0067602 | 3300048923 | Bacteria | 1973 |
| 354 | Ga0496121_0005527 | 3300048924 | Bacteria | 16152 |
| 355 | Ga0496121_0008550 | 3300048924 | Bacteria | 12005 |
| 356 | Ga0496121_0022034 | 3300048924 | Bacteria | 6204 |
| 357 | Ga0496122_0008855 | 3300048925 | Bacteria | 10738 |
| 358 | Ga0496122_0015579 | 3300048925 | Bacteria | 7256 |
| 359 | Ga0496123_0002314 | 3300048926 | Bacteria | 23928 |
| 360 | Ga0496123_0015495 | 3300048926 | Bacteria | 6249 |
| 361 | Ga0496124_0020596 | 3300048927 | Bacteria | 6088 |
| 362 | Ga0496125_0000710 | 3300048928 | Bacteria | 55020 |
| 363 | Ga0496125_0005203 | 3300048928 | Bacteria | 14597 |
| 364 | Ga0496125_0058294 | 3300048928 | Bacteria | 3120 |
| 365 | Ga0496126_0065314 | 3300048929 | Bacteria | 3257 |
| 366 | Ga0496126_0116288 | 3300048929 | Bacteria | 2325 |
| 367 | Ga0496126_0154946 | 3300048929 | Bacteria | 1961 |
| 368 | Ga0496126_0202149 | 3300048929 | Bacteria | 1677 |
| 369 | Ga0495678_001890 | 3300049459 | Bacteria | 15210 |
| 370 | Ga0495678_015557 | 3300049459 | Bacteria | 3498 |
| 371 | Ga0495682_0011136 | 3300049460 | Bacteria | 3465 |
| 372 | Ga0501032_0028641 | 3300049569 | Bacteria | 3827 |
| 373 | Ga0501033_0020588 | 3300049570 | Bacteria | 4985 |
| 374 | Ga0501034_0001709 | 3300049571 | Bacteria | 28248 |
| 375 | Ga0501034_0025558 | 3300049571 | Bacteria | 6013 |
| 376 | Ga0501034_0062645 | 3300049571 | Unclassified | 3735 |
| 377 | Ga0501034_0117406 | 3300049571 | Bacteria | 2648 |
| 378 | Ga0501036_0015891 | 3300049572 | Bacteria | 6287 |
| 379 | Ga0501036_0026779 | 3300049572 | Bacteria | 4871 |
| 380 | Ga0501036_0153723 | 3300049572 | Bacteria | 1941 |
| 381 | Ga0501037_0194924 | 3300049573 | Bacteria | 1433 |
| 382 | Ga0501038_0000014 | 3300049574 | Bacteria | 164836 |
| 383 | Ga0501038_0024830 | 3300049574 | Bacteria | 5343 |
| 384 | Ga0501039_0004707 | 3300049575 | Bacteria | 10330 |
| 385 | Ga0501040_0006648 | 3300049576 | Bacteria | 7503 |
| 386 | Ga0501040_0091002 | 3300049576 | Bacteria | 2121 |
| 387 | Ga0501040_0185316 | 3300049576 | Bacteria | 1476 |
| 388 | Ga0501041_0000023 | 3300049577 | Bacteria | 51046 |
| 389 | Ga0501041_0001081 | 3300049577 | Bacteria | 14919 |
| 390 | Ga0501041_0018662 | 3300049577 | Bacteria | 4131 |
| 391 | Ga0501041_0100474 | 3300049577 | Bacteria | 1790 |
| 392 | Ga0501042_0047504 | 3300049578 | Bacteria | 3061 |
| 393 | Ga0501042_0088194 | 3300049578 | Bacteria | 2226 |
| 394 | Ga0501043_0000121 | 3300049579 | Bacteria | 72050 |
| 395 | Ga0501043_0045567 | 3300049579 | Bacteria | 3449 |
| 396 | Ga0501043_0200714 | 3300049579 | Bacteria | 1548 |
| 397 | Ga0501046_0000157 | 3300049580 | Bacteria | 70302 |
| 398 | Ga0501046_0017088 | 3300049580 | Bacteria | 6063 |
| 399 | Ga0501046_0125077 | 3300049580 | Bacteria | 1954 |
| 400 | Ga0501046_0178819 | 3300049580 | Bacteria | 1587 |
| 401 | Ga0501047_0000198 | 3300049581 | Bacteria | 72705 |
| 402 | Ga0501047_0050766 | 3300049581 | Bacteria | 4006 |
| 403 | Ga0501047_0061826 | 3300049581 | Bacteria | 3613 |
| 404 | Ga0501048_0000020 | 3300049582 | Bacteria | 70567 |
| 405 | Ga0501048_0001216 | 3300049582 | Bacteria | 19497 |
| 406 | Ga0501048_0011807 | 3300049582 | Bacteria | 6513 |
| 407 | Ga0501048_0231257 | 3300049582 | Bacteria | 1312 |
| 408 | Ga0501068_0075082 | 3300049584 | Bacteria | 2067 |
| 409 | Ga0501070_0014599 | 3300049586 | Bacteria | 6610 |
| 410 | Ga0501071_0000496 | 3300049587 | Bacteria | 19961 |
| 411 | Ga0501071_0061432 | 3300049587 | Bacteria | 2721 |
| 412 | Ga0501072_0001424 | 3300049588 | Bacteria | 17944 |
| 413 | Ga0501072_0015746 | 3300049588 | Bacteria | 5796 |
| 414 | Ga0501072_0048824 | 3300049588 | Bacteria | 3332 |
| 415 | Ga0501074_0027398 | 3300049590 | Bacteria | 4132 |
| 416 | Ga0501074_0032693 | 3300049590 | Bacteria | 3768 |
| 417 | Ga0501074_0058718 | 3300049590 | Bacteria | 2771 |
| 418 | Ga0501074_0071397 | 3300049590 | Bacteria | 2496 |
| 419 | Ga0501074_0086448 | 3300049590 | Bacteria | 2246 |
| 420 | Ga0501075_0001541 | 3300049591 | Bacteria | 15041 |
| 421 | Ga0501075_0094203 | 3300049591 | Bacteria | 2273 |
| 422 | Ga0501075_0204635 | 3300049591 | Bacteria | 1505 |
| 423 | Ga0501076_0027248 | 3300049592 | Bacteria | 4432 |
| 424 | Ga0501076_0049514 | 3300049592 | Bacteria | 3323 |
| 425 | Ga0501076_0088942 | 3300049592 | Bacteria | 2482 |
| 426 | Ga0501076_0179224 | 3300049592 | Bacteria | 1727 |
| 427 | Ga0501077_0000714 | 3300049593 | Bacteria | 20042 |
| 428 | Ga0501077_0002269 | 3300049593 | Bacteria | 11589 |
| 429 | Ga0501077_0002332 | 3300049593 | Bacteria | 11433 |
| 430 | Ga0501077_0006844 | 3300049593 | Bacteria | 7014 |
| 431 | Ga0501079_0000769 | 3300049741 | Bacteria | 21929 |
| 432 | Ga0501079_0006340 | 3300049741 | Bacteria | 8876 |
| 433 | Ga0501079_0015449 | 3300049741 | Bacteria | 5826 |
| 434 | Ga0501079_0060690 | 3300049741 | Bacteria | 2917 |
| 435 | Ga0501079_0078499 | 3300049741 | Bacteria | 2553 |
| 436 | Ga0501080_0004129 | 3300049742 | Bacteria | 12869 |
| 437 | Ga0501080_0005187 | 3300049742 | Bacteria | 11609 |
| 438 | Ga0501080_0005645 | 3300049742 | Bacteria | 11182 |
| 439 | Ga0501080_0060269 | 3300049742 | Bacteria | 3532 |
| 440 | Ga0501080_0140633 | 3300049742 | Bacteria | 2232 |
| 441 | Ga0501081_0002294 | 3300049743 | Bacteria | 12048 |
| 442 | Ga0501081_0003181 | 3300049743 | Bacteria | 10439 |
| 443 | Ga0501081_0008301 | 3300049743 | Bacteria | 6739 |
| 444 | Ga0501083_0007955 | 3300049744 | Bacteria | 7507 |
| 445 | Ga0501083_0019946 | 3300049744 | Bacteria | 4666 |
| 446 | Ga0501083_0046396 | 3300049744 | Bacteria | 2938 |
| 447 | Ga0501083_0052403 | 3300049744 | Bacteria | 2741 |
| 448 | Ga0501035_0037565 | 3300049822 | Bacteria | 4385 |
| 449 | Ga0501035_0246860 | 3300049822 | Bacteria | 1517 |
| 450 | Ga0501044_0050216 | 3300049823 | Bacteria | 4305 |
| 451 | Ga0501044_0181990 | 3300049823 | Bacteria | 2068 |
| 452 | Ga0501045_0000975 | 3300049824 | Bacteria | 18730 |
| 453 | Ga0501045_0013664 | 3300049824 | Bacteria | 5739 |
| 454 | Ga0501045_0081109 | 3300049824 | Bacteria | 2392 |
| 455 | Ga0501045_0163537 | 3300049824 | Bacteria | 1657 |
| 456 | nmdc:mga00v17_141_c1 | 3300050491 | Bacteria | 41598 |
| 457 | nmdc:mga00v17_9143_c2 | 3300050491 | Bacteria | 4606 |
| 458 | nmdc:mga0k408_41613_c1 | 3300050493 | Bacteria | 2645 |
