F464291

General Info

Members Datasets Scaffolds Average Seq Length
565 373 490 400

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0000574|Ga0395901_0000574_35788_37212
Length 474
Sequence LAGRLFGDFFGCRNLVYFGLEIAASKLCNYYVATKKGLACSPKSVPKQLNRQERNKSMDQPQQTELNQGIKPRSPEAHVTVPHGSAGEVFFAFLKLGVTSFGGPIAHLAYFRTEFVERRRWLDDKSFSDLVALCQFLPGPASSQVGMALGLGRAGWLGALAAWLAFTLPSAIVLILFAFGVAHWAALSQSGAVHGLKVVAVAVVAQAVWGMAKSLCPDRPRAGIAIGAALLVLALPSAAGQILAIAAGGVIGRWGLELKHLPAARHRDYGISKTTGAIALLLFVALLGALPAIAAASHSTWLSAIAVFYKAGALVFGGGHVVLPLLQSGVVPNGWVGNDAFLAGYGAAQAVPGPLFTFAAYLGAVMPSPLGGWTGGLALLVAIFAPAFLLVAGALPFWESLRQRDSVQRAMAGINAAVVGVLAAALYDPVWTSAIHSRADFGLALAAFGLLVHGRLSPFIVVVLAALAGWAMAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
6 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
7 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
8 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
9 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
10 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
11 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
12 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
13 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
14 2643221594 Achromobacter sp. Root170 Isolate Unclassified
15 2643221621 Achromobacter sp. Root83 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
18 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
19 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
20 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
21 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
22 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
23 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
24 2808606394 Promicromonospora sp. C35 Isolate Unclassified
25 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
26 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
27 2818991452 Burkholderia cepacia 561 Isolate Unclassified
28 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
29 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
30 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
31 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
32 2855730933 Achromobacter sp. HZ28 Isolate Nodule
33 2855767633 Achromobacter sp. HZ34 Isolate Nodule
34 2858950400 Achromobacter sp. K91 Isolate Unclassified
35 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
36 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
37 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
38 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
39 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
40 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
41 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
42 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
43 2904564687 Burkholderia sp. 571 Isolate Unclassified
44 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
45 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
46 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
47 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
48 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
49 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
50 2919476304 Duganella sp. 3397 Isolate Unclassified
51 2919675420 Luteimonas terrae 4099 Isolate Unclassified
52 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
53 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
54 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
55 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
56 2928163908 Burkholderia sp. 567 Isolate Unclassified
57 2928536128 Burkholderia sola 565 Isolate Unclassified
58 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
59 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
60 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
61 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
62 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
63 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
64 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
65 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
66 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
67 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
68 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
69 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
70 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
71 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
72 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
75 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
78 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
93 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
94 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
100 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
101 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
102 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
106 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
107 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
108 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
109 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
110 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
111 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
120 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
121 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
122 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
125 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
126 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
135 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
159 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
160 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
161 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
162 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
168 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
169 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
173 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
212 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
235 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
236 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
237 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
241 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
242 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
243 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
262 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
265 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
279 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
280 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
299 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
300 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
305 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
310 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
311 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
364 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
365 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
366 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
367 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
368 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
369 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
370 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
371 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
372 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
373 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.73
Metatranscriptomes 0
Isolates 13.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 10.27
Nodule 2.48
Rhizoplane 3.72
Rhizosphere 70.62
Stem 0
Stem Tuber 0
Unclassified 12.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2162838 2162886007 Bacteria 2840
2 SwRhRL2b_contig_2682132 2162886007 Bacteria 1432
3 JGI25151J46595_10000131 3300003187 Bacteria 100435
4 JGI25151J46595_10002410 3300003187 Bacteria 11285
5 JGI25151J46595_10040096 3300003187 Bacteria 1720
6 JGI25165J46597_1000025 3300003214 Bacteria 333075
7 rootL2_10162752 3300003322 Bacteria 1620
8 Ga0055538_1000013 3300003751 Bacteria 348596
9 Ga0055539_1000018 3300003752 Bacteria 348596
10 Ga0055533_1000022 3300003756 Bacteria 348596
11 Ga0055525_1000024 3300003759 Bacteria 348596
12 Ga0055526_1001612 3300003771 Bacteria 15841
13 Ga0055526_1004498 3300003771 Bacteria 8351
14 Ga0055537_1001551 3300003773 Bacteria 8774
15 Ga0055524_1005163 3300003775 Bacteria 5888
16 Ga0055536_1000090 3300003781 Bacteria 77889
17 Ga0055534_1000757 3300003784 Bacteria 15353
18 Ga0055534_1002351 3300003784 Bacteria 6602
19 Ga0055541_1000013 3300003841 Bacteria 348596
20 Ga0065165_1000001 3300005262 Bacteria 494087
21 Ga0065704_10079600 3300005289 Bacteria 4117
22 Ga0065704_10087137 3300005289 Bacteria 3052
23 Ga0070658_10015681 3300005327 Bacteria 6060
24 Ga0070658_10062054 3300005327 Bacteria 3046
25 Ga0070683_100045202 3300005329 Bacteria 4064
26 Ga0068869_100005371 3300005334 Bacteria 8052
27 Ga0068869_100025276 3300005334 Bacteria 4122
28 Ga0070666_10003380 3300005335 Bacteria 9673
29 Ga0068868_100010295 3300005338 Bacteria 6764
30 Ga0070660_100000815 3300005339 Bacteria 20688
31 Ga0070660_100023074 3300005339 Bacteria 4607
32 Ga0070660_100037868 3300005339 Bacteria 3657
33 Ga0070660_100055494 3300005339 Bacteria 3061
34 Ga0070660_100086070 3300005339 Bacteria 2472
35 Ga0070689_100174084 3300005340 Bacteria 1745
36 Ga0070661_100055803 3300005344 Bacteria 2892
37 Ga0070669_100015207 3300005353 Bacteria 5481
38 Ga0070675_100015653 3300005354 Bacteria 6002
39 Ga0070671_100237620 3300005355 Bacteria 1547
40 Ga0070659_100000637 3300005366 Bacteria 25696
41 Ga0070659_100057220 3300005366 Bacteria 3074
42 Ga0070667_100097347 3300005367 Bacteria 2538
43 Ga0070701_10008112 3300005438 Bacteria 4523
44 Ga0070708_100014220 3300005445 Bacteria 6540
45 Ga0070708_100093067 3300005445 Bacteria 2747
46 Ga0070663_100000495 3300005455 Bacteria 20806
47 Ga0070663_100030473 3300005455 Bacteria 3697
48 Ga0070662_100000752 3300005457 Bacteria 19873
49 Ga0070681_10178706 3300005458 Bacteria 2044
50 Ga0070681_10230619 3300005458 Bacteria 1766
51 Ga0070706_100000388 3300005467 Bacteria 52771
52 Ga0070706_100019315 3300005467 Bacteria 6285
53 Ga0070707_100041939 3300005468 Bacteria 4381
54 Ga0070698_100105052 3300005471 Bacteria 2794
55 Ga0070698_100187403 3300005471 Bacteria 2007
56 Ga0070699_100009784 3300005518 Bacteria 8294