| 459 | nmdc:mga07m45_13976_c1 | 3300050496 | Bacteria | 4268 |
| 460 | nmdc:mga05p37_40430_c1 | 3300050507 | Bacteria | 5727 |
| 461 | nmdc:mga09592_84037_c1 | 3300050508 | Bacteria | 2714 |
| 462 | nmdc:mga0qj67_7804_c1 | 3300050509 | Bacteria | 7910 |
| 463 | nmdc:mga06r32_218654_c1 | 3300050510 | Bacteria | 1893 |
| 464 | nmdc:mga08y16_123188_c1 | 3300050511 | Bacteria | 2698 |
| 465 | Ga0495601_0135543 | 3300053077 | Bacteria | 1605 |
| 466 | Ga0495595_0065470 | 3300053084 | Bacteria | 1709 |
| 467 | Ga0495619_0003906 | 3300053085 | Bacteria | 9579 |
| 468 | Ga0500643_012946 | 3300053087 | Bacteria | 2969 |
| 469 | Ga0500556_0000336 | 3300053104 | Bacteria | 35065 |
| 470 | Ga0500557_000622 | 3300053105 | Bacteria | 4867 |
| 471 | Ga0500562_020100 | 3300053108 | Bacteria | 1733 |
| 472 | Ga0500595_017608 | 3300053119 | Bacteria | 2633 |
| 473 | Ga0500568_0001808 | 3300053139 | Bacteria | 13178 |
| 474 | Ga0500568_0066652 | 3300053139 | Bacteria | 1384 |
| 475 | Ga0500616_0000917 | 3300053153 | Bacteria | 32210 |
| 476 | Ga0500596_001643 | 3300053735 | Bacteria | 4519 |
| 477 | Ga0501084_0000739 | 3300054114 | Bacteria | 24952 |
| 478 | Ga0501084_0002070 | 3300054114 | Bacteria | 16013 |
| 479 | Ga0501084_0009931 | 3300054114 | Bacteria | 7869 |
| 480 | Ga0501084_0049269 | 3300054114 | Bacteria | 3526 |
| 481 | Ga0501082_0000869 | 3300060353 | Bacteria | 26666 |
| 482 | Ga0501082_0031019 | 3300060353 | Bacteria | 4607 |
| 483 | Ga0501082_0049319 | 3300060353 | Bacteria | 3630 |
| 484 | Ga0501082_0112868 | 3300060353 | Bacteria | 2353 |
| 485 | Ga0466962_0009066 | 3300061719 | Bacteria | 4763 |
| 486 | Ga0466962_0027249 | 3300061719 | Bacteria | 2743 |
| 487 | Ga0530510_0000323 | 3300061734 | Bacteria | 30875 |
| 488 | Ga0530510_0018161 | 3300061734 | Bacteria | 4986 |
| 489 | Ga0530510_0025237 | 3300061734 | Bacteria | 4249 |
| 490 | Ga0530510_0044764 | 3300061734 | Bacteria | 3199 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053139 | Ga0500568_0066652 | Ga0500568_0066652_350_1366 | 314 |
| 2 | 3300042876 | Ga0451577_0021805 | Ga0451577_0021805_2250_3236 | 328 |
| 3 | 3300013102 | Ga0157371_10001514 | Ga0157371_1000151414 | 342 |
| 4 | 3300048926 | Ga0496123_0015495 | Ga0496123_0015495_5029_6234 | 360 |
| 5 | 3300042876 | Ga0451577_0065911 | Ga0451577_0065911_1457_2692 | 361 |
| 6 | 3300045051 | Ga0451576_0096489 | Ga0451576_0096489_550_1785 | 361 |
| 7 | 3300048925 | Ga0496122_0008855 | Ga0496122_0008855_4854_6062 | 361 |
| 8 | 3300048928 | Ga0496125_0000710 | Ga0496125_0000710_18571_19779 | 361 |
| 9 | 3300049571 | Ga0501034_0062645 | Ga0501034_0062645_1823_3160 | 364 |
| 10 | 3300045836 | Ga0466958_0056301 | Ga0466958_0056301_103_1290 | 365 |
| 11 | 3300048905 | Ga0496102_0017089 | Ga0496102_0017089_4906_6126 | 366 |
| 12 | 3300048906 | Ga0496103_0126082 | Ga0496103_0126082_114_1334 | 366 |
| 13 | 3300048919 | Ga0496116_0079465 | Ga0496116_0079465_432_1652 | 366 |
| 14 | 3300048920 | Ga0496117_0000156 | Ga0496117_0000156_79501_80721 | 366 |
| 15 | 3300048921 | Ga0496118_0000005 | Ga0496118_0000005_1837_3057 | 366 |
| 16 | 3300048924 | Ga0496121_0022034 | Ga0496121_0022034_2154_3407 | 366 |
| 17 | 3300037471 | Ga0395905_0068361 | Ga0395905_0068361_124_1368 | 367 |
| 18 | 3300048927 | Ga0496124_0020596 | Ga0496124_0020596_3053_4273 | 367 |
| 19 | 3300053104 | Ga0500556_0000336 | Ga0500556_0000336_11998_13209 | 367 |
| 20 | 3300041452 | Ga0451793_1587026 | Ga0451793_1587026_239_1474 | 368 |
| 21 | 3300046522 | Ga0495643_0034274 | Ga0495643_0034274_936_2186 | 368 |
| 22 | 3300046528 | Ga0495642_0017735 | Ga0495642_0017735_168_1418 | 368 |
| 23 | 3300046542 | Ga0495597_0018990 | Ga0495597_0018990_188_1438 | 368 |
| 24 | 3300049592 | Ga0501076_0179224 | Ga0501076_0179224_81_1202 | 368 |
| 25 | 3300049824 | Ga0501045_0163537 | Ga0501045_0163537_268_1473 | 368 |
| 26 | 3300031730 | Ga0307516_10001128 | Ga0307516_1000112816 | 371 |
| 27 | 3300048922 | Ga0496119_0026819 | Ga0496119_0026819_68_1291 | 371 |
| 28 | 3300006173 | Ga0070716_100083546 | Ga0070716_1000835461 | 372 |
| 29 | 3300046511 | Ga0495608_0168422 | Ga0495608_0168422_23_1270 | 373 |
| 30 | 3300046514 | Ga0495618_0098689 | Ga0495618_0098689_507_1775 | 373 |
| 31 | 3300046809 | Ga0495600_0151529 | Ga0495600_0151529_176_1423 | 373 |
| 32 | 3300053077 | Ga0495601_0135543 | Ga0495601_0135543_236_1504 | 373 |
| 33 | 3300053084 | Ga0495595_0065470 | Ga0495595_0065470_302_1549 | 373 |
| 34 | 3300053085 | Ga0495619_0003906 | Ga0495619_0003906_6783_8030 | 373 |
| 35 | 3300021361 | Ga0213872_10005211 | Ga0213872_100052114 | 374 |
| 36 | 3300039447 | Ga0436361_1211686 | Ga0436361_1211686_1505_2725 | 374 |
| 37 | 3300041407 | Ga0439447_000627 | Ga0439447_000627_3513_4721 | 374 |
| 38 | 3300044693 | Ga0466961_0011072 | Ga0466961_0011072_4295_5521 | 374 |
| 39 | 3300044719 | Ga0466971_0023990 | Ga0466971_0023990_1480_2706 | 374 |
| 40 | 3300044842 | Ga0466957_0095449 | Ga0466957_0095449_95_1321 | 374 |
| 41 | 3300061719 | Ga0466962_0009066 | Ga0466962_0009066_2378_3604 | 374 |
| 42 | 3300049577 | Ga0501041_0001081 | Ga0501041_0001081_8379_9611 | 375 |
| 43 | 3300049588 | Ga0501072_0015746 | Ga0501072_0015746_3450_4682 | 375 |
| 44 | 3300049590 | Ga0501074_0027398 | Ga0501074_0027398_2413_3645 | 375 |
| 45 | 3300049592 | Ga0501076_0088942 | Ga0501076_0088942_737_1969 | 375 |
| 46 | 3300049593 | Ga0501077_0002269 | Ga0501077_0002269_7251_8483 | 375 |
| 47 | 3300049742 | Ga0501080_0004129 | Ga0501080_0004129_10283_11515 | 375 |
| 48 | 3300049743 | Ga0501081_0008301 | Ga0501081_0008301_2477_3709 | 375 |
| 49 | 3300049824 | Ga0501045_0013664 | Ga0501045_0013664_3063_4295 | 375 |
| 50 | 3300054114 | Ga0501084_0049269 | Ga0501084_0049269_2206_3438 | 375 |
| 51 | 3300061734 | Ga0530510_0018161 | Ga0530510_0018161_2449_3681 | 375 |
| 52 | 3300005549 | Ga0070704_100028751 | Ga0070704_1000287512 | 377 |
| 53 | 3300005458 | Ga0070681_10230619 | Ga0070681_102306192 | 378 |
| 54 | 3300005530 | Ga0070679_100175752 | Ga0070679_1001757521 | 378 |
| 55 | 3300009551 | Ga0105238_10074902 | Ga0105238_100749023 | 378 |
| 56 | 3300025912 | Ga0207707_10126088 | Ga0207707_101260882 | 378 |
| 57 | 3300025915 | Ga0207693_10006671 | Ga0207693_100066714 | 378 |
| 58 | 3300025921 | Ga0207652_10101333 | Ga0207652_101013332 | 378 |
| 59 | 3300048907 | Ga0496104_0241225 | Ga0496104_0241225_197_1465 | 378 |
| 60 | 3300049459 | Ga0495678_015557 | Ga0495678_015557_2008_3156 | 378 |
| 61 | 3300049744 | Ga0501083_0007955 | Ga0501083_0007955_3076_4305 | 378 |
| 62 | 3300012502 | Ga0157347_1000034 | Ga0157347_10000346 | 379 |
| 63 | 3300025921 | Ga0207652_10137820 | Ga0207652_101378202 | 379 |
| 64 | 3300049591 | Ga0501075_0204635 | Ga0501075_0204635_54_1205 | 379 |
| 65 | 3300006844 | Ga0075428_100098601 | Ga0075428_1000986012 | 380 |
| 66 | 3300006847 | Ga0075431_100000746 | Ga0075431_1000007465 | 380 |
| 67 | 3300006880 | Ga0075429_100089055 | Ga0075429_1000890552 | 380 |
| 68 | 3300009147 | Ga0114129_10001070 | Ga0114129_1000107029 | 380 |
| 69 | 3300041453 | Ga0451797_1457614 | Ga0451797_1457614_1888_3108 | 380 |
| 70 | 3300049742 | Ga0501080_0140633 | Ga0501080_0140633_1002_2219 | 380 |
| 71 | 3300050508 | nmdc:mga09592_84037_c1 | nmdc:mga09592_84037_c1_898_2097 | 380 |
| 72 | 3300050509 | nmdc:mga0qj67_7804_c1 | nmdc:mga0qj67_7804_c1_1344_2543 | 380 |
| 73 | iso_pu_bacteria | 2894023352 | 2894026315 | 380 |
| 74 | iso_pu_bacteria | 8054563764 | 8054564224 | 380 |
| 75 | 3300005616 | Ga0068852_100022802 | Ga0068852_1000228025 | 381 |
| 76 | 3300005618 | Ga0068864_100008900 | Ga0068864_1000089007 | 381 |
| 77 | 3300005719 | Ga0068861_100001850 | Ga0068861_1000018503 | 381 |
| 78 | 3300006237 | Ga0097621_100007843 | Ga0097621_1000078433 | 381 |
| 79 | 3300006358 | Ga0068871_100027451 | Ga0068871_1000274512 | 381 |
| 80 | 3300026023 | Ga0207677_10002600 | Ga0207677_100026004 | 381 |
| 81 | 3300026095 | Ga0207676_10011899 | Ga0207676_100118992 | 381 |
| 82 | 3300039447 | Ga0436361_0439571 | Ga0436361_0439571_649_1881 | 381 |
| 83 | 3300031240 | Ga0265320_10002374 | Ga0265320_100023743 | 382 |
| 84 | 3300031241 | Ga0265325_10004104 | Ga0265325_100041048 | 382 |
| 85 | 3300031548 | Ga0307408_100028832 | Ga0307408_1000288324 | 382 |
| 86 | 3300031901 | Ga0307406_10022582 | Ga0307406_100225824 | 382 |
| 87 | 3300033544 | Ga0316215_1001466 | Ga0316215_10014662 | 382 |
| 88 | 3300045049 | Ga0466959_0102528 | Ga0466959_0102528_24_1193 | 382 |
| 89 | iso_pu_bacteria | 2974298342 | 2974301069 | 382 |
| 90 | 3300005546 | Ga0070696_100159510 | Ga0070696_1001595102 | 383 |
| 91 | 3300015683 | Ga0183362_10001 | Ga0183362_10001339 | 383 |
| 92 | 3300053139 | Ga0500568_0001808 | Ga0500568_0001808_9461_10645 | 383 |
| 93 | 3300053153 | Ga0500616_0000917 | Ga0500616_0000917_23576_24760 | 383 |
| 94 | iso_pu_bacteria | 2510065053 | 2510281030 | 383 |
| 95 | iso_pu_bacteria | 2510065055 | 2510294839 | 383 |
| 96 | iso_pu_bacteria | 2510065058 | 2510309178 | 383 |
| 97 | iso_pu_bacteria | 2773857672 | 2774131970 | 383 |
| 98 | iso_pu_bacteria | 2984499530 | 2984503543 | 383 |
| 99 | 3300003751 | Ga0055538_1000013 | Ga0055538_1000013258 | 384 |
| 100 | 3300003752 | Ga0055539_1000018 | Ga0055539_1000018258 | 384 |
| 101 | 3300003756 | Ga0055533_1000022 | Ga0055533_1000022258 | 384 |
| 102 | 3300003759 | Ga0055525_1000024 | Ga0055525_1000024258 | 384 |
| 103 | 3300003771 | Ga0055526_1001612 | Ga0055526_10016124 | 384 |
| 104 | 3300003771 | Ga0055526_1004498 | Ga0055526_10044985 | 384 |
| 105 | 3300003781 | Ga0055536_1000090 | Ga0055536_100009067 | 384 |
| 106 | 3300003784 | Ga0055534_1002351 | Ga0055534_10023514 | 384 |
| 107 | 3300003841 | Ga0055541_1000013 | Ga0055541_1000013258 | 384 |
| 108 | 3300005471 | Ga0070698_100187403 | Ga0070698_1001874032 | 384 |
| 109 | 3300006946 | Ga0079104_1007105 | Ga0079104_10071053 | 384 |
| 110 | 3300015265 | Ga0182005_1000008 | Ga0182005_1000008341 | 384 |
| 111 | 3300025224 | Ga0209784_100005 | Ga0209784_100005470 | 384 |
| 112 | 3300025225 | Ga0209566_100005 | Ga0209566_100005470 | 384 |
| 113 | 3300025226 | Ga0209674_100009 | Ga0209674_100009470 | 384 |
| 114 | 3300025230 | Ga0209563_100012 | Ga0209563_100012470 | 384 |
| 115 | 3300025253 | Ga0209677_100006 | Ga0209677_100006470 | 384 |
| 116 | 3300025291 | Ga0209675_1000291 | Ga0209675_10002915 | 384 |
| 117 | 3300025292 | Ga0209676_1000059 | Ga0209676_10000595 | 384 |
| 118 | 3300025294 | Ga0209025_1000879 | Ga0209025_100087939 | 384 |
| 119 | 3300025295 | Ga0209564_1000623 | Ga0209564_100062346 | 384 |
| 120 | 3300025295 | Ga0209564_1002245 | Ga0209564_10022455 | 384 |
| 121 | 3300046460 | Ga0495638_0000145 | Ga0495638_0000145_64404_65591 | 384 |
| 122 | 3300049571 | Ga0501034_0117406 | Ga0501034_0117406_673_1851 | 384 |
| 123 | 3300049576 | Ga0501040_0185316 | Ga0501040_0185316_53_1270 | 384 |
| 124 | 3300049588 | Ga0501072_0048824 | Ga0501072_0048824_956_2173 | 384 |
| 125 | 3300049590 | Ga0501074_0032693 | Ga0501074_0032693_1244_2461 | 384 |
| 126 | 3300049592 | Ga0501076_0049514 | Ga0501076_0049514_711_1928 | 384 |
| 127 | 3300049593 | Ga0501077_0006844 | Ga0501077_0006844_313_1530 | 384 |
| 128 | 3300049741 | Ga0501079_0006340 | Ga0501079_0006340_1543_2760 | 384 |
| 129 | 3300049742 | Ga0501080_0005187 | Ga0501080_0005187_10265_11482 | 384 |
| 130 | 3300049744 | Ga0501083_0046396 | Ga0501083_0046396_1401_2618 | 384 |
| 131 | 3300053108 | Ga0500562_020100 | Ga0500562_020100_102_1289 | 384 |
| 132 | 3300054114 | Ga0501084_0002070 | Ga0501084_0002070_9022_10239 | 384 |
| 133 | 3300060353 | Ga0501082_0112868 | Ga0501082_0112868_906_2123 | 384 |
| 134 | iso_pu_bacteria | 2599185239 | 2599740777 | 384 |
| 135 | iso_pu_bacteria | 2599185240 | 2599747128 | 384 |
| 136 | iso_pu_bacteria | 2599185355 | 2600209664 | 384 |
| 137 | iso_pu_bacteria | 2675903129 | 2676744886 | 384 |
| 138 | iso_pu_bacteria | 2818991452 | 2819633222 | 384 |
| 139 | iso_pu_bacteria | 3007419365 | 3007424083 | 384 |
| 140 | 3300005438 | Ga0070701_10008112 | Ga0070701_100081122 | 385 |
| 141 | 3300005844 | Ga0068862_100080957 | Ga0068862_1000809572 | 385 |
| 142 | 3300026116 | Ga0207674_10028948 | Ga0207674_100289482 | 385 |
| 143 | 3300042006 | Ga0439432_023781 | Ga0439432_023781_567_1733 | 385 |
| 144 | 3300045976 | Ga0466967_0021844 | Ga0466967_0021844_2835_4055 | 385 |
| 145 | 3300046500 | Ga0495596_0000738 | Ga0495596_0000738_14771_15985 | 385 |
| 146 | 3300046501 | Ga0495607_0008050 | Ga0495607_0008050_5739_6953 | 385 |
| 147 | 3300046512 | Ga0495610_0002945 | Ga0495610_0002945_7682_8896 | 385 |
| 148 | 3300046538 | Ga0495609_0000943 | Ga0495609_0000943_14816_16030 | 385 |
| 149 | 3300046665 | Ga0495661_0010519 | Ga0495661_0010519_634_1848 | 385 |