57 Ga0070699_100073777 3300005518 Bacteria 2969
58 Ga0070679_100175752 3300005530 Bacteria 2114
59 Ga0070684_100041117 3300005535 Bacteria 3984
60 Ga0070697_100019344 3300005536 Bacteria 5378
61 Ga0070697_100196088 3300005536 Bacteria 1715
62 Ga0068853_100003918 3300005539 Bacteria 11422
63 Ga0068853_100028407 3300005539 Bacteria 4704
64 Ga0070696_100058155 3300005546 Bacteria 2700
65 Ga0070696_100159510 3300005546 Bacteria 1661
66 Ga0070693_100052321 3300005547 Bacteria 2341
67 Ga0070704_100028751 3300005549 Bacteria 3702
68 Ga0068855_100025742 3300005563 Bacteria 7035
69 Ga0068855_100110310 3300005563 Bacteria 3159
70 Ga0068855_100171029 3300005563 Bacteria 2461
71 Ga0070664_100010718 3300005564 Bacteria 7433
72 Ga0068857_100007527 3300005577 Bacteria 9369
73 Ga0068857_100010070 3300005577 Bacteria 8214
74 Ga0068854_100030944 3300005578 Bacteria 3716
75 Ga0068854_100035802 3300005578 Bacteria 3476
76 Ga0068854_100167848 3300005578 Bacteria 1705
77 Ga0068852_100022802 3300005616 Bacteria 5027
78 Ga0068852_100045127 3300005616 Bacteria 3747
79 Ga0068852_100090448 3300005616 Bacteria 2737
80 Ga0068859_100006569 3300005617 Bacteria 11802
81 Ga0068864_100008900 3300005618 Bacteria 8275
82 Ga0068861_100001850 3300005719 Bacteria 13615
83 Ga0068851_10020638 3300005834 Bacteria 3192
84 Ga0068851_10029602 3300005834 Bacteria 2712
85 Ga0068863_100032733 3300005841 Bacteria 4953
86 Ga0068858_100034057 3300005842 Bacteria 4725
87 Ga0068860_100156728 3300005843 Bacteria 2195
88 Ga0068862_100043338 3300005844 Bacteria 3836
89 Ga0068862_100080957 3300005844 Bacteria 2817
90 Ga0070717_10011901 3300006028 Bacteria 6621
91 Ga0070717_10173763 3300006028 Bacteria 1875
92 Ga0075364_10000241 3300006051 Bacteria 26213
93 Ga0075364_10019578 3300006051 Bacteria 4248
94 Ga0075364_10053825 3300006051 Bacteria 2631
95 Ga0070716_100083546 3300006173 Bacteria 1913
96 Ga0070712_100009916 3300006175 Bacteria 6005
97 Ga0097621_100007843 3300006237 Bacteria 7656
98 Ga0075370_10069306 3300006353 Bacteria 2015
99 Ga0068871_100027451 3300006358 Bacteria 4453
100 Ga0075428_100097502 3300006844 Bacteria 3205
101 Ga0075428_100098601 3300006844 Bacteria 3186
102 Ga0075431_100000746 3300006847 Bacteria 28089
103 Ga0075429_100089055 3300006880 Bacteria 2690
104 Ga0097620_100006569 3300006931 Bacteria 11802
105 Ga0099824_1030680 3300006942 Bacteria 2128
106 Ga0099822_1003706 3300006943 Bacteria 19688
107 Ga0079104_1001730 3300006946 Bacteria 13875
108 Ga0079104_1007105 3300006946 Bacteria 4117
109 Ga0099826_10000039 3300006948 Bacteria 99286
110 Ga0105250_10002148 3300009092 Bacteria 10119
111 Ga0111539_10020521 3300009094 Bacteria 8137
112 Ga0114129_10001070 3300009147 Bacteria 35994
113 Ga0114129_10100051 3300009147 Bacteria 4012
114 Ga0114129_10144150 3300009147 Bacteria 3263
115 Ga0105248_10004400 3300009177 Bacteria 15593
116 Ga0105248_10005940 3300009177 Bacteria 13414
117 Ga0105248_10012680 3300009177 Bacteria 9300
118 Ga0105237_10016183 3300009545 Bacteria 7756
119 Ga0105237_10036428 3300009545 Bacteria 4979
120 Ga0105238_10007494 3300009551 Bacteria 10932
121 Ga0105238_10011653 3300009551 Bacteria 8859
122 Ga0105238_10012510 3300009551 Bacteria 8561
123 Ga0105238_10052632 3300009551 Bacteria 4093
124 Ga0105238_10074902 3300009551 Bacteria 3377
125 Ga0099796_10000276 3300010159 Bacteria 8117
126 Ga0099796_10015184 3300010159 Bacteria 2245
127 Ga0105239_10013790 3300010375 Bacteria 8970
128 Ga0105239_10043880 3300010375 Bacteria 4903
129 Ga0105239_10202282 3300010375 Bacteria 2225
130 Ga0157347_1000034 3300012502 Bacteria 5131
131 Ga0157371_10001514 3300013102 Bacteria 24008
132 Ga0157371_10051085 3300013102 Bacteria 2938
133 Ga0157369_10008661 3300013105 Bacteria 11666
134 Ga0157374_10009759 3300013296 Bacteria 8242
135 Ga0157378_10020686 3300013297 Bacteria 5788
136 Ga0157372_10004459 3300013307 Bacteria 14933
137 Ga0157372_10153648 3300013307 Bacteria 2658
138 Ga0157372_10154140 3300013307 Bacteria 2653
139 Ga0157375_10047478 3300013308 Bacteria 4194
140 Ga0163163_10049178 3300014325 Bacteria 4148
141 Ga0157379_10004214 3300014968 Bacteria 12278
142 Ga0157376_10006746 3300014969 Bacteria 8127
143 Ga0182006_1000008 3300015261 Bacteria 449652
144 Ga0182006_1002448 3300015261 Bacteria 10147
145 Ga0182006_1038981 3300015261 Bacteria 1877
146 Ga0182005_1000008 3300015265 Bacteria 471394
147 Ga0183362_10001 3300015683 Bacteria 2046624
148 Ga0163161_10032047 3300017792 Bacteria 3750
149 Ga0213872_10005211 3300021361 Bacteria 6725
150 Ga0213875_10002319 3300021388 Bacteria 11514
151 Ga0209784_100005 3300025224 Bacteria 1040422
152 Ga0209566_100005 3300025225 Bacteria 1040422
153 Ga0209674_100009 3300025226 Bacteria 1040422
154 Ga0209563_100012 3300025230 Bacteria 1040422
155 Ga0209677_100006 3300025253 Bacteria 1040422
156 Ga0209233_1000053 3300025261 Bacteria 444909
157 Ga0209565_1000927 3300025263 Bacteria 15517
158 Ga0209565_1003320 3300025263 Bacteria 5268
159 Ga0209673_1000443 3300025273 Bacteria 71250
160 Ga0209673_1010110 3300025273 Bacteria 4008
161 Ga0209675_1000291 3300025291 Bacteria 46848
162 Ga0209675_1001223 3300025291 Bacteria 15517
163 Ga0209675_1002115 3300025291 Bacteria 10517
164 Ga0209676_1000059 3300025292 Bacteria 344882
165 Ga0209025_1000028 3300025294 Bacteria 490678
166 Ga0209025_1000879 3300025294 Bacteria 47123
167 Ga0209025_1002965 3300025294 Bacteria 16857
168 Ga0209025_1010155 3300025294 Bacteria 6423
169 Ga0209564_1000623 3300025295 Bacteria 53919
170 Ga0209564_1002245 3300025295 Bacteria 15893
171 Ga0209564_1002915 3300025295 Bacteria 12446
172 Ga0209564_1004985 3300025295 Bacteria 7816
173 Ga0209256_1000661 3300025299 Bacteria 46620
174 Ga0209256_1003207 3300025299 Bacteria 11817
175 Ga0207656_10019146 3300025321 Bacteria 2705
176 Ga0207696_1003576 3300025711 Bacteria 7019
177 Ga0207688_10005778 3300025901 Bacteria 6735
178 Ga0207680_10007805 3300025903 Bacteria 5229
179 Ga0207684_10010691 3300025910 Bacteria 8061
180 Ga0207684_10174831 3300025910 Bacteria 1851
181 Ga0207707_10126088 3300025912 Bacteria 2239
182 Ga0207695_10000573 3300025913 Bacteria 75332
183 Ga0207671_10031935 3300025914 Bacteria 3921
184 Ga0207693_10006671 3300025915 Bacteria 9536
185 Ga0207693_10035719 3300025915 Bacteria 3918
186 Ga0207657_10000137 3300025919 Bacteria 74712
187 Ga0207657_10003404 3300025919 Bacteria 16996
188 Ga0207657_10023220 3300025919 Bacteria 5781
189 Ga0207657_10026864 3300025919 Bacteria 5280
190 Ga0207657_10037213 3300025919 Bacteria 4348
191 Ga0207652_10101333 3300025921 Bacteria 2543
192 Ga0207652_10137820 3300025921 Bacteria 2180
193 Ga0207646_10016047 3300025922 Bacteria 7039
194 Ga0207681_10055000 3300025923 Bacteria 2709
195 Ga0207694_10119344 3300025924 Bacteria 2104
196 Ga0207690_10000013 3300025932 Bacteria 266156
197 Ga0207706_10001109 3300025933 Bacteria 27405
198 Ga0207711_10005616 3300025941 Bacteria 10604
199 Ga0207689_10000605 3300025942 Bacteria 34379
200 Ga0207689_10002130 3300025942 Bacteria 18622
201 Ga0207679_10149315 3300025945 Bacteria 1900
202 Ga0207667_10023248 3300025949 Bacteria 6825
203 Ga0207667_10027384 3300025949 Bacteria 6205
204 Ga0207667_10091394 3300025949 Bacteria 3144
205 Ga0207667_10179673 3300025949 Bacteria 2173
206 Ga0207651_10000815 3300025960 Bacteria 13452
207 Ga0207640_10088754 3300025981 Bacteria 2135
208 Ga0207658_10103211 3300025986 Bacteria 2238
209 Ga0207677_10002600 3300026023 Bacteria 9491
210 Ga0207639_10071657 3300026041 Bacteria 2711
211 Ga0207639_10094938 3300026041 Bacteria 2395
212 Ga0207678_10000119 3300026067 Bacteria 65478
213 Ga0207678_10000497 3300026067 Bacteria 35757
214 Ga0207702_10173163 3300026078 Bacteria 1981
215 Ga0207648_10066129 3300026089 Bacteria 3153
216 Ga0207676_10011899 3300026095 Bacteria 6225
217 Ga0207674_10004838 3300026116 Bacteria 16125
218 Ga0207674_10015373 3300026116 Bacteria 8409
219 Ga0207674_10028948 3300026116 Bacteria 5839
220 Ga0207674_10029689 3300026116 Bacteria 5754
221 Ga0207675_100000926 3300026118 Bacteria 29286
222 Ga0207698_10015729 3300026142 Bacteria 5078
223 Ga0207698_10059749 3300026142 Bacteria 2961
224 Ga0209281_1001457 3300027111 Bacteria 13898
225 Ga0209589_1000015 3300027357 Bacteria 225913
226 Ga0209489_100015 3300027361 Bacteria 225913
227 Ga0209700_100025 3300027363 Bacteria 225913
228 Ga0209282_1000058 3300027666 Bacteria 99152
229 Ga0316181_1070820 3300030744 Bacteria 2748
230 Ga0265330_10011296 3300031235 Bacteria 4194
231 Ga0265320_10002374 3300031240 Bacteria 13161
232 Ga0265325_10004104 3300031241 Bacteria 9278
233 Ga0265325_10013704 3300031241 Bacteria 4604
234 Ga0265339_10000425 3300031249 Bacteria 33388
235 Ga0265316_10136146 3300031344 Bacteria 1848
236 Ga0307408_100028832 3300031548 Bacteria 3839
237 Ga0265313_10000107 3300031595 Bacteria 83816
238 Ga0265314_10025974 3300031711 Bacteria 4408
239 Ga0307516_10001128 3300031730 Bacteria 37196
240 Ga0307406_10022582 3300031901 Bacteria 3734
241 Ga0307406_10053404 3300031901 Bacteria 2574
242 Ga0307412_10212565 3300031911 Bacteria 1477
243 Ga0316215_1001466 3300033544 Bacteria 2272
244 Ga0373931_0006912 3300035691 Bacteria 5338
245 Ga0373925_0077596 3300037068 Bacteria 2522
246 Ga0395899_0008100 3300037312 Bacteria 8092
247 Ga0395900_0006777 3300037418 Bacteria 11891
248 Ga0395900_0079503 3300037418 Bacteria 3370
249 Ga0395898_0043891 3300037466 Bacteria 4404
250 Ga0395898_0097958 3300037466 Bacteria 2816
251 Ga0395905_0000353 3300037471 Bacteria 65228
252 Ga0395905_0013434 3300037471 Bacteria 7846
253 Ga0395905_0068361 3300037471 Bacteria 3327
254 Ga0436364_0616684 3300037853 Bacteria 34041
255 Ga0395901_0000574 3300038443 Bacteria 42766
256 Ga0395901_0205259 3300038443 Bacteria 2065
257 Ga0436361_0439571 3300039447 Bacteria 4790
258 Ga0436361_1211686 3300039447 Bacteria 8622
259 Ga0439447_000627 3300041407 Bacteria 13144
260 Ga0439447_005618 3300041407 Bacteria 4151
261 Ga0451793_1587026 3300041452 Bacteria 1598
262 Ga0451797_1457614 3300041453 Bacteria 3551
263 Ga0439432_023781 3300042006 Bacteria 2016
264 Ga0439432_025387 3300042006 Bacteria 1944
265 Ga0439452_005096 3300042010 Bacteria 4284
266 Ga0439456_004556 3300042013 Bacteria 2802
267 Ga0439463_011493 3300042016 Bacteria 2174
268 Ga0450890_002362 3300042127 Bacteria 2603
269 Ga0450907_001201 3300042146 Bacteria 5860
270 Ga0439460_0011782 3300042461 Bacteria 2259
271 Ga0451577_0021805 3300042876 Bacteria 5858
272 Ga0451577_0065911 3300042876 Bacteria 3229