| 150 | 3300047320 | Ga0495672_0002271 | Ga0495672_0002271_7231_8445 | 385 |
| 151 | 3300047447 | Ga0495685_025804 | Ga0495685_025804_15_1229 | 385 |
| 152 | 3300048913 | Ga0496110_0000148 | Ga0496110_0000148_11183_12343 | 385 |
| 153 | 3300048914 | Ga0496111_0054707 | Ga0496111_0054707_1486_2646 | 385 |
| 154 | 3300048919 | Ga0496116_0014321 | Ga0496116_0014321_4153_5367 | 385 |
| 155 | 3300048924 | Ga0496121_0005527 | Ga0496121_0005527_14883_16097 | 385 |
| 156 | 3300049579 | Ga0501043_0000121 | Ga0501043_0000121_52081_53325 | 385 |
| 157 | 3300049580 | Ga0501046_0000157 | Ga0501046_0000157_52053_53297 | 385 |
| 158 | 3300049581 | Ga0501047_0000198 | Ga0501047_0000198_18726_19970 | 385 |
| 159 | 3300049582 | Ga0501048_0000020 | Ga0501048_0000020_52053_53297 | 385 |
| 160 | 2162886007 | SwRhRL2b_contig_2682132 | SwRhRL2b_0337.00004910 | 386 |
| 161 | 3300005289 | Ga0065704_10087137 | Ga0065704_100871372 | 386 |
| 162 | 3300037471 | Ga0395905_0000353 | Ga0395905_0000353_22492_23703 | 386 |
| 163 | 3300046507 | Ga0495606_0004680 | Ga0495606_0004680_11768_12928 | 386 |
| 164 | 3300046665 | Ga0495661_0003823 | Ga0495661_0003823_8535_9785 | 386 |
| 165 | iso_pu_bacteria | 2846037992 | 2846040110 | 386 |
| 166 | 3300046558 | Ga0495633_0001624 | Ga0495633_0001624_7067_8233 | 387 |
| 167 | 3300046692 | Ga0495671_0001086 | Ga0495671_0001086_16127_17341 | 387 |
| 168 | 3300048925 | Ga0496122_0015579 | Ga0496122_0015579_1761_2975 | 387 |
| 169 | 3300048926 | Ga0496123_0002314 | Ga0496123_0002314_22114_23328 | 387 |
| 170 | 3300053735 | Ga0500596_001643 | Ga0500596_001643_2303_3469 | 387 |
| 171 | 3300061734 | Ga0530510_0044764 | Ga0530510_0044764_523_1749 | 387 |
| 172 | 3300003187 | JGI25151J46595_10040096 | JGI25151J46595_100400961 | 388 |
| 173 | 3300005339 | Ga0070660_100055494 | Ga0070660_1000554942 | 388 |
| 174 | 3300005458 | Ga0070681_10178706 | Ga0070681_101787061 | 388 |
| 175 | 3300005563 | Ga0068855_100025742 | Ga0068855_1000257426 | 388 |
| 176 | 3300005577 | Ga0068857_100007527 | Ga0068857_1000075272 | 388 |
| 177 | 3300005616 | Ga0068852_100045127 | Ga0068852_1000451274 | 388 |
| 178 | 3300009551 | Ga0105238_10052632 | Ga0105238_100526322 | 388 |
| 179 | 3300025263 | Ga0209565_1003320 | Ga0209565_10033204 | 388 |
| 180 | 3300025291 | Ga0209675_1002115 | Ga0209675_10021154 | 388 |
| 181 | 3300025294 | Ga0209025_1002965 | Ga0209025_10029653 | 388 |
| 182 | 3300025299 | Ga0209256_1000661 | Ga0209256_10006619 | 388 |
| 183 | 3300025919 | Ga0207657_10003404 | Ga0207657_1000340410 | 388 |
| 184 | 3300025945 | Ga0207679_10149315 | Ga0207679_101493151 | 388 |
| 185 | 3300025949 | Ga0207667_10023248 | Ga0207667_100232484 | 388 |
| 186 | 3300026116 | Ga0207674_10004838 | Ga0207674_100048386 | 388 |
| 187 | 3300044842 | Ga0466957_0009939 | Ga0466957_0009939_1487_2656 | 388 |
| 188 | 3300044842 | Ga0466957_0149432 | Ga0466957_0149432_203_1372 | 388 |
| 189 | 3300045836 | Ga0466958_0000187 | Ga0466958_0000187_8777_9946 | 388 |
| 190 | 3300046542 | Ga0495597_0000167 | Ga0495597_0000167_50701_51987 | 388 |
| 191 | 3300048919 | Ga0496116_0047596 | Ga0496116_0047596_1227_2399 | 388 |
| 192 | 3300049572 | Ga0501036_0153723 | Ga0501036_0153723_653_1864 | 388 |
| 193 | 3300049576 | Ga0501040_0091002 | Ga0501040_0091002_700_1911 | 388 |
| 194 | 3300049580 | Ga0501046_0125077 | Ga0501046_0125077_389_1600 | 388 |
| 195 | 3300049582 | Ga0501048_0231257 | Ga0501048_0231257_77_1288 | 388 |
| 196 | 3300061719 | Ga0466962_0027249 | Ga0466962_0027249_1443_2612 | 388 |
| 197 | iso_pu_bacteria | 2808606377 | 2808929640 | 388 |
| 198 | iso_pu_bacteria | 2808606381 | 2808951781 | 388 |
| 199 | iso_pu_bacteria | 2932422444 | 2932425967 | 388 |
| 200 | 3300037418 | Ga0395900_0079503 | Ga0395900_0079503_1765_2952 | 389 |
| 201 | 3300049571 | Ga0501034_0025558 | Ga0501034_0025558_1281_2468 | 389 |
| 202 | 3300049580 | Ga0501046_0017088 | Ga0501046_0017088_1874_3061 | 389 |
| 203 | 3300053119 | Ga0500595_017608 | Ga0500595_017608_570_1928 | 389 |
| 204 | iso_pu_bacteria | 2739367654 | 2739605186 | 389 |
| 205 | iso_pu_bacteria | 2919675420 | 2919676418 | 389 |
| 206 | 3300006844 | Ga0075428_100097502 | Ga0075428_1000975025 | 390 |
| 207 | 3300009094 | Ga0111539_10020521 | Ga0111539_100205219 | 390 |
| 208 | 3300009147 | Ga0114129_10100051 | Ga0114129_101000517 | 390 |
| 209 | 3300010159 | Ga0099796_10015184 | Ga0099796_100151842 | 390 |
| 210 | 3300013307 | Ga0157372_10154140 | Ga0157372_101541402 | 390 |
| 211 | 3300026089 | Ga0207648_10066129 | Ga0207648_100661293 | 390 |
| 212 | 3300031344 | Ga0265316_10136146 | Ga0265316_101361462 | 390 |
| 213 | 3300037068 | Ga0373925_0077596 | Ga0373925_0077596_629_1858 | 390 |
| 214 | 3300038443 | Ga0395901_0205259 | Ga0395901_0205259_758_1942 | 390 |
| 215 | 3300042016 | Ga0439463_011493 | Ga0439463_011493_76_1284 | 390 |
| 216 | 3300046615 | Ga0495656_0001352 | Ga0495656_0001352_4971_6146 | 390 |
| 217 | 3300048922 | Ga0496119_0000133 | Ga0496119_0000133_50791_52023 | 390 |
| 218 | 3300048923 | Ga0496120_0013066 | Ga0496120_0013066_2622_3854 | 390 |
| 219 | 3300049741 | Ga0501079_0060690 | Ga0501079_0060690_1216_2439 | 390 |
| 220 | 3300050491 | nmdc:mga00v17_9143_c2 | nmdc:mga00v17_9143_c2_151_1326 | 390 |
| 221 | 3300050511 | nmdc:mga08y16_123188_c1 | nmdc:mga08y16_123188_c1_1125_2345 | 390 |
| 222 | iso_pu_bacteria | 2839094727 | 2839099433 | 390 |
| 223 | iso_pu_bacteria | 2939669807 | 2939672446 | 390 |
| 224 | 3300005262 | Ga0065165_1000001 | Ga0065165_1000001245 | 391 |
| 225 | 3300005334 | Ga0068869_100005371 | Ga0068869_1000053718 | 391 |
| 226 | 3300005338 | Ga0068868_100010295 | Ga0068868_1000102956 | 391 |
| 227 | 3300005339 | Ga0070660_100023074 | Ga0070660_1000230743 | 391 |
| 228 | 3300005340 | Ga0070689_100174084 | Ga0070689_1001740841 | 391 |
| 229 | 3300005366 | Ga0070659_100057220 | Ga0070659_1000572202 | 391 |
| 230 | 3300005367 | Ga0070667_100097347 | Ga0070667_1000973472 | 391 |
| 231 | 3300005457 | Ga0070662_100000752 | Ga0070662_1000007523 | 391 |
| 232 | 3300005536 | Ga0070697_100196088 | Ga0070697_1001960881 | 391 |
| 233 | 3300005539 | Ga0068853_100003918 | Ga0068853_10000391811 | 391 |
| 234 | 3300005546 | Ga0070696_100058155 | Ga0070696_1000581551 | 391 |
| 235 | 3300005547 | Ga0070693_100052321 | Ga0070693_1000523212 | 391 |
| 236 | 3300005563 | Ga0068855_100171029 | Ga0068855_1001710292 | 391 |
| 237 | 3300005578 | Ga0068854_100167848 | Ga0068854_1001678482 | 391 |
| 238 | 3300005617 | Ga0068859_100006569 | Ga0068859_1000065692 | 391 |
| 239 | 3300005842 | Ga0068858_100034057 | Ga0068858_1000340574 | 391 |
| 240 | 3300005843 | Ga0068860_100156728 | Ga0068860_1001567282 | 391 |
| 241 | 3300005844 | Ga0068862_100043338 | Ga0068862_1000433382 | 391 |
| 242 | 3300006931 | Ga0097620_100006569 | Ga0097620_10000656910 | 391 |
| 243 | 3300009177 | Ga0105248_10004400 | Ga0105248_100044009 | 391 |
| 244 | 3300009177 | Ga0105248_10005940 | Ga0105248_100059409 | 391 |
| 245 | 3300009545 | Ga0105237_10036428 | Ga0105237_100364285 | 391 |
| 246 | 3300009551 | Ga0105238_10012510 | Ga0105238_100125102 | 391 |
| 247 | 3300010375 | Ga0105239_10013790 | Ga0105239_100137902 | 391 |
| 248 | 3300013296 | Ga0157374_10009759 | Ga0157374_100097597 | 391 |
| 249 | 3300013297 | Ga0157378_10020686 | Ga0157378_100206865 | 391 |
| 250 | 3300013307 | Ga0157372_10153648 | Ga0157372_101536483 | 391 |
| 251 | 3300013308 | Ga0157375_10047478 | Ga0157375_100474782 | 391 |
| 252 | 3300014325 | Ga0163163_10049178 | Ga0163163_100491784 | 391 |
| 253 | 3300014968 | Ga0157379_10004214 | Ga0157379_100042142 | 391 |
| 254 | 3300014969 | Ga0157376_10006746 | Ga0157376_100067467 | 391 |
| 255 | 3300017792 | Ga0163161_10032047 | Ga0163161_100320471 | 391 |
| 256 | 3300025919 | Ga0207657_10026864 | Ga0207657_100268642 | 391 |
| 257 | 3300025941 | Ga0207711_10005616 | Ga0207711_100056168 | 391 |
| 258 | 3300025942 | Ga0207689_10002130 | Ga0207689_100021308 | 391 |
| 259 | 3300025981 | Ga0207640_10088754 | Ga0207640_100887542 | 391 |
| 260 | 3300025986 | Ga0207658_10103211 | Ga0207658_101032112 | 391 |
| 261 | 3300026041 | Ga0207639_10094938 | Ga0207639_100949382 | 391 |
| 262 | 3300026067 | Ga0207678_10000497 | Ga0207678_1000049716 | 391 |
| 263 | 3300026116 | Ga0207674_10029689 | Ga0207674_100296896 | 391 |
| 264 | 3300026118 | Ga0207675_100000926 | Ga0207675_10000092626 | 391 |
| 265 | 3300026142 | Ga0207698_10059749 | Ga0207698_100597492 | 391 |
| 266 | 3300035691 | Ga0373931_0006912 | Ga0373931_0006912_2198_3415 | 391 |
| 267 | 3300037312 | Ga0395899_0008100 | Ga0395899_0008100_1973_3184 | 391 |
| 268 | 3300037466 | Ga0395898_0043891 | Ga0395898_0043891_497_1708 | 391 |
| 269 | 3300046474 | Ga0495605_0006921 | Ga0495605_0006921_2935_4122 | 391 |
| 270 | 3300046492 | Ga0495585_0008730 | Ga0495585_0008730_4426_5613 | 391 |
| 271 | 3300046506 | Ga0495583_0029329 | Ga0495583_0029329_203_1390 | 391 |
| 272 | 3300046515 | Ga0495620_0027151 | Ga0495620_0027151_512_1699 | 391 |
| 273 | 3300046518 | Ga0495631_0001207 | Ga0495631_0001207_6298_7485 | 391 |
| 274 | 3300046519 | Ga0495632_0006023 | Ga0495632_0006023_5830_7017 | 391 |
| 275 | 3300046524 | Ga0495648_0090617 | Ga0495648_0090617_213_1400 | 391 |
| 276 | 3300046538 | Ga0495609_0019502 | Ga0495609_0019502_1046_2233 | 391 |
| 277 | 3300046616 | Ga0495668_0008800 | Ga0495668_0008800_2587_3774 | 391 |
| 278 | 3300046660 | Ga0495625_0000467 | Ga0495625_0000467_15385_16572 | 391 |
| 279 | 3300046810 | Ga0495660_0003780 | Ga0495660_0003780_2514_3701 | 391 |
| 280 | 3300048904 | Ga0496101_0084325 | Ga0496101_0084325_693_1910 | 391 |
| 281 | 3300048905 | Ga0496102_0178839 | Ga0496102_0178839_276_1502 | 391 |
| 282 | 3300048907 | Ga0496104_0055042 | Ga0496104_0055042_977_2203 | 391 |
| 283 | 3300048910 | Ga0496107_0120045 | Ga0496107_0120045_173_1390 | 391 |
| 284 | 3300048913 | Ga0496110_0089697 | Ga0496110_0089697_441_1658 | 391 |
| 285 | 3300048914 | Ga0496111_0006204 | Ga0496111_0006204_5848_7065 | 391 |
| 286 | 3300048916 | Ga0496113_0037116 | Ga0496113_0037116_307_1536 | 391 |
| 287 | 3300048917 | Ga0496114_0010521 | Ga0496114_0010521_6022_7239 | 391 |
| 288 | 3300048918 | Ga0496115_0027875 | Ga0496115_0027875_1834_3051 | 391 |
| 289 | 3300053087 | Ga0500643_012946 | Ga0500643_012946_1094_2281 | 391 |
| 290 | 3300053105 | Ga0500557_000622 | Ga0500557_000622_2323_3510 | 391 |
| 291 | iso_pu_bacteria | 2808606394 | 2809028414 | 391 |
| 292 | iso_pu_bacteria | 2901300506 | 2901310261 | 391 |
| 293 | iso_pu_bacteria | 2917832318 | 2917834980 | 391 |
| 294 | iso_pu_bacteria | 2996336353 | 2996341660 | 391 |
| 295 | 3300003187 | JGI25151J46595_10002410 | JGI25151J46595_100024102 | 392 |
| 296 | 3300003773 | Ga0055537_1001551 | Ga0055537_10015515 | 392 |
| 297 | 3300003775 | Ga0055524_1005163 | Ga0055524_10051635 | 392 |
| 298 | 3300003784 | Ga0055534_1000757 | Ga0055534_100075710 | 392 |
| 299 | 3300005335 | Ga0070666_10003380 | Ga0070666_100033809 | 392 |
| 300 | 3300025263 | Ga0209565_1000927 | Ga0209565_10009275 | 392 |
| 301 | 3300025273 | Ga0209673_1010110 | Ga0209673_10101102 | 392 |
| 302 | 3300025291 | Ga0209675_1001223 | Ga0209675_100122311 | 392 |
| 303 | 3300025294 | Ga0209025_1010155 | Ga0209025_10101552 | 392 |
| 304 | 3300025295 | Ga0209564_1002915 | Ga0209564_10029153 | 392 |
| 305 | 3300025299 | Ga0209256_1003207 | Ga0209256_100320710 | 392 |
| 306 | 3300025903 | Ga0207680_10007805 | Ga0207680_100078055 | 392 |
| 307 | 3300025949 | Ga0207667_10027384 | Ga0207667_100273843 | 392 |
| 308 | 3300049572 | Ga0501036_0015891 | Ga0501036_0015891_2242_3435 | 392 |
| 309 | 3300049577 | Ga0501041_0018662 | Ga0501041_0018662_1996_3189 | 392 |
| 310 | 3300049582 | Ga0501048_0011807 | Ga0501048_0011807_1621_2814 | 392 |
| 311 | 3300049587 | Ga0501071_0061432 | Ga0501071_0061432_860_2053 | 392 |
| 312 | 3300049590 | Ga0501074_0086448 | Ga0501074_0086448_527_1720 | 392 |
| 313 | 3300049591 | Ga0501075_0001541 | Ga0501075_0001541_3419_4612 | 392 |
| 314 | 3300049592 | Ga0501076_0027248 | Ga0501076_0027248_1571_2764 | 392 |
| 315 | 3300049593 | Ga0501077_0002332 | Ga0501077_0002332_3053_4246 | 392 |
| 316 | 3300049741 | Ga0501079_0078499 | Ga0501079_0078499_229_1422 | 392 |
| 317 | 3300049743 | Ga0501081_0003181 | Ga0501081_0003181_6569_7762 | 392 |
| 318 | 3300049744 | Ga0501083_0019946 | Ga0501083_0019946_1351_2544 | 392 |
| 319 | 3300049824 | Ga0501045_0081109 | Ga0501045_0081109_962_2155 | 392 |
| 320 | 3300050510 | nmdc:mga06r32_218654_c1 | nmdc:mga06r32_218654_c1_227_1450 | 392 |
| 321 | 3300054114 | Ga0501084_0009931 | Ga0501084_0009931_5965_7158 | 392 |