273 Ga0466961_0011072 3300044693 Bacteria 5765
274 Ga0466971_0023990 3300044719 Bacteria 2719
275 Ga0466957_0009939 3300044842 Bacteria 5443
276 Ga0466957_0095449 3300044842 Bacteria 1867
277 Ga0466957_0149432 3300044842 Bacteria 1510
278 Ga0466959_0102528 3300045049 Bacteria 2048
279 Ga0451576_0096489 3300045051 Bacteria 3075
280 Ga0466958_0000187 3300045836 Bacteria 22479
281 Ga0466958_0056301 3300045836 Bacteria 2388
282 Ga0466967_0021844 3300045976 Bacteria 5208
283 Ga0495638_0000145 3300046460 Bacteria 112275
284 Ga0495638_0023560 3300046460 Bacteria 4025
285 Ga0495605_0006921 3300046474 Bacteria 6478
286 Ga0495585_0008730 3300046492 Bacteria 6128
287 Ga0495596_0000738 3300046500 Bacteria 20164
288 Ga0495607_0008050 3300046501 Bacteria 7238
289 Ga0495607_0023097 3300046501 Bacteria 3896
290 Ga0495583_0017814 3300046506 Bacteria 3759
291 Ga0495583_0029329 3300046506 Bacteria 2693
292 Ga0495606_0004680 3300046507 Bacteria 13523
293 Ga0495608_0168422 3300046511 Bacteria 1390
294 Ga0495610_0002945 3300046512 Bacteria 13742
295 Ga0495618_0098689 3300046514 Bacteria 1869
296 Ga0495620_0027151 3300046515 Bacteria 2683
297 Ga0495631_0001207 3300046518 Bacteria 15935
298 Ga0495632_0006023 3300046519 Bacteria 7881
299 Ga0495637_0027844 3300046520 Bacteria 2525
300 Ga0495643_0034274 3300046522 Bacteria 2802
301 Ga0495648_0002842 3300046524 Bacteria 15591
302 Ga0495648_0090617 3300046524 Bacteria 1713
303 Ga0495666_0012358 3300046526 Bacteria 4256
304 Ga0495642_0006479 3300046528 Bacteria 4492
305 Ga0495642_0017735 3300046528 Bacteria 2781
306 Ga0495609_0000943 3300046538 Bacteria 21055
307 Ga0495609_0019502 3300046538 Bacteria 3137
308 Ga0495597_0000167 3300046542 Bacteria 58157
309 Ga0495597_0018990 3300046542 Bacteria 3221
310 Ga0495645_0036425 3300046543 Bacteria 3586
311 Ga0495633_0001624 3300046558 Bacteria 16970
312 Ga0495656_0001352 3300046615 Bacteria 8004
313 Ga0495668_0008800 3300046616 Bacteria 6257
314 Ga0495611_0002205 3300046648 Bacteria 9054
315 Ga0495625_0000467 3300046660 Bacteria 60730
316 Ga0495659_0002637 3300046664 Bacteria 5786
317 Ga0495661_0003823 3300046665 Bacteria 11016
318 Ga0495661_0010519 3300046665 Bacteria 6310
319 Ga0495669_0000012 3300046684 Bacteria 157373
320 Ga0495671_0000066 3300046692 Bacteria 105167
321 Ga0495671_0001086 3300046692 Bacteria 18821
322 Ga0495600_0151529 3300046809 Bacteria 1501
323 Ga0495660_0003780 3300046810 Bacteria 9283
324 Ga0495604_0005176 3300047317 Bacteria 10329
325 Ga0495672_0002271 3300047320 Bacteria 17861
326 Ga0495672_0012359 3300047320 Bacteria 5960
327 Ga0495685_025804 3300047447 Bacteria 2022
328 Ga0495593_0010951 3300047673 Bacteria 5223
329 Ga0496101_0084325 3300048904 Bacteria 2353
330 Ga0496102_0017089 3300048905 Bacteria 6351
331 Ga0496102_0178839 3300048905 Bacteria 1998
332 Ga0496103_0126082 3300048906 Bacteria 1633
333 Ga0496104_0055042 3300048907 Bacteria 3761
334 Ga0496104_0241225 3300048907 Bacteria 1720
335 Ga0496107_0120045 3300048910 Bacteria 1936
336 Ga0496110_0000148 3300048913 Bacteria 41684
337 Ga0496110_0089697 3300048913 Bacteria 2748
338 Ga0496111_0006204 3300048914 Bacteria 7744
339 Ga0496111_0054707 3300048914 Unclassified 2886
340 Ga0496113_0037116 3300048916 Bacteria 3574
341 Ga0496114_0010521 3300048917 Bacteria 7362
342 Ga0496115_0027875 3300048918 Bacteria 4422
343 Ga0496116_0014321 3300048919 Bacteria 6339
344 Ga0496116_0047596 3300048919 Bacteria 2886
345 Ga0496116_0079465 3300048919 Unclassified 2041
346 Ga0496117_0000156 3300048920 Bacteria 145285
347 Ga0496118_0000005 3300048921 Bacteria 697350
348 Ga0496118_0148913 3300048921 Bacteria 1468
349 Ga0496119_0000133 3300048922 Bacteria 104400
350 Ga0496119_0008959 3300048922 Bacteria 8688
351 Ga0496119_0026819 3300048922 Bacteria 3982
352 Ga0496120_0013066 3300048923 Bacteria 5614
353 Ga0496120_0067602 3300048923 Bacteria 1973
354 Ga0496121_0005527 3300048924 Bacteria 16152
355 Ga0496121_0008550 3300048924 Bacteria 12005
356 Ga0496121_0022034 3300048924 Bacteria 6204
357 Ga0496122_0008855 3300048925 Bacteria 10738
358 Ga0496122_0015579 3300048925 Bacteria 7256
359 Ga0496123_0002314 3300048926 Bacteria 23928
360 Ga0496123_0015495 3300048926 Bacteria 6249
361 Ga0496124_0020596 3300048927 Bacteria 6088
362 Ga0496125_0000710 3300048928 Bacteria 55020
363 Ga0496125_0005203 3300048928 Bacteria 14597
364 Ga0496125_0058294 3300048928 Bacteria 3120
365 Ga0496126_0065314 3300048929 Bacteria 3257
366 Ga0496126_0116288 3300048929 Bacteria 2325
367 Ga0496126_0154946 3300048929 Bacteria 1961
368 Ga0496126_0202149 3300048929 Bacteria 1677
369 Ga0495678_001890 3300049459 Bacteria 15210
370 Ga0495678_015557 3300049459 Bacteria 3498
371 Ga0495682_0011136 3300049460 Bacteria 3465
372 Ga0501032_0028641 3300049569 Bacteria 3827
373 Ga0501033_0020588 3300049570 Bacteria 4985
374 Ga0501034_0001709 3300049571 Bacteria 28248
375 Ga0501034_0025558 3300049571 Bacteria 6013
376 Ga0501034_0062645 3300049571 Unclassified 3735
377 Ga0501034_0117406 3300049571 Bacteria 2648
378 Ga0501036_0015891 3300049572 Bacteria 6287
379 Ga0501036_0026779 3300049572 Bacteria 4871
380 Ga0501036_0153723 3300049572 Bacteria 1941
381 Ga0501037_0194924 3300049573 Bacteria 1433
382 Ga0501038_0000014 3300049574 Bacteria 164836
383 Ga0501038_0024830 3300049574 Bacteria 5343
384 Ga0501039_0004707 3300049575 Bacteria 10330
385 Ga0501040_0006648 3300049576 Bacteria 7503
386 Ga0501040_0091002 3300049576 Bacteria 2121
387 Ga0501040_0185316 3300049576 Bacteria 1476
388 Ga0501041_0000023 3300049577 Bacteria 51046
389 Ga0501041_0001081 3300049577 Bacteria 14919
390 Ga0501041_0018662 3300049577 Bacteria 4131
391 Ga0501041_0100474 3300049577 Bacteria 1790
392 Ga0501042_0047504 3300049578 Bacteria 3061
393 Ga0501042_0088194 3300049578 Bacteria 2226
394 Ga0501043_0000121 3300049579 Bacteria 72050
395 Ga0501043_0045567 3300049579 Bacteria 3449
396 Ga0501043_0200714 3300049579 Bacteria 1548
397 Ga0501046_0000157 3300049580 Bacteria 70302
398 Ga0501046_0017088 3300049580 Bacteria 6063
399 Ga0501046_0125077 3300049580 Bacteria 1954
400 Ga0501046_0178819 3300049580 Bacteria 1587
401 Ga0501047_0000198 3300049581 Bacteria 72705
402 Ga0501047_0050766 3300049581 Bacteria 4006
403 Ga0501047_0061826 3300049581 Bacteria 3613
404 Ga0501048_0000020 3300049582 Bacteria 70567
405 Ga0501048_0001216 3300049582 Bacteria 19497
406 Ga0501048_0011807 3300049582 Bacteria 6513
407 Ga0501048_0231257 3300049582 Bacteria 1312
408 Ga0501068_0075082 3300049584 Bacteria 2067
409 Ga0501070_0014599 3300049586 Bacteria 6610
410 Ga0501071_0000496 3300049587 Bacteria 19961
411 Ga0501071_0061432 3300049587 Bacteria 2721
412 Ga0501072_0001424 3300049588 Bacteria 17944
413 Ga0501072_0015746 3300049588 Bacteria 5796
414 Ga0501072_0048824 3300049588 Bacteria 3332
415 Ga0501074_0027398 3300049590 Bacteria 4132
416 Ga0501074_0032693 3300049590 Bacteria 3768
417 Ga0501074_0058718 3300049590 Bacteria 2771
418 Ga0501074_0071397 3300049590 Bacteria 2496
419 Ga0501074_0086448 3300049590 Bacteria 2246
420 Ga0501075_0001541 3300049591 Bacteria 15041
421 Ga0501075_0094203 3300049591 Bacteria 2273
422 Ga0501075_0204635 3300049591 Bacteria 1505
423 Ga0501076_0027248 3300049592 Bacteria 4432
424 Ga0501076_0049514 3300049592 Bacteria 3323
425 Ga0501076_0088942 3300049592 Bacteria 2482
426 Ga0501076_0179224 3300049592 Bacteria 1727
427 Ga0501077_0000714 3300049593 Bacteria 20042
428 Ga0501077_0002269 3300049593 Bacteria 11589
429 Ga0501077_0002332 3300049593 Bacteria 11433
430 Ga0501077_0006844 3300049593 Bacteria 7014
431 Ga0501079_0000769 3300049741 Bacteria 21929
432 Ga0501079_0006340 3300049741 Bacteria 8876
433 Ga0501079_0015449 3300049741 Bacteria 5826
434 Ga0501079_0060690 3300049741 Bacteria 2917
435 Ga0501079_0078499 3300049741 Bacteria 2553
436 Ga0501080_0004129 3300049742 Bacteria 12869
437 Ga0501080_0005187 3300049742 Bacteria 11609
438 Ga0501080_0005645 3300049742 Bacteria 11182
439 Ga0501080_0060269 3300049742 Bacteria 3532
440 Ga0501080_0140633 3300049742 Bacteria 2232
441 Ga0501081_0002294 3300049743 Bacteria 12048
442 Ga0501081_0003181 3300049743 Bacteria 10439
443 Ga0501081_0008301 3300049743 Bacteria 6739
444 Ga0501083_0007955 3300049744 Bacteria 7507
445 Ga0501083_0019946 3300049744 Bacteria 4666
446 Ga0501083_0046396 3300049744 Bacteria 2938
447 Ga0501083_0052403 3300049744 Bacteria 2741
448 Ga0501035_0037565 3300049822 Bacteria 4385
449 Ga0501035_0246860 3300049822 Bacteria 1517
450 Ga0501044_0050216 3300049823 Bacteria 4305
451 Ga0501044_0181990 3300049823 Bacteria 2068
452 Ga0501045_0000975 3300049824 Bacteria 18730
453 Ga0501045_0013664 3300049824 Bacteria 5739
454 Ga0501045_0081109 3300049824 Bacteria 2392
455 Ga0501045_0163537 3300049824 Bacteria 1657
456 nmdc:mga00v17_141_c1 3300050491 Bacteria 41598
457 nmdc:mga00v17_9143_c2 3300050491 Bacteria 4606
458 nmdc:mga0k408_41613_c1 3300050493 Bacteria 2645
459 nmdc:mga07m45_13976_c1 3300050496 Bacteria 4268
460 nmdc:mga05p37_40430_c1 3300050507 Bacteria 5727
461 nmdc:mga09592_84037_c1 3300050508 Bacteria 2714
462 nmdc:mga0qj67_7804_c1 3300050509 Bacteria 7910
463 nmdc:mga06r32_218654_c1 3300050510 Bacteria 1893
464 nmdc:mga08y16_123188_c1 3300050511 Bacteria 2698
465 Ga0495601_0135543 3300053077 Bacteria 1605
466 Ga0495595_0065470 3300053084 Bacteria 1709
467 Ga0495619_0003906 3300053085 Bacteria 9579
468 Ga0500643_012946 3300053087 Bacteria 2969
469 Ga0500556_0000336 3300053104 Bacteria 35065
470 Ga0500557_000622 3300053105 Bacteria 4867
471 Ga0500562_020100 3300053108 Bacteria 1733
472 Ga0500595_017608 3300053119 Bacteria 2633
473 Ga0500568_0001808 3300053139 Bacteria 13178
474 Ga0500568_0066652 3300053139 Bacteria 1384
475 Ga0500616_0000917 3300053153 Bacteria 32210
476 Ga0500596_001643 3300053735 Bacteria 4519
477 Ga0501084_0000739 3300054114 Bacteria 24952
478 Ga0501084_0002070 3300054114 Bacteria 16013
479 Ga0501084_0009931 3300054114 Bacteria 7869
480 Ga0501084_0049269 3300054114 Bacteria 3526
481 Ga0501082_0000869 3300060353 Bacteria 26666
482 Ga0501082_0031019 3300060353 Bacteria 4607
483 Ga0501082_0049319 3300060353 Bacteria 3630
484 Ga0501082_0112868 3300060353 Bacteria 2353
485 Ga0466962_0009066 3300061719 Bacteria 4763
486 Ga0466962_0027249 3300061719 Bacteria 2743
487 Ga0530510_0000323 3300061734 Bacteria 30875
488 Ga0530510_0018161 3300061734 Bacteria 4986
489 Ga0530510_0025237 3300061734 Bacteria 4249
490 Ga0530510_0044764 3300061734 Bacteria 3199

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053139 Ga0500568_0066652 Ga0500568_0066652_350_1366 314
2 3300042876 Ga0451577_0021805 Ga0451577_0021805_2250_3236 328
3 3300013102 Ga0157371_10001514 Ga0157371_1000151414 342
4 3300048926 Ga0496123_0015495 Ga0496123_0015495_5029_6234 360
5 3300042876 Ga0451577_0065911 Ga0451577_0065911_1457_2692 361
6 3300045051 Ga0451576_0096489 Ga0451576_0096489_550_1785 361
7 3300048925 Ga0496122_0008855 Ga0496122_0008855_4854_6062 361
8 3300048928 Ga0496125_0000710 Ga0496125_0000710_18571_19779 361
9 3300049571 Ga0501034_0062645 Ga0501034_0062645_1823_3160 364
10 3300045836 Ga0466958_0056301 Ga0466958_0056301_103_1290 365
11 3300048905 Ga0496102_0017089 Ga0496102_0017089_4906_6126 366
12 3300048906 Ga0496103_0126082 Ga0496103_0126082_114_1334 366
13 3300048919 Ga0496116_0079465 Ga0496116_0079465_432_1652 366
14 3300048920 Ga0496117_0000156 Ga0496117_0000156_79501_80721 366
15 3300048921 Ga0496118_0000005 Ga0496118_0000005_1837_3057 366
16 3300048924 Ga0496121_0022034 Ga0496121_0022034_2154_3407 366
17 3300037471 Ga0395905_0068361 Ga0395905_0068361_124_1368 367
18 3300048927 Ga0496124_0020596 Ga0496124_0020596_3053_4273 367
19 3300053104 Ga0500556_0000336 Ga0500556_0000336_11998_13209 367
20 3300041452 Ga0451793_1587026 Ga0451793_1587026_239_1474 368
21 3300046522 Ga0495643_0034274 Ga0495643_0034274_936_2186 368
22 3300046528 Ga0495642_0017735 Ga0495642_0017735_168_1418 368
23 3300046542 Ga0495597_0018990 Ga0495597_0018990_188_1438 368
24 3300049592 Ga0501076_0179224 Ga0501076_0179224_81_1202 368
25 3300049824 Ga0501045_0163537 Ga0501045_0163537_268_1473 368
26 3300031730 Ga0307516_10001128 Ga0307516_1000112816 371
27 3300048922 Ga0496119_0026819 Ga0496119_0026819_68_1291 371
28 3300006173 Ga0070716_100083546 Ga0070716_1000835461 372
29 3300046511 Ga0495608_0168422 Ga0495608_0168422_23_1270 373
30 3300046514 Ga0495618_0098689 Ga0495618_0098689_507_1775 373
31 3300046809 Ga0495600_0151529 Ga0495600_0151529_176_1423 373
32 3300053077 Ga0495601_0135543 Ga0495601_0135543_236_1504 373
33 3300053084 Ga0495595_0065470 Ga0495595_0065470_302_1549 373
34 3300053085 Ga0495619_0003906 Ga0495619_0003906_6783_8030 373
35 3300021361 Ga0213872_10005211 Ga0213872_100052114 374
36 3300039447 Ga0436361_1211686 Ga0436361_1211686_1505_2725 374
37 3300041407 Ga0439447_000627 Ga0439447_000627_3513_4721 374
38 3300044693 Ga0466961_0011072 Ga0466961_0011072_4295_5521 374
39 3300044719 Ga0466971_0023990 Ga0466971_0023990_1480_2706 374
40 3300044842 Ga0466957_0095449 Ga0466957_0095449_95_1321 374
41 3300061719 Ga0466962_0009066 Ga0466962_0009066_2378_3604 374
42 3300049577 Ga0501041_0001081 Ga0501041_0001081_8379_9611 375
43 3300049588 Ga0501072_0015746 Ga0501072_0015746_3450_4682 375
44 3300049590 Ga0501074_0027398 Ga0501074_0027398_2413_3645 375
45 3300049592 Ga0501076_0088942 Ga0501076_0088942_737_1969 375
46 3300049593 Ga0501077_0002269 Ga0501077_0002269_7251_8483 375
47 3300049742 Ga0501080_0004129 Ga0501080_0004129_10283_11515 375
48 3300049743 Ga0501081_0008301 Ga0501081_0008301_2477_3709 375
49 3300049824 Ga0501045_0013664 Ga0501045_0013664_3063_4295 375
50 3300054114 Ga0501084_0049269 Ga0501084_0049269_2206_3438 375
51 3300061734 Ga0530510_0018161 Ga0530510_0018161_2449_3681 375
52 3300005549 Ga0070704_100028751 Ga0070704_1000287512 377
53 3300005458 Ga0070681_10230619 Ga0070681_102306192 378
54 3300005530 Ga0070679_100175752 Ga0070679_1001757521 378
55 3300009551 Ga0105238_10074902 Ga0105238_100749023 378
56 3300025912 Ga0207707_10126088 Ga0207707_101260882 378
57 3300025915 Ga0207693_10006671 Ga0207693_100066714 378
58 3300025921 Ga0207652_10101333 Ga0207652_101013332 378
59 3300048907 Ga0496104_0241225 Ga0496104_0241225_197_1465 378
60 3300049459 Ga0495678_015557 Ga0495678_015557_2008_3156 378
61 3300049744 Ga0501083_0007955 Ga0501083_0007955_3076_4305 378
62 3300012502 Ga0157347_1000034 Ga0157347_10000346 379
63 3300025921 Ga0207652_10137820 Ga0207652_101378202 379
64 3300049591 Ga0501075_0204635 Ga0501075_0204635_54_1205 379
65 3300006844 Ga0075428_100098601 Ga0075428_1000986012 380
66 3300006847 Ga0075431_100000746 Ga0075431_1000007465 380
67 3300006880 Ga0075429_100089055 Ga0075429_1000890552 380
68 3300009147 Ga0114129_10001070 Ga0114129_1000107029 380
69 3300041453 Ga0451797_1457614 Ga0451797_1457614_1888_3108 380
70 3300049742 Ga0501080_0140633 Ga0501080_0140633_1002_2219 380
71 3300050508 nmdc:mga09592_84037_c1 nmdc:mga09592_84037_c1_898_2097 380
72 3300050509 nmdc:mga0qj67_7804_c1 nmdc:mga0qj67_7804_c1_1344_2543 380
73 iso_pu_bacteria 2894023352 2894026315 380
74 iso_pu_bacteria 8054563764 8054564224 380
75 3300005616 Ga0068852_100022802 Ga0068852_1000228025 381
76 3300005618 Ga0068864_100008900 Ga0068864_1000089007 381
77 3300005719 Ga0068861_100001850 Ga0068861_1000018503 381
78 3300006237 Ga0097621_100007843 Ga0097621_1000078433 381
79 3300006358 Ga0068871_100027451 Ga0068871_1000274512 381
80 3300026023 Ga0207677_10002600 Ga0207677_100026004 381
81 3300026095 Ga0207676_10011899 Ga0207676_100118992 381
82 3300039447 Ga0436361_0439571 Ga0436361_0439571_649_1881 381
83 3300031240 Ga0265320_10002374 Ga0265320_100023743 382
84 3300031241 Ga0265325_10004104 Ga0265325_100041048 382
85 3300031548 Ga0307408_100028832 Ga0307408_1000288324 382
86 3300031901 Ga0307406_10022582 Ga0307406_100225824 382
87 3300033544 Ga0316215_1001466 Ga0316215_10014662 382
88 3300045049 Ga0466959_0102528 Ga0466959_0102528_24_1193 382
89 iso_pu_bacteria 2974298342 2974301069 382
90 3300005546 Ga0070696_100159510 Ga0070696_1001595102 383
91 3300015683 Ga0183362_10001 Ga0183362_10001339 383
92 3300053139 Ga0500568_0001808 Ga0500568_0001808_9461_10645 383
93 3300053153 Ga0500616_0000917 Ga0500616_0000917_23576_24760 383
94 iso_pu_bacteria 2510065053 2510281030 383
95 iso_pu_bacteria 2510065055 2510294839 383
96 iso_pu_bacteria 2510065058 2510309178 383
97 iso_pu_bacteria 2773857672 2774131970 383
98 iso_pu_bacteria 2984499530 2984503543 383
99 3300003751 Ga0055538_1000013 Ga0055538_1000013258 384
100 3300003752 Ga0055539_1000018 Ga0055539_1000018258 384
101 3300003756 Ga0055533_1000022 Ga0055533_1000022258 384
102 3300003759 Ga0055525_1000024 Ga0055525_1000024258 384
103 3300003771 Ga0055526_1001612 Ga0055526_10016124 384
104 3300003771 Ga0055526_1004498 Ga0055526_10044985 384
105 3300003781 Ga0055536_1000090 Ga0055536_100009067 384
106 3300003784 Ga0055534_1002351 Ga0055534_10023514 384
107 3300003841 Ga0055541_1000013 Ga0055541_1000013258 384
108 3300005471 Ga0070698_100187403 Ga0070698_1001874032 384
109 3300006946 Ga0079104_1007105 Ga0079104_10071053 384
110 3300015265 Ga0182005_1000008 Ga0182005_1000008341 384
111 3300025224 Ga0209784_100005 Ga0209784_100005470 384
112 3300025225 Ga0209566_100005 Ga0209566_100005470 384
113 3300025226 Ga0209674_100009 Ga0209674_100009470 384
114 3300025230 Ga0209563_100012 Ga0209563_100012470 384
115 3300025253 Ga0209677_100006 Ga0209677_100006470 384
116 3300025291 Ga0209675_1000291 Ga0209675_10002915 384
117 3300025292 Ga0209676_1000059 Ga0209676_10000595 384
118 3300025294 Ga0209025_1000879 Ga0209025_100087939 384
119 3300025295 Ga0209564_1000623 Ga0209564_100062346 384
120 3300025295 Ga0209564_1002245 Ga0209564_10022455 384
121 3300046460 Ga0495638_0000145 Ga0495638_0000145_64404_65591 384
122 3300049571 Ga0501034_0117406 Ga0501034_0117406_673_1851 384
123 3300049576 Ga0501040_0185316 Ga0501040_0185316_53_1270 384
124 3300049588 Ga0501072_0048824 Ga0501072_0048824_956_2173 384
125 3300049590 Ga0501074_0032693 Ga0501074_0032693_1244_2461 384
126 3300049592 Ga0501076_0049514 Ga0501076_0049514_711_1928 384
127 3300049593 Ga0501077_0006844 Ga0501077_0006844_313_1530 384
128 3300049741 Ga0501079_0006340 Ga0501079_0006340_1543_2760 384
129 3300049742 Ga0501080_0005187 Ga0501080_0005187_10265_11482 384
130 3300049744 Ga0501083_0046396 Ga0501083_0046396_1401_2618 384
131 3300053108 Ga0500562_020100 Ga0500562_020100_102_1289 384
132 3300054114 Ga0501084_0002070 Ga0501084_0002070_9022_10239 384
133 3300060353 Ga0501082_0112868 Ga0501082_0112868_906_2123 384
134 iso_pu_bacteria 2599185239 2599740777 384
135 iso_pu_bacteria 2599185240 2599747128 384
136 iso_pu_bacteria 2599185355 2600209664 384
137 iso_pu_bacteria 2675903129 2676744886 384
138 iso_pu_bacteria 2818991452 2819633222 384
139 iso_pu_bacteria 3007419365 3007424083 384
140 3300005438 Ga0070701_10008112 Ga0070701_100081122 385
141 3300005844 Ga0068862_100080957 Ga0068862_1000809572 385