| 322 | 3300060353 | Ga0501082_0049319 | Ga0501082_0049319_1884_3077 | 392 |
| 323 | 3300061734 | Ga0530510_0025237 | Ga0530510_0025237_1760_2953 | 392 |
| 324 | iso_pu_bacteria | 2852649853 | 2852650756 | 392 |
| 325 | iso_pu_bacteria | 2904530477 | 2904530939 | 392 |
| 326 | 3300003214 | JGI25165J46597_1000025 | JGI25165J46597_1000025106 | 393 |
| 327 | 3300005327 | Ga0070658_10062054 | Ga0070658_100620542 | 393 |
| 328 | 3300005329 | Ga0070683_100045202 | Ga0070683_1000452023 | 393 |
| 329 | 3300005334 | Ga0068869_100025276 | Ga0068869_1000252762 | 393 |
| 330 | 3300005339 | Ga0070660_100037868 | Ga0070660_1000378682 | 393 |
| 331 | 3300005339 | Ga0070660_100086070 | Ga0070660_1000860701 | 393 |
| 332 | 3300005355 | Ga0070671_100237620 | Ga0070671_1002376201 | 393 |
| 333 | 3300005535 | Ga0070684_100041117 | Ga0070684_1000411173 | 393 |
| 334 | 3300005539 | Ga0068853_100028407 | Ga0068853_1000284073 | 393 |
| 335 | 3300005564 | Ga0070664_100010718 | Ga0070664_1000107183 | 393 |
| 336 | 3300005577 | Ga0068857_100010070 | Ga0068857_1000100704 | 393 |
| 337 | 3300005578 | Ga0068854_100035802 | Ga0068854_1000358023 | 393 |
| 338 | 3300005834 | Ga0068851_10029602 | Ga0068851_100296023 | 393 |
| 339 | 3300006028 | Ga0070717_10173763 | Ga0070717_101737632 | 393 |
| 340 | 3300006051 | Ga0075364_10000241 | Ga0075364_1000024110 | 393 |
| 341 | 3300006051 | Ga0075364_10019578 | Ga0075364_100195782 | 393 |
| 342 | 3300006175 | Ga0070712_100009916 | Ga0070712_1000099163 | 393 |
| 343 | 3300009177 | Ga0105248_10012680 | Ga0105248_100126809 | 393 |
| 344 | 3300009551 | Ga0105238_10007494 | Ga0105238_100074947 | 393 |
| 345 | 3300010375 | Ga0105239_10202282 | Ga0105239_102022822 | 393 |
| 346 | 3300013102 | Ga0157371_10051085 | Ga0157371_100510852 | 393 |
| 347 | 3300013105 | Ga0157369_10008661 | Ga0157369_1000866111 | 393 |
| 348 | 3300013307 | Ga0157372_10004459 | Ga0157372_1000445910 | 393 |
| 349 | 3300025261 | Ga0209233_1000053 | Ga0209233_1000053275 | 393 |
| 350 | 3300025321 | Ga0207656_10019146 | Ga0207656_100191462 | 393 |
| 351 | 3300025915 | Ga0207693_10035719 | Ga0207693_100357193 | 393 |
| 352 | 3300025919 | Ga0207657_10023220 | Ga0207657_100232202 | 393 |
| 353 | 3300025919 | Ga0207657_10037213 | Ga0207657_100372133 | 393 |
| 354 | 3300026041 | Ga0207639_10071657 | Ga0207639_100716572 | 393 |
| 355 | 3300026116 | Ga0207674_10015373 | Ga0207674_100153737 | 393 |
| 356 | 3300026142 | Ga0207698_10015729 | Ga0207698_100157293 | 393 |
| 357 | 3300031901 | Ga0307406_10053404 | Ga0307406_100534041 | 393 |
| 358 | 3300046460 | Ga0495638_0023560 | Ga0495638_0023560_2697_3962 | 393 |
| 359 | 3300048928 | Ga0496125_0005203 | Ga0496125_0005203_6469_7680 | 393 |
| 360 | 3300048929 | Ga0496126_0065314 | Ga0496126_0065314_298_1509 | 393 |
| 361 | 3300048929 | Ga0496126_0202149 | Ga0496126_0202149_93_1319 | 393 |
| 362 | 3300049573 | Ga0501037_0194924 | Ga0501037_0194924_24_1226 | 393 |
| 363 | 3300049574 | Ga0501038_0000014 | Ga0501038_0000014_26120_27334 | 393 |
| 364 | 3300049579 | Ga0501043_0200714 | Ga0501043_0200714_206_1396 | 393 |
| 365 | 3300049742 | Ga0501080_0060269 | Ga0501080_0060269_1519_2709 | 393 |
| 366 | 3300049822 | Ga0501035_0246860 | Ga0501035_0246860_154_1344 | 393 |
| 367 | 3300050491 | nmdc:mga00v17_141_c1 | nmdc:mga00v17_141_c1_14992_16188 | 393 |
| 368 | iso_pu_bacteria | 2551306416 | 2553007691 | 393 |
| 369 | iso_pu_bacteria | 2574179768 | 2574430001 | 393 |
| 370 | iso_pu_bacteria | 2721755763 | 2723876514 | 393 |
| 371 | iso_pu_bacteria | 2739367655 | 2739612542 | 393 |
| 372 | iso_pu_bacteria | 2881412998 | 2881415395 | 393 |
| 373 | iso_pu_bacteria | 2923510766 | 2923515795 | 393 |
| 374 | 3300003322 | rootL2_10162752 | rootL2_101627522 | 394 |
| 375 | 3300005344 | Ga0070661_100055803 | Ga0070661_1000558032 | 394 |
| 376 | 3300005353 | Ga0070669_100015207 | Ga0070669_1000152076 | 394 |
| 377 | 3300005354 | Ga0070675_100015653 | Ga0070675_1000156537 | 394 |
| 378 | 3300005445 | Ga0070708_100093067 | Ga0070708_1000930674 | 394 |
| 379 | 3300005455 | Ga0070663_100030473 | Ga0070663_1000304732 | 394 |
| 380 | 3300005467 | Ga0070706_100000388 | Ga0070706_10000038857 | 394 |
| 381 | 3300005518 | Ga0070699_100073777 | Ga0070699_1000737773 | 394 |
| 382 | 3300005834 | Ga0068851_10020638 | Ga0068851_100206382 | 394 |
| 383 | 3300009147 | Ga0114129_10144150 | Ga0114129_101441502 | 394 |
| 384 | 3300010159 | Ga0099796_10000276 | Ga0099796_100002764 | 394 |
| 385 | 3300021388 | Ga0213875_10002319 | Ga0213875_1000231911 | 394 |
| 386 | 3300025901 | Ga0207688_10005778 | Ga0207688_100057782 | 394 |
| 387 | 3300025914 | Ga0207671_10031935 | Ga0207671_100319353 | 394 |
| 388 | 3300025923 | Ga0207681_10055000 | Ga0207681_100550002 | 394 |
| 389 | 3300025924 | Ga0207694_10119344 | Ga0207694_101193442 | 394 |
| 390 | 3300025933 | Ga0207706_10001109 | Ga0207706_100011092 | 394 |
| 391 | 3300025942 | Ga0207689_10000605 | Ga0207689_1000060513 | 394 |
| 392 | 3300025949 | Ga0207667_10179673 | Ga0207667_101796732 | 394 |
| 393 | 3300026078 | Ga0207702_10173163 | Ga0207702_101731632 | 394 |
| 394 | 3300037853 | Ga0436364_0616684 | Ga0436364_0616684_25503_26747 | 394 |
| 395 | 3300047673 | Ga0495593_0010951 | Ga0495593_0010951_59_1255 | 394 |
| 396 | 3300048922 | Ga0496119_0008959 | Ga0496119_0008959_4688_5929 | 394 |
| 397 | 3300048923 | Ga0496120_0067602 | Ga0496120_0067602_420_1661 | 394 |
| 398 | 3300048928 | Ga0496125_0058294 | Ga0496125_0058294_1522_2763 | 394 |
| 399 | 3300048929 | Ga0496126_0154946 | Ga0496126_0154946_401_1642 | 394 |
| 400 | 3300050507 | nmdc:mga05p37_40430_c1 | nmdc:mga05p37_40430_c1_3112_4431 | 394 |
| 401 | iso_pu_bacteria | 2554235132 | 2554814891 | 394 |
| 402 | iso_pu_bacteria | 2855730933 | 2855733387 | 394 |
| 403 | iso_pu_bacteria | 2855767633 | 2855772396 | 394 |
| 404 | iso_pu_bacteria | 2929160207 | 2929161039 | 394 |
| 405 | iso_pu_bacteria | 8045864390 | 8045865742 | 394 |
| 406 | 3300003187 | JGI25151J46595_10000131 | JGI25151J46595_1000013160 | 395 |
| 407 | 3300005468 | Ga0070707_100041939 | Ga0070707_1000419392 | 395 |
| 408 | 3300005471 | Ga0070698_100105052 | Ga0070698_1001050522 | 395 |
| 409 | 3300005518 | Ga0070699_100009784 | Ga0070699_1000097848 | 395 |
| 410 | 3300005536 | Ga0070697_100019344 | Ga0070697_1000193442 | 395 |
| 411 | 3300005578 | Ga0068854_100030944 | Ga0068854_1000309441 | 395 |