142 3300026116 Ga0207674_10028948 Ga0207674_100289482 385
143 3300042006 Ga0439432_023781 Ga0439432_023781_567_1733 385
144 3300045976 Ga0466967_0021844 Ga0466967_0021844_2835_4055 385
145 3300046500 Ga0495596_0000738 Ga0495596_0000738_14771_15985 385
146 3300046501 Ga0495607_0008050 Ga0495607_0008050_5739_6953 385
147 3300046512 Ga0495610_0002945 Ga0495610_0002945_7682_8896 385
148 3300046538 Ga0495609_0000943 Ga0495609_0000943_14816_16030 385
149 3300046665 Ga0495661_0010519 Ga0495661_0010519_634_1848 385
150 3300047320 Ga0495672_0002271 Ga0495672_0002271_7231_8445 385
151 3300047447 Ga0495685_025804 Ga0495685_025804_15_1229 385
152 3300048913 Ga0496110_0000148 Ga0496110_0000148_11183_12343 385
153 3300048914 Ga0496111_0054707 Ga0496111_0054707_1486_2646 385
154 3300048919 Ga0496116_0014321 Ga0496116_0014321_4153_5367 385
155 3300048924 Ga0496121_0005527 Ga0496121_0005527_14883_16097 385
156 3300049579 Ga0501043_0000121 Ga0501043_0000121_52081_53325 385
157 3300049580 Ga0501046_0000157 Ga0501046_0000157_52053_53297 385
158 3300049581 Ga0501047_0000198 Ga0501047_0000198_18726_19970 385
159 3300049582 Ga0501048_0000020 Ga0501048_0000020_52053_53297 385
160 2162886007 SwRhRL2b_contig_2682132 SwRhRL2b_0337.00004910 386
161 3300005289 Ga0065704_10087137 Ga0065704_100871372 386
162 3300037471 Ga0395905_0000353 Ga0395905_0000353_22492_23703 386
163 3300046507 Ga0495606_0004680 Ga0495606_0004680_11768_12928 386
164 3300046665 Ga0495661_0003823 Ga0495661_0003823_8535_9785 386
165 iso_pu_bacteria 2846037992 2846040110 386
166 3300046558 Ga0495633_0001624 Ga0495633_0001624_7067_8233 387
167 3300046692 Ga0495671_0001086 Ga0495671_0001086_16127_17341 387
168 3300048925 Ga0496122_0015579 Ga0496122_0015579_1761_2975 387
169 3300048926 Ga0496123_0002314 Ga0496123_0002314_22114_23328 387
170 3300053735 Ga0500596_001643 Ga0500596_001643_2303_3469 387
171 3300061734 Ga0530510_0044764 Ga0530510_0044764_523_1749 387
172 3300003187 JGI25151J46595_10040096 JGI25151J46595_100400961 388
173 3300005339 Ga0070660_100055494 Ga0070660_1000554942 388
174 3300005458 Ga0070681_10178706 Ga0070681_101787061 388
175 3300005563 Ga0068855_100025742 Ga0068855_1000257426 388
176 3300005577 Ga0068857_100007527 Ga0068857_1000075272 388
177 3300005616 Ga0068852_100045127 Ga0068852_1000451274 388
178 3300009551 Ga0105238_10052632 Ga0105238_100526322 388
179 3300025263 Ga0209565_1003320 Ga0209565_10033204 388
180 3300025291 Ga0209675_1002115 Ga0209675_10021154 388
181 3300025294 Ga0209025_1002965 Ga0209025_10029653 388
182 3300025299 Ga0209256_1000661 Ga0209256_10006619 388
183 3300025919 Ga0207657_10003404 Ga0207657_1000340410 388
184 3300025945 Ga0207679_10149315 Ga0207679_101493151 388
185 3300025949 Ga0207667_10023248 Ga0207667_100232484 388
186 3300026116 Ga0207674_10004838 Ga0207674_100048386 388
187 3300044842 Ga0466957_0009939 Ga0466957_0009939_1487_2656 388
188 3300044842 Ga0466957_0149432 Ga0466957_0149432_203_1372 388
189 3300045836 Ga0466958_0000187 Ga0466958_0000187_8777_9946 388
190 3300046542 Ga0495597_0000167 Ga0495597_0000167_50701_51987 388
191 3300048919 Ga0496116_0047596 Ga0496116_0047596_1227_2399 388
192 3300049572 Ga0501036_0153723 Ga0501036_0153723_653_1864 388
193 3300049576 Ga0501040_0091002 Ga0501040_0091002_700_1911 388
194 3300049580 Ga0501046_0125077 Ga0501046_0125077_389_1600 388
195 3300049582 Ga0501048_0231257 Ga0501048_0231257_77_1288 388
196 3300061719 Ga0466962_0027249 Ga0466962_0027249_1443_2612 388
197 iso_pu_bacteria 2808606377 2808929640 388
198 iso_pu_bacteria 2808606381 2808951781 388
199 iso_pu_bacteria 2932422444 2932425967 388
200 3300037418 Ga0395900_0079503 Ga0395900_0079503_1765_2952 389
201 3300049571 Ga0501034_0025558 Ga0501034_0025558_1281_2468 389
202 3300049580 Ga0501046_0017088 Ga0501046_0017088_1874_3061 389
203 3300053119 Ga0500595_017608 Ga0500595_017608_570_1928 389
204 iso_pu_bacteria 2739367654 2739605186 389
205 iso_pu_bacteria 2919675420 2919676418 389
206 3300006844 Ga0075428_100097502 Ga0075428_1000975025 390
207 3300009094 Ga0111539_10020521 Ga0111539_100205219 390
208 3300009147 Ga0114129_10100051 Ga0114129_101000517 390
209 3300010159 Ga0099796_10015184 Ga0099796_100151842 390
210 3300013307 Ga0157372_10154140 Ga0157372_101541402 390
211 3300026089 Ga0207648_10066129 Ga0207648_100661293 390
212 3300031344 Ga0265316_10136146 Ga0265316_101361462 390
213 3300037068 Ga0373925_0077596 Ga0373925_0077596_629_1858 390
214 3300038443 Ga0395901_0205259 Ga0395901_0205259_758_1942 390
215 3300042016 Ga0439463_011493 Ga0439463_011493_76_1284 390
216 3300046615 Ga0495656_0001352 Ga0495656_0001352_4971_6146 390
217 3300048922 Ga0496119_0000133 Ga0496119_0000133_50791_52023 390
218 3300048923 Ga0496120_0013066 Ga0496120_0013066_2622_3854 390
219 3300049741 Ga0501079_0060690 Ga0501079_0060690_1216_2439 390
220 3300050491 nmdc:mga00v17_9143_c2 nmdc:mga00v17_9143_c2_151_1326 390
221 3300050511 nmdc:mga08y16_123188_c1 nmdc:mga08y16_123188_c1_1125_2345 390
222 iso_pu_bacteria 2839094727 2839099433 390
223 iso_pu_bacteria 2939669807 2939672446 390
224 3300005262 Ga0065165_1000001 Ga0065165_1000001245 391
225 3300005334 Ga0068869_100005371 Ga0068869_1000053718 391
226 3300005338 Ga0068868_100010295 Ga0068868_1000102956 391
227 3300005339 Ga0070660_100023074 Ga0070660_1000230743 391
228 3300005340 Ga0070689_100174084 Ga0070689_1001740841 391
229 3300005366 Ga0070659_100057220 Ga0070659_1000572202 391
230 3300005367 Ga0070667_100097347 Ga0070667_1000973472 391
231 3300005457 Ga0070662_100000752 Ga0070662_1000007523 391
232 3300005536 Ga0070697_100196088 Ga0070697_1001960881 391
233 3300005539 Ga0068853_100003918 Ga0068853_10000391811 391
234 3300005546 Ga0070696_100058155 Ga0070696_1000581551 391
235 3300005547 Ga0070693_100052321 Ga0070693_1000523212 391
236 3300005563 Ga0068855_100171029 Ga0068855_1001710292 391
237 3300005578 Ga0068854_100167848 Ga0068854_1001678482 391
238 3300005617 Ga0068859_100006569 Ga0068859_1000065692 391
239 3300005842 Ga0068858_100034057 Ga0068858_1000340574 391
240 3300005843 Ga0068860_100156728 Ga0068860_1001567282 391
241 3300005844 Ga0068862_100043338 Ga0068862_1000433382 391
242 3300006931 Ga0097620_100006569 Ga0097620_10000656910 391
243 3300009177 Ga0105248_10004400 Ga0105248_100044009 391
244 3300009177 Ga0105248_10005940 Ga0105248_100059409 391
245 3300009545 Ga0105237_10036428 Ga0105237_100364285 391
246 3300009551 Ga0105238_10012510 Ga0105238_100125102 391
247 3300010375 Ga0105239_10013790 Ga0105239_100137902 391
248 3300013296 Ga0157374_10009759 Ga0157374_100097597 391
249 3300013297 Ga0157378_10020686 Ga0157378_100206865 391
250 3300013307 Ga0157372_10153648 Ga0157372_101536483 391
251 3300013308 Ga0157375_10047478 Ga0157375_100474782 391
252 3300014325 Ga0163163_10049178 Ga0163163_100491784 391
253 3300014968 Ga0157379_10004214 Ga0157379_100042142 391
254 3300014969 Ga0157376_10006746 Ga0157376_100067467 391
255 3300017792 Ga0163161_10032047 Ga0163161_100320471 391
256 3300025919 Ga0207657_10026864 Ga0207657_100268642 391
257 3300025941 Ga0207711_10005616 Ga0207711_100056168 391
258 3300025942 Ga0207689_10002130 Ga0207689_100021308 391
259 3300025981 Ga0207640_10088754 Ga0207640_100887542 391
260 3300025986 Ga0207658_10103211 Ga0207658_101032112 391
261 3300026041 Ga0207639_10094938 Ga0207639_100949382 391
262 3300026067 Ga0207678_10000497 Ga0207678_1000049716 391
263 3300026116 Ga0207674_10029689 Ga0207674_100296896 391
264 3300026118 Ga0207675_100000926 Ga0207675_10000092626 391
265 3300026142 Ga0207698_10059749 Ga0207698_100597492 391
266 3300035691 Ga0373931_0006912 Ga0373931_0006912_2198_3415 391
267 3300037312 Ga0395899_0008100 Ga0395899_0008100_1973_3184 391
268 3300037466 Ga0395898_0043891 Ga0395898_0043891_497_1708 391
269 3300046474 Ga0495605_0006921 Ga0495605_0006921_2935_4122 391
270 3300046492 Ga0495585_0008730 Ga0495585_0008730_4426_5613 391
271 3300046506 Ga0495583_0029329 Ga0495583_0029329_203_1390 391
272 3300046515 Ga0495620_0027151 Ga0495620_0027151_512_1699 391
273 3300046518 Ga0495631_0001207 Ga0495631_0001207_6298_7485 391
274 3300046519 Ga0495632_0006023 Ga0495632_0006023_5830_7017 391
275 3300046524 Ga0495648_0090617 Ga0495648_0090617_213_1400 391
276 3300046538 Ga0495609_0019502 Ga0495609_0019502_1046_2233 391
277 3300046616 Ga0495668_0008800 Ga0495668_0008800_2587_3774 391
278 3300046660 Ga0495625_0000467 Ga0495625_0000467_15385_16572 391
279 3300046810 Ga0495660_0003780 Ga0495660_0003780_2514_3701 391
280 3300048904 Ga0496101_0084325 Ga0496101_0084325_693_1910 391
281 3300048905 Ga0496102_0178839 Ga0496102_0178839_276_1502 391
282 3300048907 Ga0496104_0055042 Ga0496104_0055042_977_2203 391
283 3300048910 Ga0496107_0120045 Ga0496107_0120045_173_1390 391
284 3300048913 Ga0496110_0089697 Ga0496110_0089697_441_1658 391
285 3300048914 Ga0496111_0006204 Ga0496111_0006204_5848_7065 391
286 3300048916 Ga0496113_0037116 Ga0496113_0037116_307_1536 391
287 3300048917 Ga0496114_0010521 Ga0496114_0010521_6022_7239 391
288 3300048918 Ga0496115_0027875 Ga0496115_0027875_1834_3051 391
289 3300053087 Ga0500643_012946 Ga0500643_012946_1094_2281 391
290 3300053105 Ga0500557_000622 Ga0500557_000622_2323_3510 391
291 iso_pu_bacteria 2808606394 2809028414 391
292 iso_pu_bacteria 2901300506 2901310261 391
293 iso_pu_bacteria 2917832318 2917834980 391
294 iso_pu_bacteria 2996336353 2996341660 391
295 3300003187 JGI25151J46595_10002410 JGI25151J46595_100024102 392
296 3300003773 Ga0055537_1001551 Ga0055537_10015515 392
297 3300003775 Ga0055524_1005163 Ga0055524_10051635 392
298 3300003784 Ga0055534_1000757 Ga0055534_100075710 392
299 3300005335 Ga0070666_10003380 Ga0070666_100033809 392
300 3300025263 Ga0209565_1000927 Ga0209565_10009275 392
301 3300025273 Ga0209673_1010110 Ga0209673_10101102 392
302 3300025291 Ga0209675_1001223 Ga0209675_100122311 392
303 3300025294 Ga0209025_1010155 Ga0209025_10101552 392
304 3300025295 Ga0209564_1002915 Ga0209564_10029153 392
305 3300025299 Ga0209256_1003207 Ga0209256_100320710 392
306 3300025903 Ga0207680_10007805 Ga0207680_100078055 392
307 3300025949 Ga0207667_10027384 Ga0207667_100273843 392
308 3300049572 Ga0501036_0015891 Ga0501036_0015891_2242_3435 392
309 3300049577 Ga0501041_0018662 Ga0501041_0018662_1996_3189 392
310 3300049582 Ga0501048_0011807 Ga0501048_0011807_1621_2814 392
311 3300049587 Ga0501071_0061432 Ga0501071_0061432_860_2053 392
312 3300049590 Ga0501074_0086448 Ga0501074_0086448_527_1720 392
313 3300049591 Ga0501075_0001541 Ga0501075_0001541_3419_4612 392
314 3300049592 Ga0501076_0027248 Ga0501076_0027248_1571_2764 392
315 3300049593 Ga0501077_0002332 Ga0501077_0002332_3053_4246 392
316 3300049741 Ga0501079_0078499 Ga0501079_0078499_229_1422 392
317 3300049743 Ga0501081_0003181 Ga0501081_0003181_6569_7762 392
318 3300049744 Ga0501083_0019946 Ga0501083_0019946_1351_2544 392
319 3300049824 Ga0501045_0081109 Ga0501045_0081109_962_2155 392
320 3300050510 nmdc:mga06r32_218654_c1 nmdc:mga06r32_218654_c1_227_1450 392
321 3300054114 Ga0501084_0009931 Ga0501084_0009931_5965_7158 392
322 3300060353 Ga0501082_0049319 Ga0501082_0049319_1884_3077 392
323 3300061734 Ga0530510_0025237 Ga0530510_0025237_1760_2953 392
324 iso_pu_bacteria 2852649853 2852650756 392
325 iso_pu_bacteria 2904530477 2904530939 392
326 3300003214 JGI25165J46597_1000025 JGI25165J46597_1000025106 393
327 3300005327 Ga0070658_10062054 Ga0070658_100620542 393
328 3300005329 Ga0070683_100045202 Ga0070683_1000452023 393
329 3300005334 Ga0068869_100025276 Ga0068869_1000252762 393
330 3300005339 Ga0070660_100037868 Ga0070660_1000378682 393
331 3300005339 Ga0070660_100086070 Ga0070660_1000860701 393
332 3300005355 Ga0070671_100237620 Ga0070671_1002376201 393
333 3300005535 Ga0070684_100041117 Ga0070684_1000411173 393
334 3300005539 Ga0068853_100028407 Ga0068853_1000284073 393
335 3300005564 Ga0070664_100010718 Ga0070664_1000107183 393
336 3300005577 Ga0068857_100010070 Ga0068857_1000100704 393
337 3300005578 Ga0068854_100035802 Ga0068854_1000358023 393
338 3300005834 Ga0068851_10029602 Ga0068851_100296023 393
339 3300006028 Ga0070717_10173763 Ga0070717_101737632 393
340 3300006051 Ga0075364_10000241 Ga0075364_1000024110 393
341 3300006051 Ga0075364_10019578 Ga0075364_100195782 393
342 3300006175 Ga0070712_100009916 Ga0070712_1000099163 393
343 3300009177 Ga0105248_10012680 Ga0105248_100126809 393
344 3300009551 Ga0105238_10007494 Ga0105238_100074947 393
345 3300010375 Ga0105239_10202282 Ga0105239_102022822 393
346 3300013102 Ga0157371_10051085 Ga0157371_100510852 393
347 3300013105 Ga0157369_10008661 Ga0157369_1000866111 393
348 3300013307 Ga0157372_10004459 Ga0157372_1000445910 393
349 3300025261 Ga0209233_1000053 Ga0209233_1000053275 393
350 3300025321 Ga0207656_10019146 Ga0207656_100191462 393
351 3300025915 Ga0207693_10035719 Ga0207693_100357193 393
352 3300025919 Ga0207657_10023220 Ga0207657_100232202 393
353 3300025919 Ga0207657_10037213 Ga0207657_100372133 393
354 3300026041 Ga0207639_10071657 Ga0207639_100716572 393
355 3300026116 Ga0207674_10015373 Ga0207674_100153737 393
356 3300026142 Ga0207698_10015729 Ga0207698_100157293 393
357 3300031901 Ga0307406_10053404 Ga0307406_100534041 393
358 3300046460 Ga0495638_0023560 Ga0495638_0023560_2697_3962 393
359 3300048928 Ga0496125_0005203 Ga0496125_0005203_6469_7680 393
360 3300048929 Ga0496126_0065314 Ga0496126_0065314_298_1509 393
361 3300048929 Ga0496126_0202149 Ga0496126_0202149_93_1319 393
362 3300049573 Ga0501037_0194924 Ga0501037_0194924_24_1226 393
363 3300049574 Ga0501038_0000014 Ga0501038_0000014_26120_27334 393
364 3300049579 Ga0501043_0200714 Ga0501043_0200714_206_1396 393
365 3300049742 Ga0501080_0060269 Ga0501080_0060269_1519_2709 393
366 3300049822 Ga0501035_0246860 Ga0501035_0246860_154_1344 393
367 3300050491 nmdc:mga00v17_141_c1 nmdc:mga00v17_141_c1_14992_16188 393
368 iso_pu_bacteria 2551306416 2553007691 393
369 iso_pu_bacteria 2574179768 2574430001 393
370 iso_pu_bacteria 2721755763 2723876514 393
371 iso_pu_bacteria 2739367655 2739612542 393
372 iso_pu_bacteria 2881412998 2881415395 393
373 iso_pu_bacteria 2923510766 2923515795 393
374 3300003322 rootL2_10162752 rootL2_101627522 394
375 3300005344 Ga0070661_100055803 Ga0070661_1000558032 394
376 3300005353 Ga0070669_100015207 Ga0070669_1000152076 394
377 3300005354 Ga0070675_100015653 Ga0070675_1000156537 394
378 3300005445 Ga0070708_100093067 Ga0070708_1000930674 394
379 3300005455 Ga0070663_100030473 Ga0070663_1000304732 394
380 3300005467 Ga0070706_100000388 Ga0070706_10000038857 394
381 3300005518 Ga0070699_100073777 Ga0070699_1000737773 394
382 3300005834 Ga0068851_10020638 Ga0068851_100206382 394
383 3300009147 Ga0114129_10144150 Ga0114129_101441502 394
384 3300010159 Ga0099796_10000276 Ga0099796_100002764 394
385 3300021388 Ga0213875_10002319 Ga0213875_1000231911 394
386 3300025901 Ga0207688_10005778 Ga0207688_100057782 394
387 3300025914 Ga0207671_10031935 Ga0207671_100319353 394
388 3300025923 Ga0207681_10055000 Ga0207681_100550002 394
389 3300025924 Ga0207694_10119344 Ga0207694_101193442 394
390 3300025933 Ga0207706_10001109 Ga0207706_100011092 394
391 3300025942 Ga0207689_10000605 Ga0207689_1000060513 394
392 3300025949 Ga0207667_10179673 Ga0207667_101796732 394
393 3300026078 Ga0207702_10173163 Ga0207702_101731632 394
394 3300037853 Ga0436364_0616684 Ga0436364_0616684_25503_26747 394
395 3300047673 Ga0495593_0010951 Ga0495593_0010951_59_1255 394
396 3300048922 Ga0496119_0008959 Ga0496119_0008959_4688_5929 394
397 3300048923 Ga0496120_0067602 Ga0496120_0067602_420_1661 394
398 3300048928 Ga0496125_0058294 Ga0496125_0058294_1522_2763 394
399 3300048929 Ga0496126_0154946 Ga0496126_0154946_401_1642 394
400 3300050507 nmdc:mga05p37_40430_c1 nmdc:mga05p37_40430_c1_3112_4431 394
401 iso_pu_bacteria 2554235132 2554814891 394
402 iso_pu_bacteria 2855730933 2855733387 394
403 iso_pu_bacteria 2855767633 2855772396 394
404 iso_pu_bacteria 2929160207 2929161039 394
405 iso_pu_bacteria 8045864390 8045865742 394
406 3300003187 JGI25151J46595_10000131 JGI25151J46595_1000013160 395
407 3300005468 Ga0070707_100041939 Ga0070707_1000419392 395
408 3300005471 Ga0070698_100105052 Ga0070698_1001050522 395
409 3300005518 Ga0070699_100009784 Ga0070699_1000097848 395
410 3300005536 Ga0070697_100019344 Ga0070697_1000193442 395
411 3300005578 Ga0068854_100030944 Ga0068854_1000309441 395
412 3300006942 Ga0099824_1030680 Ga0099824_10306802 395
413 3300006943 Ga0099822_1003706 Ga0099822_100370625 395
414 3300006948 Ga0099826_10000039 Ga0099826_1000003991 395
415 3300015261 Ga0182006_1002448 Ga0182006_10024481 395
416 3300025294 Ga0209025_1000028 Ga0209025_1000028376 395
417 3300025910 Ga0207684_10010691 Ga0207684_100106916 395
418 3300025913 Ga0207695_10000573 Ga0207695_100005739 395
419 3300025922 Ga0207646_10016047 Ga0207646_100160473 395
420 3300027357 Ga0209589_1000015 Ga0209589_1000015134 395
421 3300027361 Ga0209489_100015 Ga0209489_100015134 395
422 3300027363 Ga0209700_100025 Ga0209700_100025134 395
423 3300027666 Ga0209282_1000058 Ga0209282_100005891 395
424 3300030744 Ga0316181_1070820 Ga0316181_10708204 395
425 3300031911 Ga0307412_10212565 Ga0307412_102125651 395
426 3300041407 Ga0439447_005618 Ga0439447_005618_27_1232 395
427 3300042006 Ga0439432_025387 Ga0439432_025387_544_1749 395
428 3300042010 Ga0439452_005096 Ga0439452_005096_685_1890 395
429 3300042013 Ga0439456_004556 Ga0439456_004556_87_1292 395
430 3300042127 Ga0450890_002362 Ga0450890_002362_1075_2280 395
431 3300042146 Ga0450907_001201 Ga0450907_001201_3211_4416 395
432 3300042461 Ga0439460_0011782 Ga0439460_0011782_569_1774 395
433 3300046501 Ga0495607_0023097 Ga0495607_0023097_826_2037 395
434 3300046506 Ga0495583_0017814 Ga0495583_0017814_1766_2977 395
435 3300046520 Ga0495637_0027844 Ga0495637_0027844_338_1549 395
436 3300046524 Ga0495648_0002842 Ga0495648_0002842_12382_13593 395
437 3300046648 Ga0495611_0002205 Ga0495611_0002205_7658_8869 395
438 3300046664 Ga0495659_0002637 Ga0495659_0002637_880_2091 395
439 3300047320 Ga0495672_0012359 Ga0495672_0012359_1101_2312 395
440 3300049459 Ga0495678_001890 Ga0495678_001890_2056_3267 395
441 3300049460 Ga0495682_0011136 Ga0495682_0011136_2068_3279 395
442 3300049577 Ga0501041_0100474 Ga0501041_0100474_432_1670 395
443 3300049578 Ga0501042_0088194 Ga0501042_0088194_109_1341 395
444 3300049591 Ga0501075_0094203 Ga0501075_0094203_934_2166 395
445 3300049741 Ga0501079_0015449 Ga0501079_0015449_3522_4760 395
446 3300060353 Ga0501082_0031019 Ga0501082_0031019_3048_4286 395
447 iso_pu_bacteria 2521172590 2521557167 395
448 iso_pu_bacteria 2599185292 2599902387 395
449 iso_pu_bacteria 2643221594 2643979068 395
450 iso_pu_bacteria 2728369097 2729148161 395
451 iso_pu_bacteria 2808606395 2809036171 395
452 iso_pu_bacteria 2818991449 2819618676 395
453 iso_pu_bacteria 2858950400 2858954849 395
454 iso_pu_bacteria 2897561785 2897562650 395
455 iso_pu_bacteria 2904439833 2904440125 395
456 iso_pu_bacteria 2904584206 2904587428 395
457 iso_pu_bacteria 2904589729 2904592537 395
458 iso_pu_bacteria 2904601388 2904604672 395
459 iso_pu_bacteria 2919079590 2919082502 395
460 iso_pu_bacteria 2919704043 2919704118 395
461 iso_pu_bacteria 2923516293 2923517434 395
462 iso_pu_bacteria 8002869464 8002871195 395
463 iso_pu_bacteria 8056060235 8056061077 395
464 3300005445 Ga0070708_100014220 Ga0070708_1000142204 396
465 3300005467 Ga0070706_100019315 Ga0070706_1000193153 396
466 3300005841 Ga0068863_100032733 Ga0068863_1000327333 396
467 3300025910 Ga0207684_10174831 Ga0207684_101748312 396
468 3300037418 Ga0395900_0006777 Ga0395900_0006777_6809_8077 396
469 3300037466 Ga0395898_0097958 Ga0395898_0097958_1481_2749 396
470 3300037471 Ga0395905_0013434 Ga0395905_0013434_1042_2247 396
471 3300046526 Ga0495666_0012358 Ga0495666_0012358_473_1690 396
472 3300047317 Ga0495604_0005176 Ga0495604_0005176_8805_10022 396
473 3300049569 Ga0501032_0028641 Ga0501032_0028641_2475_3674 396
474 3300049570 Ga0501033_0020588 Ga0501033_0020588_1356_2579 396
475 3300049581 Ga0501047_0050766 Ga0501047_0050766_703_2016 396
476 3300049822 Ga0501035_0037565 Ga0501035_0037565_2704_3927 396
477 3300049823 Ga0501044_0181990 Ga0501044_0181990_136_1377 396
478 iso_pu_bacteria 2522572158 2523105525 396
479 iso_pu_bacteria 2891633521 2891637219 396
480 iso_pu_bacteria 2919476304 2919477959 396
481 iso_pu_bacteria 8002392321 8002392780 396
482 3300005563 Ga0068855_100110310 Ga0068855_1001103104 397
483 3300006051 Ga0075364_10053825 Ga0075364_100538252 397
484 3300006353 Ga0075370_10069306 Ga0075370_100693063 397
485 3300009545 Ga0105237_10016183 Ga0105237_100161834 397
486 3300025949 Ga0207667_10091394 Ga0207667_100913941 397
487 3300046528 Ga0495642_0006479 Ga0495642_0006479_1684_2904 397
488 3300046543 Ga0495645_0036425 Ga0495645_0036425_1177_2400 397
489 3300046684 Ga0495669_0000012 Ga0495669_0000012_106147_107367 397
490 3300049571 Ga0501034_0001709 Ga0501034_0001709_8950_10176 397
491 3300050493 nmdc:mga0k408_41613_c1 nmdc:mga0k408_41613_c1_303_1535 397
492 3300050496 nmdc:mga07m45_13976_c1 nmdc:mga07m45_13976_c1_853_2121 397
493 3300005327 Ga0070658_10015681 Ga0070658_100156815 398
494 3300006028 Ga0070717_10011901 Ga0070717_100119013 398
495 3300031235 Ga0265330_10011296 Ga0265330_100112962 398
496 3300031241 Ga0265325_10013704 Ga0265325_100137042 398
497 3300031249 Ga0265339_10000425 Ga0265339_1000042514 398
498 3300031595 Ga0265313_10000107 Ga0265313_1000010784 398
499 3300031711 Ga0265314_10025974 Ga0265314_100259743 398
500 3300038443 Ga0395901_0000574 Ga0395901_0000574_35788_37212 398
501 3300048929 Ga0496126_0116288 Ga0496126_0116288_139_1380 398
502 3300049572 Ga0501036_0026779 Ga0501036_0026779_3123_4355 398
503 3300049574 Ga0501038_0024830 Ga0501038_0024830_993_2225 398
504 3300049575 Ga0501039_0004707 Ga0501039_0004707_6888_8120 398
505 3300049576 Ga0501040_0006648 Ga0501040_0006648_4471_5703 398
506 3300049577 Ga0501041_0000023 Ga0501041_0000023_15892_17124 398
507 3300049578 Ga0501042_0047504 Ga0501042_0047504_1817_3049 398
508 3300049579 Ga0501043_0045567 Ga0501043_0045567_2120_3352 398
509 3300049580 Ga0501046_0178819 Ga0501046_0178819_337_1569 398
510 3300049581 Ga0501047_0061826 Ga0501047_0061826_1900_3120 398
511 3300049582 Ga0501048_0001216 Ga0501048_0001216_6699_7931 398
512 3300049584 Ga0501068_0075082 Ga0501068_0075082_317_1549 398
513 3300049586 Ga0501070_0014599 Ga0501070_0014599_3362_4582 398
514 3300049587 Ga0501071_0000496 Ga0501071_0000496_11946_13178 398
515 3300049588 Ga0501072_0001424 Ga0501072_0001424_213_1445 398
516 3300049590 Ga0501074_0058718 Ga0501074_0058718_942_2162 398
517 3300049590 Ga0501074_0071397 Ga0501074_0071397_787_2019 398
518 3300049593 Ga0501077_0000714 Ga0501077_0000714_1362_2594 398
519 3300049741 Ga0501079_0000769 Ga0501079_0000769_161_1393 398
520 3300049742 Ga0501080_0005645 Ga0501080_0005645_3164_4384 398
521 3300049743 Ga0501081_0002294 Ga0501081_0002294_337_1569 398
522 3300049744 Ga0501083_0052403 Ga0501083_0052403_593_1825 398
523 3300049823 Ga0501044_0050216 Ga0501044_0050216_1177_2397 398
524 3300049824 Ga0501045_0000975 Ga0501045_0000975_2005_3237 398
525 3300054114 Ga0501084_0000739 Ga0501084_0000739_7043_8275 398
526 3300060353 Ga0501082_0000869 Ga0501082_0000869_7488_8720 398
527 3300061734 Ga0530510_0000323 Ga0530510_0000323_6929_8161 398
528 iso_pu_bacteria 640427133 640488366 398
529 iso_pu_bacteria 651053060 651176401 398
530 3300015261 Ga0182006_1000008 Ga0182006_1000008259 399
531 iso_pu_bacteria 2834641062 2834644616 399
532 iso_pu_bacteria 2870068957 2870070409 399
533 iso_pu_bacteria 2904564687 2904569236 399
534 iso_pu_bacteria 2904571731 2904576456 399
535 iso_pu_bacteria 2928157003 2928161340 399
536 iso_pu_bacteria 2928163908 2928168170 399
537 iso_pu_bacteria 2928536128 2928541634 399
538 iso_pu_bacteria 8003400568 8003404324 399
539 iso_pu_bacteria 8020953355 8020959245 399
540 iso_pu_bacteria 8021120328 8021127229 399
541 3300025960 Ga0207651_10000815 Ga0207651_100008154 400
542 iso_pu_bacteria 2643221621 2644121294 400
543 2162886007 SwRhRL2b_contig_2162838 SwRhRL2b_0770.00006840 401
544 3300005289 Ga0065704_10079600 Ga0065704_100796002 401
545 3300005339 Ga0070660_100000815 Ga0070660_10000081518 401
546 3300005366 Ga0070659_100000637 Ga0070659_1000006376 401
547 3300005455 Ga0070663_100000495 Ga0070663_10000049517 401
548 3300005616 Ga0068852_100090448 Ga0068852_1000904483 401
549 3300006946 Ga0079104_1001730 Ga0079104_100173015 401
550 3300009092 Ga0105250_10002148 Ga0105250_100021483 401
551 3300009551 Ga0105238_10011653 Ga0105238_100116534 401
552 3300010375 Ga0105239_10043880 Ga0105239_100438806 401
553 3300015261 Ga0182006_1038981 Ga0182006_10389812 401
554 3300025273 Ga0209673_1000443 Ga0209673_100044313 401
555 3300025295 Ga0209564_1004985 Ga0209564_10049853 401
556 3300025711 Ga0207696_1003576 Ga0207696_10035762 401
557 3300025919 Ga0207657_10000137 Ga0207657_1000013713 401
558 3300025932 Ga0207690_10000013 Ga0207690_10000013236 401
559 3300026067 Ga0207678_10000119 Ga0207678_1000011912 401
560 3300027111 Ga0209281_1001457 Ga0209281_100145715 401
561 3300046692 Ga0495671_0000066 Ga0495671_0000066_60676_61920 401
562 3300048921 Ga0496118_0148913 Ga0496118_0148913_15_1226 401
563 3300048924 Ga0496121_0008550 Ga0496121_0008550_3627_4838 401
564 iso_pu_bacteria 2981990288 2981993279 401
565 iso_pu_bacteria 641736154 642415616 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02417

Chromate_transp

Chromate transporter

302

470

0.94

PF02417

Chromate_transp

Chromate transporter

87

253

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3378 68 375
5tsa-assembly1.cif.gz_A crystal structure of the zrt-/irt-like protein from bordetella bronchiseptica with bound zn2+ 0.3367 68 375
4yzf-assembly2.cif.gz_C crystal structure of the anion exchanger domain of human erythrocyte band 3 0.3302 6 393
5iof-assembly1.cif.gz_A structure of the transmembrane domain of the transporter slc26dg 0.3253 4 400
5da0-assembly1.cif.gz_A structure of the the slc26 transporter slc26dg in complex with a nanobody 0.3238 4 397
ID Description Score Start End Superfamily
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.3218 14 399 1.20.1740.10
af_P76103_4_381_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.317 14 399 1.20.1740.10
af_A0A1D6LTK4_165_459_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.293 54 357 1.20.1740.10
af_A0A1D6LTK4_165_459_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2822 54 357 1.20.1740.10
af_Q4E277_72_471_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.2742 14 401 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A6F8QPN4-F1-model_v4 Chromate transporter 0.9964 56 401 GO:0005886
GO:0015109
AF-A0A2S9GSM2-F1-model_v4 2A51: chromate transporter, chromate ion transporter (CHR) family 0.9942 10 397 GO:0005886
GO:0015109
AF-A0A5E6T2R0-F1-model_v4 Chromate transport protein 0.9925 6 401 GO:0005886
GO:0015109
AF-A0A387K1P2-F1-model_v4 Chromate ion transporter 0.9911 100 401 GO:0005886
GO:0015109
AF-A0A6F8QPN4-F1-model_v4 Chromate transporter 0.9906 56 401 GO:0005886
GO:0015109

Feature Viewer

pLDDT pTM Quality
91.98 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map