| 412 | 3300006942 | Ga0099824_1030680 | Ga0099824_10306802 | 395 |
| 413 | 3300006943 | Ga0099822_1003706 | Ga0099822_100370625 | 395 |
| 414 | 3300006948 | Ga0099826_10000039 | Ga0099826_1000003991 | 395 |
| 415 | 3300015261 | Ga0182006_1002448 | Ga0182006_10024481 | 395 |
| 416 | 3300025294 | Ga0209025_1000028 | Ga0209025_1000028376 | 395 |
| 417 | 3300025910 | Ga0207684_10010691 | Ga0207684_100106916 | 395 |
| 418 | 3300025913 | Ga0207695_10000573 | Ga0207695_100005739 | 395 |
| 419 | 3300025922 | Ga0207646_10016047 | Ga0207646_100160473 | 395 |
| 420 | 3300027357 | Ga0209589_1000015 | Ga0209589_1000015134 | 395 |
| 421 | 3300027361 | Ga0209489_100015 | Ga0209489_100015134 | 395 |
| 422 | 3300027363 | Ga0209700_100025 | Ga0209700_100025134 | 395 |
| 423 | 3300027666 | Ga0209282_1000058 | Ga0209282_100005891 | 395 |
| 424 | 3300030744 | Ga0316181_1070820 | Ga0316181_10708204 | 395 |
| 425 | 3300031911 | Ga0307412_10212565 | Ga0307412_102125651 | 395 |
| 426 | 3300041407 | Ga0439447_005618 | Ga0439447_005618_27_1232 | 395 |
| 427 | 3300042006 | Ga0439432_025387 | Ga0439432_025387_544_1749 | 395 |
| 428 | 3300042010 | Ga0439452_005096 | Ga0439452_005096_685_1890 | 395 |
| 429 | 3300042013 | Ga0439456_004556 | Ga0439456_004556_87_1292 | 395 |
| 430 | 3300042127 | Ga0450890_002362 | Ga0450890_002362_1075_2280 | 395 |
| 431 | 3300042146 | Ga0450907_001201 | Ga0450907_001201_3211_4416 | 395 |
| 432 | 3300042461 | Ga0439460_0011782 | Ga0439460_0011782_569_1774 | 395 |
| 433 | 3300046501 | Ga0495607_0023097 | Ga0495607_0023097_826_2037 | 395 |
| 434 | 3300046506 | Ga0495583_0017814 | Ga0495583_0017814_1766_2977 | 395 |
| 435 | 3300046520 | Ga0495637_0027844 | Ga0495637_0027844_338_1549 | 395 |
| 436 | 3300046524 | Ga0495648_0002842 | Ga0495648_0002842_12382_13593 | 395 |
| 437 | 3300046648 | Ga0495611_0002205 | Ga0495611_0002205_7658_8869 | 395 |
| 438 | 3300046664 | Ga0495659_0002637 | Ga0495659_0002637_880_2091 | 395 |
| 439 | 3300047320 | Ga0495672_0012359 | Ga0495672_0012359_1101_2312 | 395 |
| 440 | 3300049459 | Ga0495678_001890 | Ga0495678_001890_2056_3267 | 395 |
| 441 | 3300049460 | Ga0495682_0011136 | Ga0495682_0011136_2068_3279 | 395 |
| 442 | 3300049577 | Ga0501041_0100474 | Ga0501041_0100474_432_1670 | 395 |
| 443 | 3300049578 | Ga0501042_0088194 | Ga0501042_0088194_109_1341 | 395 |
| 444 | 3300049591 | Ga0501075_0094203 | Ga0501075_0094203_934_2166 | 395 |
| 445 | 3300049741 | Ga0501079_0015449 | Ga0501079_0015449_3522_4760 | 395 |
| 446 | 3300060353 | Ga0501082_0031019 | Ga0501082_0031019_3048_4286 | 395 |
| 447 | iso_pu_bacteria | 2521172590 | 2521557167 | 395 |
| 448 | iso_pu_bacteria | 2599185292 | 2599902387 | 395 |
| 449 | iso_pu_bacteria | 2643221594 | 2643979068 | 395 |
| 450 | iso_pu_bacteria | 2728369097 | 2729148161 | 395 |
| 451 | iso_pu_bacteria | 2808606395 | 2809036171 | 395 |
| 452 | iso_pu_bacteria | 2818991449 | 2819618676 | 395 |
| 453 | iso_pu_bacteria | 2858950400 | 2858954849 | 395 |
| 454 | iso_pu_bacteria | 2897561785 | 2897562650 | 395 |
| 455 | iso_pu_bacteria | 2904439833 | 2904440125 | 395 |
| 456 | iso_pu_bacteria | 2904584206 | 2904587428 | 395 |
| 457 | iso_pu_bacteria | 2904589729 | 2904592537 | 395 |
| 458 | iso_pu_bacteria | 2904601388 | 2904604672 | 395 |
| 459 | iso_pu_bacteria | 2919079590 | 2919082502 | 395 |
| 460 | iso_pu_bacteria | 2919704043 | 2919704118 | 395 |
| 461 | iso_pu_bacteria | 2923516293 | 2923517434 | 395 |
| 462 | iso_pu_bacteria | 8002869464 | 8002871195 | 395 |
| 463 | iso_pu_bacteria | 8056060235 | 8056061077 | 395 |
| 464 | 3300005445 | Ga0070708_100014220 | Ga0070708_1000142204 | 396 |
| 465 | 3300005467 | Ga0070706_100019315 | Ga0070706_1000193153 | 396 |
| 466 | 3300005841 | Ga0068863_100032733 | Ga0068863_1000327333 | 396 |
| 467 | 3300025910 | Ga0207684_10174831 | Ga0207684_101748312 | 396 |
| 468 | 3300037418 | Ga0395900_0006777 | Ga0395900_0006777_6809_8077 | 396 |
| 469 | 3300037466 | Ga0395898_0097958 | Ga0395898_0097958_1481_2749 | 396 |
| 470 | 3300037471 | Ga0395905_0013434 | Ga0395905_0013434_1042_2247 | 396 |
| 471 | 3300046526 | Ga0495666_0012358 | Ga0495666_0012358_473_1690 | 396 |
| 472 | 3300047317 | Ga0495604_0005176 | Ga0495604_0005176_8805_10022 | 396 |
| 473 | 3300049569 | Ga0501032_0028641 | Ga0501032_0028641_2475_3674 | 396 |
| 474 | 3300049570 | Ga0501033_0020588 | Ga0501033_0020588_1356_2579 | 396 |
| 475 | 3300049581 | Ga0501047_0050766 | Ga0501047_0050766_703_2016 | 396 |
| 476 | 3300049822 | Ga0501035_0037565 | Ga0501035_0037565_2704_3927 | 396 |
| 477 | 3300049823 | Ga0501044_0181990 | Ga0501044_0181990_136_1377 | 396 |
| 478 | iso_pu_bacteria | 2522572158 | 2523105525 | 396 |
| 479 | iso_pu_bacteria | 2891633521 | 2891637219 | 396 |
| 480 | iso_pu_bacteria | 2919476304 | 2919477959 | 396 |
| 481 | iso_pu_bacteria | 8002392321 | 8002392780 | 396 |
| 482 | 3300005563 | Ga0068855_100110310 | Ga0068855_1001103104 | 397 |
| 483 | 3300006051 | Ga0075364_10053825 | Ga0075364_100538252 | 397 |
| 484 | 3300006353 | Ga0075370_10069306 | Ga0075370_100693063 | 397 |
| 485 | 3300009545 | Ga0105237_10016183 | Ga0105237_100161834 | 397 |
| 486 | 3300025949 | Ga0207667_10091394 | Ga0207667_100913941 | 397 |
| 487 | 3300046528 | Ga0495642_0006479 | Ga0495642_0006479_1684_2904 | 397 |
| 488 | 3300046543 | Ga0495645_0036425 | Ga0495645_0036425_1177_2400 | 397 |
| 489 | 3300046684 | Ga0495669_0000012 | Ga0495669_0000012_106147_107367 | 397 |
| 490 | 3300049571 | Ga0501034_0001709 | Ga0501034_0001709_8950_10176 | 397 |
| 491 | 3300050493 | nmdc:mga0k408_41613_c1 | nmdc:mga0k408_41613_c1_303_1535 | 397 |
| 492 | 3300050496 | nmdc:mga07m45_13976_c1 | nmdc:mga07m45_13976_c1_853_2121 | 397 |
| 493 | 3300005327 | Ga0070658_10015681 | Ga0070658_100156815 | 398 |
| 494 | 3300006028 | Ga0070717_10011901 | Ga0070717_100119013 | 398 |
| 495 | 3300031235 | Ga0265330_10011296 | Ga0265330_100112962 | 398 |
| 496 | 3300031241 | Ga0265325_10013704 | Ga0265325_100137042 | 398 |
| 497 | 3300031249 | Ga0265339_10000425 | Ga0265339_1000042514 | 398 |
| 498 | 3300031595 | Ga0265313_10000107 | Ga0265313_1000010784 | 398 |
| 499 | 3300031711 | Ga0265314_10025974 | Ga0265314_100259743 | 398 |
| 500 | 3300038443 | Ga0395901_0000574 | Ga0395901_0000574_35788_37212 | 398 |
| 501 | 3300048929 | Ga0496126_0116288 | Ga0496126_0116288_139_1380 | 398 |
| 502 | 3300049572 | Ga0501036_0026779 | Ga0501036_0026779_3123_4355 | 398 |
| 503 | 3300049574 | Ga0501038_0024830 | Ga0501038_0024830_993_2225 | 398 |
| 504 | 3300049575 | Ga0501039_0004707 | Ga0501039_0004707_6888_8120 | 398 |
| 505 | 3300049576 | Ga0501040_0006648 | Ga0501040_0006648_4471_5703 | 398 |
| 506 | 3300049577 | Ga0501041_0000023 | Ga0501041_0000023_15892_17124 | 398 |
| 507 | 3300049578 | Ga0501042_0047504 | Ga0501042_0047504_1817_3049 | 398 |
| 508 | 3300049579 | Ga0501043_0045567 | Ga0501043_0045567_2120_3352 | 398 |
| 509 | 3300049580 | Ga0501046_0178819 | Ga0501046_0178819_337_1569 | 398 |
| 510 | 3300049581 | Ga0501047_0061826 | Ga0501047_0061826_1900_3120 | 398 |
| 511 | 3300049582 | Ga0501048_0001216 | Ga0501048_0001216_6699_7931 | 398 |
| 512 | 3300049584 | Ga0501068_0075082 | Ga0501068_0075082_317_1549 | 398 |
| 513 | 3300049586 | Ga0501070_0014599 | Ga0501070_0014599_3362_4582 | 398 |
| 514 | 3300049587 | Ga0501071_0000496 | Ga0501071_0000496_11946_13178 | 398 |
| 515 | 3300049588 | Ga0501072_0001424 | Ga0501072_0001424_213_1445 | 398 |
| 516 | 3300049590 | Ga0501074_0058718 | Ga0501074_0058718_942_2162 | 398 |
| 517 | 3300049590 | Ga0501074_0071397 | Ga0501074_0071397_787_2019 | 398 |
| 518 | 3300049593 | Ga0501077_0000714 | Ga0501077_0000714_1362_2594 | 398 |
| 519 | 3300049741 | Ga0501079_0000769 | Ga0501079_0000769_161_1393 | 398 |
| 520 | 3300049742 | Ga0501080_0005645 | Ga0501080_0005645_3164_4384 | 398 |
| 521 | 3300049743 | Ga0501081_0002294 | Ga0501081_0002294_337_1569 | 398 |
| 522 | 3300049744 | Ga0501083_0052403 | Ga0501083_0052403_593_1825 | 398 |
| 523 | 3300049823 | Ga0501044_0050216 | Ga0501044_0050216_1177_2397 | 398 |
| 524 | 3300049824 | Ga0501045_0000975 | Ga0501045_0000975_2005_3237 | 398 |
| 525 | 3300054114 | Ga0501084_0000739 | Ga0501084_0000739_7043_8275 | 398 |
| 526 | 3300060353 | Ga0501082_0000869 | Ga0501082_0000869_7488_8720 | 398 |
| 527 | 3300061734 | Ga0530510_0000323 | Ga0530510_0000323_6929_8161 | 398 |
| 528 | iso_pu_bacteria | 640427133 | 640488366 | 398 |
| 529 | iso_pu_bacteria | 651053060 | 651176401 | 398 |
| 530 | 3300015261 | Ga0182006_1000008 | Ga0182006_1000008259 | 399 |
| 531 | iso_pu_bacteria | 2834641062 | 2834644616 | 399 |
| 532 | iso_pu_bacteria | 2870068957 | 2870070409 | 399 |
| 533 | iso_pu_bacteria | 2904564687 | 2904569236 | 399 |
| 534 | iso_pu_bacteria | 2904571731 | 2904576456 | 399 |
| 535 | iso_pu_bacteria | 2928157003 | 2928161340 | 399 |
| 536 | iso_pu_bacteria | 2928163908 | 2928168170 | 399 |
| 537 | iso_pu_bacteria | 2928536128 | 2928541634 | 399 |
| 538 | iso_pu_bacteria | 8003400568 | 8003404324 | 399 |
| 539 | iso_pu_bacteria | 8020953355 | 8020959245 | 399 |
| 540 | iso_pu_bacteria | 8021120328 | 8021127229 | 399 |
| 541 | 3300025960 | Ga0207651_10000815 | Ga0207651_100008154 | 400 |
| 542 | iso_pu_bacteria | 2643221621 | 2644121294 | 400 |
| 543 | 2162886007 | SwRhRL2b_contig_2162838 | SwRhRL2b_0770.00006840 | 401 |
| 544 | 3300005289 | Ga0065704_10079600 | Ga0065704_100796002 | 401 |
| 545 | 3300005339 | Ga0070660_100000815 | Ga0070660_10000081518 | 401 |
| 546 | 3300005366 | Ga0070659_100000637 | Ga0070659_1000006376 | 401 |
| 547 | 3300005455 | Ga0070663_100000495 | Ga0070663_10000049517 | 401 |
| 548 | 3300005616 | Ga0068852_100090448 | Ga0068852_1000904483 | 401 |
| 549 | 3300006946 | Ga0079104_1001730 | Ga0079104_100173015 | 401 |
| 550 | 3300009092 | Ga0105250_10002148 | Ga0105250_100021483 | 401 |
| 551 | 3300009551 | Ga0105238_10011653 | Ga0105238_100116534 | 401 |
| 552 | 3300010375 | Ga0105239_10043880 | Ga0105239_100438806 | 401 |
| 553 | 3300015261 | Ga0182006_1038981 | Ga0182006_10389812 | 401 |
| 554 | 3300025273 | Ga0209673_1000443 | Ga0209673_100044313 | 401 |
| 555 | 3300025295 | Ga0209564_1004985 | Ga0209564_10049853 | 401 |
| 556 | 3300025711 | Ga0207696_1003576 | Ga0207696_10035762 | 401 |
| 557 | 3300025919 | Ga0207657_10000137 | Ga0207657_1000013713 | 401 |
| 558 | 3300025932 | Ga0207690_10000013 | Ga0207690_10000013236 | 401 |
| 559 | 3300026067 | Ga0207678_10000119 | Ga0207678_1000011912 | 401 |
| 560 | 3300027111 | Ga0209281_1001457 | Ga0209281_100145715 | 401 |
| 561 | 3300046692 | Ga0495671_0000066 | Ga0495671_0000066_60676_61920 | 401 |
| 562 | 3300048921 | Ga0496118_0148913 | Ga0496118_0148913_15_1226 | 401 |
| 563 | 3300048924 | Ga0496121_0008550 | Ga0496121_0008550_3627_4838 | 401 |
| 564 | iso_pu_bacteria | 2981990288 | 2981993279 | 401 |
| 565 | iso_pu_bacteria | 641736154 | 642415616 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tsa-assembly1.cif.gz_A | crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ | 0.3378 | 68 | 375 |
| 5tsa-assembly1.cif.gz_A | crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ | 0.3367 | 68 | 375 |
| 4yzf-assembly2.cif.gz_C | crystal structure of the anion exchanger domain of human erythrocyte band 3 | 0.3302 | 6 | 393 |
| 5iof-assembly1.cif.gz_A | structure of the transmembrane domain of the transporter slc26dg | 0.3253 | 4 | 400 |
| 5da0-assembly1.cif.gz_A | structure of the the slc26 transporter slc26dg in complex with a nanobody | 0.3238 | 4 | 397 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.3218 | 14 | 399 | 1.20.1740.10 |
| af_P76103_4_381_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.317 | 14 | 399 | 1.20.1740.10 |
| af_A0A1D6LTK4_165_459_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.293 | 54 | 357 | 1.20.1740.10 |
| af_A0A1D6LTK4_165_459_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.2822 | 54 | 357 | 1.20.1740.10 |
| af_Q4E277_72_471_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.2742 | 14 | 401 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6F8QPN4-F1-model_v4 | Chromate transporter | 0.9964 | 56 | 401 |
GO:0005886
GO:0015109 |
| AF-A0A2S9GSM2-F1-model_v4 | 2A51: chromate transporter, chromate ion transporter (CHR) family | 0.9942 | 10 | 397 |
GO:0005886
GO:0015109 |
| AF-A0A5E6T2R0-F1-model_v4 | Chromate transport protein | 0.9925 | 6 | 401 |
GO:0005886
GO:0015109 |
| AF-A0A387K1P2-F1-model_v4 | Chromate ion transporter | 0.9911 | 100 | 401 |
GO:0005886
GO:0015109 |
| AF-A0A6F8QPN4-F1-model_v4 | Chromate transporter | 0.9906 | 56 | 401 |
GO:0005886
GO:0015109 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar