F464261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 290 | 1130 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10000084|Ga0157378_1000008432 |
| Length | 292 |
| Sequence | VDVAARADPAAARREHGRRAATPEGSRLMRQYLELLRHVLEHGDAKSDRTGTGTRSVFGYQMRFDLARGFPLLTTKKLHTKSIVYELLWFLRGETNIGYLNEHGVSIWDEWADAQGELGPVYGKQWRXXXXADGRTIDQISWVIDEIKRNPDSRRLVVSAWNVADLPKMALQPCHALFQFHVANGRLSCQLYQRSADIFLGVPFNIASYALLTHMVAQVCGLRPGDFVHTLGDAHLYNNHVEQAREQLKREPMALPTLKLNPAVRSIFDFSFADIALEGYTAHASIKAPIAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 77 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 166 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 183 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 188 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 217 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 226 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 227 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 228 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 267 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 268 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 269 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 270 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 271 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 272 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 273 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 274 | 2744054655 | Acinetobacter sp. BMW17 | Isolate | Unclassified |
| 275 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 276 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 277 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 278 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 279 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 280 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 281 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 282 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 283 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 284 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 285 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 286 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 287 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 288 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 289 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 290 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.75 |
| Metatranscriptomes | 0 |
| Isolates | 4.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 0 |
| Rhizoplane | 2.83 |
| Rhizosphere | 85.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157378_10000084 | 3300013297 | Bacteria | 87722 |
| 2 | JGI24737J22298_10011344 | 3300001990 | Unclassified | 2922 |
| 3 | JGI24033J26618_1000230 | 3300002155 | Bacteria | 6369 |
| 4 | JGI25162J39368_1000469 | 3300002737 | Bacteria | 31140 |
| 5 | JGI25162J39368_1001913 | 3300002737 | Bacteria | 9539 |
| 6 | JGI25162J39368_1003611 | 3300002737 | Bacteria | 4286 |
| 7 | JGI25157J39369_1001903 | 3300002741 | Bacteria | 6335 |
| 8 | JGI25164J39214_1000269 | 3300002772 | Bacteria | 38654 |
| 9 | JGI25164J39214_1001410 | 3300002772 | Bacteria | 5693 |
| 10 | JGI25151J46595_10001114 | 3300003187 | Bacteria | 19608 |
| 11 | JGI25165J46597_1000535 | 3300003214 | Bacteria | 35299 |
| 12 | Ga0055542_1000234 | 3300003762 | Bacteria | 63993 |
| 13 | Ga0055536_1000007 | 3300003781 | Bacteria | 345133 |
| 14 | Ga0055530_10003348 | 3300003791 | Bacteria | 9192 |
| 15 | Ga0065714_10007410 | 3300005288 | Bacteria | 4701 |
| 16 | Ga0065714_10064842 | 3300005288 | Bacteria | 17197 |
| 17 | Ga0065714_10065235 | 3300005288 | Bacteria | 11538 |
| 18 | Ga0065714_10170270 | 3300005288 | Bacteria | 1000 |
| 19 | Ga0065704_10073689 | 3300005289 | Bacteria | 6842 |
| 20 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 21 | Ga0070658_10014183 | 3300005327 | Bacteria | 6396 |
| 22 | Ga0070658_10322396 | 3300005327 | Bacteria | 1319 |
| 23 | Ga0070676_10002876 | 3300005328 | Bacteria | 8893 |
| 24 | Ga0070683_100640697 | 3300005329 | Bacteria | 1017 |
| 25 | Ga0070670_100069920 | 3300005331 | Bacteria | 3013 |
| 26 | Ga0070670_100127408 | 3300005331 | Bacteria | 2197 |
| 27 | Ga0068869_100007891 | 3300005334 | Bacteria | 6834 |
| 28 | Ga0070666_10001536 | 3300005335 | Bacteria | 14027 |
| 29 | Ga0070666_10027008 | 3300005335 | Bacteria | 3756 |
| 30 | Ga0070666_10090224 | 3300005335 | Bacteria | 2104 |
| 31 | Ga0070666_10197033 | 3300005335 | Bacteria | 1416 |
| 32 | Ga0070666_10374421 | 3300005335 | Bacteria | 1021 |
| 33 | Ga0070680_100125629 | 3300005336 | Bacteria | 2143 |
| 34 | Ga0070680_100233519 | 3300005336 | Bacteria | 1554 |
| 35 | Ga0070682_100066499 | 3300005337 | Bacteria | 2293 |
| 36 | Ga0068868_100048161 | 3300005338 | Bacteria | 3343 |
| 37 | Ga0068868_100175536 | 3300005338 | Bacteria | 1776 |
| 38 | Ga0070660_100015151 | 3300005339 | Bacteria | 5562 |
| 39 | Ga0070660_100045746 | 3300005339 | Bacteria | 3352 |
| 40 | Ga0070660_100201483 | 3300005339 | Bacteria | 1614 |
| 41 | Ga0070689_100031851 | 3300005340 | Bacteria | 4008 |
| 42 | Ga0070661_100051220 | 3300005344 | Bacteria | 3021 |
| 43 | Ga0070692_10007991 | 3300005345 | Bacteria | 4693 |
| 44 | Ga0070692_10047329 | 3300005345 | Bacteria | 2226 |
| 45 | Ga0070669_100165371 | 3300005353 | Bacteria | 1722 |
| 46 | Ga0070675_100313692 | 3300005354 | Bacteria | 1384 |
| 47 | Ga0070675_100381316 | 3300005354 | Bacteria | 1255 |
| 48 | Ga0070671_100169989 | 3300005355 | Bacteria | 1843 |
| 49 | Ga0070673_100104787 | 3300005364 | Bacteria | 2336 |
| 50 | Ga0070688_100078975 | 3300005365 | Bacteria | 2124 |
| 51 | Ga0070659_100064651 | 3300005366 | Bacteria | 2896 |
| 52 | Ga0070659_100178384 | 3300005366 | Bacteria | 1742 |
| 53 | Ga0070667_100021724 | 3300005367 | Bacteria | 5325 |
| 54 | Ga0070667_100065972 | 3300005367 | Bacteria | 3074 |
| 55 | Ga0070667_100182689 | 3300005367 | Bacteria | 1855 |
| 56 | Ga0070667_100634723 | 3300005367 | Bacteria | 986 |
| 57 | Ga0070714_100000020 | 3300005435 | Bacteria | 169262 |
| 58 | Ga0070714_100003124 | 3300005435 | Bacteria | 12300 |
| 59 | Ga0070714_100072138 | 3300005435 | Bacteria | 2989 |
| 60 | Ga0070710_10032553 | 3300005437 | Bacteria | 2825 |
| 61 | Ga0070710_10330168 | 3300005437 | Bacteria | 1004 |
| 62 | Ga0070711_100050995 | 3300005439 | Bacteria | 2840 |
| 63 | Ga0070711_100205295 | 3300005439 | Bacteria | 1523 |
| 64 | Ga0070694_100006352 | 3300005444 | Bacteria | 7170 |
| 65 | Ga0070663_100056138 | 3300005455 | Bacteria | 2821 |
| 66 | Ga0070678_100000238 | 3300005456 | Bacteria | 25199 |
| 67 | Ga0070662_100000343 | 3300005457 | Bacteria | 27936 |
| 68 | Ga0070662_100449081 | 3300005457 | Bacteria | 1070 |
| 69 | Ga0070681_10094279 | 3300005458 | Bacteria | 2942 |
| 70 | Ga0070681_10146007 | 3300005458 | Bacteria | 2294 |
| 71 | Ga0068867_100001894 | 3300005459 | Bacteria | 14557 |
| 72 | Ga0070685_10014301 | 3300005466 | Bacteria | 4201 |
| 73 | Ga0070679_100143552 | 3300005530 | Bacteria | 2366 |
| 74 | Ga0070679_100177553 | 3300005530 | Bacteria | 2102 |
| 75 | Ga0070684_100023894 | 3300005535 | Bacteria | 5121 |
| 76 | Ga0070684_100277736 | 3300005535 | Bacteria | 1534 |
| 77 | Ga0068853_100003732 | 3300005539 | Bacteria | 11684 |
| 78 | Ga0068853_100007643 | 3300005539 | Bacteria | 8663 |
| 79 | Ga0068853_100014673 | 3300005539 | Bacteria | 6426 |
| 80 | Ga0068853_100023924 | 3300005539 | Bacteria | 5119 |
| 81 | Ga0068853_100078383 | 3300005539 | Bacteria | 2887 |
| 82 | Ga0068853_100111450 | 3300005539 | Bacteria | 2431 |
| 83 | Ga0068853_100146195 | 3300005539 | Bacteria | 2125 |
| 84 | Ga0070672_100034725 | 3300005543 | Bacteria | 3829 |
| 85 | Ga0070695_100009050 | 3300005545 | Bacteria | 5920 |
| 86 | Ga0070693_100017659 | 3300005547 | Bacteria | 3713 |
| 87 | Ga0070665_100000026 | 3300005548 | Bacteria | 365176 |
| 88 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 89 | Ga0070665_100045983 | 3300005548 | Bacteria | 4385 |
| 90 | Ga0068855_100011186 | 3300005563 | Bacteria | 10837 |
| 91 | Ga0068855_100045231 | 3300005563 | Bacteria | 5206 |
| 92 | Ga0068855_100242906 | 3300005563 | Bacteria | 2011 |
| 93 | Ga0068855_100244225 | 3300005563 | Bacteria | 2005 |
| 94 | Ga0068855_100428068 | 3300005563 | Bacteria | 1447 |
| 95 | Ga0068855_100531945 | 3300005563 | Bacteria | 1274 |
| 96 | Ga0068855_100621228 | 3300005563 | Bacteria | 1163 |
| 97 | Ga0068857_100076736 | 3300005577 | Bacteria | 2980 |
| 98 | Ga0068856_100007535 | 3300005614 | Bacteria | 10621 |
| 99 | Ga0068856_100027783 | 3300005614 | Bacteria | 5520 |
| 100 | Ga0068856_100382691 | 3300005614 | Bacteria | 1426 |
| 101 | Ga0068856_100507085 | 3300005614 | Bacteria | 1227 |
| 102 | Ga0068852_100000143 | 3300005616 | Bacteria | 48192 |
| 103 | Ga0068852_100016382 | 3300005616 | Bacteria | 5778 |
| 104 | Ga0068852_100082190 | 3300005616 | Bacteria | 2862 |
| 105 | Ga0068864_100000400 | 3300005618 | Bacteria | 37634 |
| 106 | Ga0068864_100321810 | 3300005618 | Bacteria | 1453 |
| 107 | Ga0068864_100463653 | 3300005618 | Bacteria | 1213 |
| 108 | Ga0068863_100027534 | 3300005841 | Bacteria | 5422 |
| 109 | Ga0068863_100027921 | 3300005841 | Bacteria | 5386 |
| 110 | Ga0068863_100584858 | 3300005841 | Bacteria | 1104 |
| 111 | Ga0068863_100587694 | 3300005841 | Bacteria | 1101 |
| 112 | Ga0068863_100684610 | 3300005841 | Bacteria | 1018 |
| 113 | Ga0068862_100197401 | 3300005844 | Bacteria | 1813 |
| 114 | Ga0081455_10294346 | 3300005937 | Bacteria | 1167 |
| 115 | Ga0081455_10307537 | 3300005937 | Bacteria | 1134 |
| 116 | Ga0081540_1011365 | 3300005983 | Bacteria | 5954 |
| 117 | Ga0097621_100000028 | 3300006237 | Bacteria | 71678 |
| 118 | Ga0097621_100032411 | 3300006237 | Bacteria | 4153 |
| 119 | Ga0097621_100049554 | 3300006237 | Bacteria | 3412 |
| 120 | Ga0097621_100126469 | 3300006237 | Bacteria | 2171 |
| 121 | Ga0097621_100159001 | 3300006237 | Bacteria | 1941 |
| 122 | Ga0068871_100000066 | 3300006358 | Bacteria | 57980 |
| 123 | Ga0068871_100010632 | 3300006358 | Bacteria | 6726 |
| 124 | Ga0068871_100103394 | 3300006358 | Bacteria | 2388 |
| 125 | Ga0075428_100002048 | 3300006844 | Bacteria | 21752 |
| 126 | Ga0075428_100072476 | 3300006844 | Bacteria | 3762 |
| 127 | Ga0075430_100034901 | 3300006846 | Bacteria | 4270 |
| 128 | Ga0075431_100000149 | 3300006847 | Bacteria | 47617 |
| 129 | Ga0075429_100000056 | 3300006880 | Bacteria | 53996 |
| 130 | Ga0068865_100000551 | 3300006881 | Bacteria | 20805 |
| 131 | Ga0068865_100001490 | 3300006881 | Bacteria | 13649 |
| 132 | Ga0068865_100216718 | 3300006881 | Bacteria | 1494 |
| 133 | Ga0105244_10031962 | 3300009036 | Bacteria | 2791 |
| 134 | Ga0105240_10007839 | 3300009093 | Bacteria | 15410 |
| 135 | Ga0105240_10012898 | 3300009093 | Bacteria | 11510 |
| 136 | Ga0105240_10013894 | 3300009093 | Bacteria | 11028 |
| 137 | Ga0105240_10019601 | 3300009093 | Bacteria | 9034 |
| 138 | Ga0105240_10053280 | 3300009093 | Bacteria | 5079 |
| 139 | Ga0105245_10024611 | 3300009098 | Bacteria | 5288 |
| 140 | Ga0105241_10000711 | 3300009174 | Bacteria | 25180 |
| 141 | Ga0105241_10002900 | 3300009174 | Bacteria | 12814 |
| 142 | Ga0105242_10006736 | 3300009176 | Bacteria | 8861 |
| 143 | Ga0105242_10106803 | 3300009176 | Bacteria | 2380 |
| 144 | Ga0105242_10136347 | 3300009176 | Bacteria | 2125 |
| 145 | Ga0105242_10641034 | 3300009176 | Bacteria | 1032 |
| 146 | Ga0105248_10024084 | 3300009177 | Bacteria | 6765 |
| 147 | Ga0105237_10000491 | 3300009545 | Bacteria | 56127 |
| 148 | Ga0105237_10001267 | 3300009545 | Bacteria | 33722 |
| 149 | Ga0105237_10006108 | 3300009545 | Bacteria | 13461 |
| 150 | Ga0105237_10035158 | 3300009545 | Bacteria | 5071 |
| 151 | Ga0105238_10010062 | 3300009551 | Bacteria | 9488 |
| 152 | Ga0105238_10013627 | 3300009551 | Bacteria | 8212 |
| 153 | Ga0105238_10020069 | 3300009551 | Bacteria | 6802 |
| 154 | Ga0105238_10035576 | 3300009551 | Bacteria | 5062 |
| 155 | Ga0105238_10297896 | 3300009551 | Bacteria | 1596 |
| 156 | Ga0105238_10422321 | 3300009551 | Bacteria | 1328 |
| 157 | Ga0105238_10881303 | 3300009551 | Bacteria | 913 |
| 158 | Ga0105249_10025357 | 3300009553 | Bacteria | 5337 |
| 159 | Ga0099796_10000261 | 3300010159 | Bacteria | 8345 |
| 160 | Ga0105239_10005993 | 3300010375 | Bacteria | 14144 |
| 161 | Ga0105239_10007020 | 3300010375 | Bacteria | 12963 |
| 162 | Ga0105239_10043959 | 3300010375 | Bacteria | 4899 |
| 163 | Ga0105239_10065055 | 3300010375 | Bacteria | 4004 |
| 164 | Ga0105239_10335422 | 3300010375 | Bacteria | 1706 |
| 165 | Ga0157373_10013395 | 3300013100 | Bacteria | 6016 |
| 166 | Ga0157371_10000901 | 3300013102 | Bacteria | 33476 |
| 167 | Ga0157370_10004580 | 3300013104 | Bacteria | 15829 |
| 168 | Ga0157370_10011717 | 3300013104 | Bacteria | 9154 |
| 169 | Ga0157370_10012867 | 3300013104 | Bacteria | 8651 |
| 170 | Ga0157370_10017982 | 3300013104 | Bacteria | 7116 |
| 171 | Ga0157370_10034372 | 3300013104 | Bacteria | 4938 |
| 172 | Ga0157370_10131866 | 3300013104 | Bacteria | 2331 |
| 173 | Ga0157370_10152324 | 3300013104 | Bacteria | 2151 |
| 174 | Ga0157370_10215150 | 3300013104 | Bacteria | 1780 |
| 175 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 176 | Ga0157369_10000030 | 3300013105 | Bacteria | 203569 |
| 177 | Ga0157369_10046414 | 3300013105 | Bacteria | 4721 |
| 178 | Ga0157369_10187559 | 3300013105 | Bacteria | 2174 |
| 179 | Ga0157369_10328418 | 3300013105 | Bacteria | 1589 |
| 180 | Ga0157374_10000174 | 3300013296 | Bacteria | 59597 |
| 181 | Ga0157374_10001861 | 3300013296 | Bacteria | 17768 |
| 182 | Ga0157374_10015286 | 3300013296 | Bacteria | 6730 |
| 183 | Ga0157374_10067873 | 3300013296 | Bacteria | 3354 |
| 184 | Ga0157378_10013832 | 3300013297 | Bacteria | 7057 |
| 185 | Ga0157378_10055544 | 3300013297 | Bacteria | 3528 |
| 186 | Ga0163162_10000007 | 3300013306 | Bacteria | 368084 |
| 187 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 188 | Ga0163162_10007761 | 3300013306 | Bacteria | 10455 |
| 189 | Ga0157372_10008558 | 3300013307 | Bacteria | 10867 |
| 190 | Ga0157372_10027310 | 3300013307 | Bacteria | 6215 |
| 191 | Ga0157372_10050841 | 3300013307 | Bacteria | 4610 |
| 192 | Ga0157372_10220280 | 3300013307 | Bacteria | 2200 |
| 193 | Ga0157372_10309327 | 3300013307 | Bacteria | 1839 |
| 194 | Ga0157375_10005772 | 3300013308 | Bacteria | 10770 |
| 195 | Ga0157375_10030316 | 3300013308 | Bacteria | 5099 |
| 196 | Ga0163163_10000300 | 3300014325 | Bacteria | 48781 |
| 197 | Ga0163163_10013575 | 3300014325 | Bacteria | 7461 |
| 198 | Ga0163163_10407115 | 3300014325 | Bacteria | 1419 |
| 199 | Ga0157380_10302629 | 3300014326 | Bacteria | 1474 |
| 200 | Ga0182008_10000130 | 3300014497 | Bacteria | 57208 |
| 201 | Ga0182008_10001316 | 3300014497 | Bacteria | 16944 |
| 202 | Ga0182008_10028841 | 3300014497 | Bacteria | 2806 |
| 203 | Ga0182008_10033522 | 3300014497 | Bacteria | 2576 |
| 204 | Ga0182008_10036206 | 3300014497 | Bacteria | 2470 |
| 205 | Ga0182008_10073328 | 3300014497 | Bacteria | 1684 |
| 206 | Ga0157377_10044175 | 3300014745 | Bacteria | 2483 |
| 207 | Ga0157379_10005114 | 3300014968 | Bacteria | 11247 |
| 208 | Ga0157376_10006575 | 3300014969 | Bacteria | 8226 |
| 209 | Ga0157376_10014791 | 3300014969 | Bacteria | 5873 |
| 210 | Ga0157376_10117075 | 3300014969 | Bacteria | 2355 |
| 211 | Ga0182006_1001053 | 3300015261 | Bacteria | 17809 |
| 212 | Ga0182006_1001108 | 3300015261 | Bacteria | 17182 |
| 213 | Ga0182006_1002573 | 3300015261 | Bacteria | 9833 |
| 214 | Ga0182006_1004766 | 3300015261 | Bacteria | 6614 |
| 215 | Ga0182006_1018359 | 3300015261 | Bacteria | 2957 |
| 216 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 217 | Ga0182007_10002352 | 3300015262 | Bacteria | 9470 |
| 218 | Ga0182007_10030385 | 3300015262 | Bacteria | 1847 |
| 219 | Ga0183373_1005 | 3300015682 | Bacteria | 351562 |
| 220 | Ga0163161_10000206 | 3300017792 | Bacteria | 54119 |
| 221 | Ga0163161_10000729 | 3300017792 | Bacteria | 25879 |
| 222 | Ga0163161_10010548 | 3300017792 | Bacteria | 6399 |
| 223 | Ga0209672_100411 | 3300025228 | Bacteria | 25324 |
| 224 | Ga0207427_100157 | 3300025231 | Bacteria | 77115 |
| 225 | Ga0207427_100235 | 3300025231 | Bacteria | 45748 |
| 226 | Ga0207427_102188 | 3300025231 | Bacteria | 5545 |
| 227 | Ga0209437_100202 | 3300025233 | Bacteria | 118709 |
| 228 | Ga0209437_100223 | 3300025233 | Bacteria | 102763 |
| 229 | Ga0209437_100254 | 3300025233 | Bacteria | 83422 |
| 230 | Ga0209646_1002295 | 3300025246 | Bacteria | 4357 |
| 231 | Ga0209026_1000077 | 3300025250 | Bacteria | 200561 |
| 232 | Ga0209026_1000139 | 3300025250 | Bacteria | 115298 |
| 233 | Ga0209026_1002607 | 3300025250 | Bacteria | 6606 |
| 234 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 235 | Ga0209759_1008551 | 3300025256 | Bacteria | 3178 |
| 236 | Ga0209759_1010910 | 3300025256 | Bacteria | 2626 |
| 237 | Ga0209759_1015662 | 3300025256 | Bacteria | 1947 |
| 238 | Ga0209233_1000252 | 3300025261 | Bacteria | 83708 |
| 239 | Ga0209233_1000272 | 3300025261 | Bacteria | 73393 |
| 240 | Ga0209233_1007249 | 3300025261 | Bacteria | 3526 |
| 241 | Ga0209455_1000188 | 3300025272 | Bacteria | 92883 |
| 242 | Ga0209455_1017598 | 3300025272 | Bacteria | 1493 |
| 243 | Ga0209676_1000058 | 3300025292 | Bacteria | 345185 |
| 244 | Ga0209050_1000054 | 3300025298 | Bacteria | 345186 |
| 245 | Ga0207655_1076569 | 3300025728 | Bacteria | 1223 |
| 246 | Ga0207692_10051132 | 3300025898 | Bacteria | 2094 |
| 247 | Ga0207680_10001173 | 3300025903 | Bacteria | 12356 |
| 248 | Ga0207680_10174137 | 3300025903 | Bacteria | 1451 |
| 249 | Ga0207647_10000328 | 3300025904 | Bacteria | 38905 |
| 250 | Ga0207647_10014181 | 3300025904 | Bacteria | 5501 |
| 251 | Ga0207699_10008828 | 3300025906 | Bacteria | 4993 |
| 252 | Ga0207645_10000190 | 3300025907 | Bacteria | 49657 |
| 253 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 254 | Ga0207705_10024735 | 3300025909 | Bacteria | 4285 |
| 255 | Ga0207705_10127950 | 3300025909 | Bacteria | 1889 |
| 256 | Ga0207654_10000978 | 3300025911 | Bacteria | 15688 |
| 257 | Ga0207654_10110661 | 3300025911 | Bacteria | 1708 |
| 258 | Ga0207707_10020119 | 3300025912 | Bacteria | 5825 |
| 259 | Ga0207707_10223795 | 3300025912 | Bacteria | 1638 |
| 260 | Ga0207695_10000112 | 3300025913 | Bacteria | 248037 |
| 261 | Ga0207695_10000420 | 3300025913 | Bacteria | 94361 |
| 262 | Ga0207695_10002721 | 3300025913 | Bacteria | 25814 |
| 263 | Ga0207695_10005336 | 3300025913 | Bacteria | 17109 |
| 264 | Ga0207695_10008101 | 3300025913 | Bacteria | 13214 |
| 265 | Ga0207695_10026795 | 3300025913 | Bacteria | 6428 |
| 266 | Ga0207671_10000610 | 3300025914 | Bacteria | 47260 |
| 267 | Ga0207671_10001525 | 3300025914 | Bacteria | 26570 |
| 268 | Ga0207671_10021503 | 3300025914 | Bacteria | 4892 |
| 269 | Ga0207671_10023748 | 3300025914 | Bacteria | 4620 |
| 270 | Ga0207671_10484671 | 3300025914 | Bacteria | 986 |
| 271 | Ga0207657_10009926 | 3300025919 | Bacteria | 9528 |
| 272 | Ga0207657_10196289 | 3300025919 | Bacteria | 1626 |
| 273 | Ga0207649_10010149 | 3300025920 | Bacteria | 5169 |
| 274 | Ga0207649_10137775 | 3300025920 | Bacteria | 1666 |
| 275 | Ga0207652_10009487 | 3300025921 | Bacteria | 7824 |
| 276 | Ga0207694_10003531 | 3300025924 | Bacteria | 12413 |
| 277 | Ga0207694_10010134 | 3300025924 | Bacteria | 7103 |
| 278 | Ga0207694_10011279 | 3300025924 | Bacteria | 6748 |
| 279 | Ga0207694_10114396 | 3300025924 | Bacteria | 2149 |
| 280 | Ga0207694_10158399 | 3300025924 | Bacteria | 1828 |
| 281 | Ga0207694_10342961 | 3300025924 | Bacteria | 1235 |
| 282 | Ga0207694_10489904 | 3300025924 | Bacteria | 1029 |
| 283 | Ga0207650_10159495 | 3300025925 | Bacteria | 1786 |
| 284 | Ga0207659_10088480 | 3300025926 | Bacteria | 2307 |
| 285 | Ga0207687_10081650 | 3300025927 | Bacteria | 2337 |
| 286 | Ga0207664_10000023 | 3300025929 | Bacteria | 204730 |
| 287 | Ga0207664_10002288 | 3300025929 | Bacteria | 12631 |
| 288 | Ga0207664_10428387 | 3300025929 | Bacteria | 1179 |
| 289 | Ga0207644_10079343 | 3300025931 | Bacteria | 2422 |
| 290 | Ga0207690_10008974 | 3300025932 | Bacteria | 5934 |
| 291 | Ga0207690_10009308 | 3300025932 | Bacteria | 5836 |
| 292 | Ga0207690_10009401 | 3300025932 | Bacteria | 5806 |
| 293 | Ga0207690_10125842 | 3300025932 | Bacteria | 1868 |
| 294 | Ga0207706_10000778 | 3300025933 | Bacteria | 33033 |
| 295 | Ga0207706_10078895 | 3300025933 | Bacteria | 2896 |
| 296 | Ga0207670_10021106 | 3300025936 | Bacteria | 4013 |
| 297 | Ga0207704_10000073 | 3300025938 | Bacteria | 62449 |
| 298 | Ga0207704_10009480 | 3300025938 | Bacteria | 4700 |
| 299 | Ga0207691_10034462 | 3300025940 | Bacteria | 4707 |
| 300 | Ga0207691_10201572 | 3300025940 | Bacteria | 1731 |
| 301 | Ga0207711_10023332 | 3300025941 | Bacteria | 5178 |
| 302 | Ga0207689_10043784 | 3300025942 | Bacteria | 3700 |
| 303 | Ga0207689_10233228 | 3300025942 | Bacteria | 1521 |
| 304 | Ga0207689_10257361 | 3300025942 | Bacteria | 1444 |
| 305 | Ga0207661_10263782 | 3300025944 | Bacteria | 1535 |
| 306 | Ga0207667_10015380 | 3300025949 | Bacteria | 8697 |
| 307 | Ga0207667_10029739 | 3300025949 | Bacteria | 5919 |
| 308 | Ga0207667_10031421 | 3300025949 | Bacteria | 5732 |
| 309 | Ga0207667_10054676 | 3300025949 | Bacteria | 4199 |
| 310 | Ga0207667_10147481 | 3300025949 | Bacteria | 2422 |
| 311 | Ga0207667_10200120 | 3300025949 | Bacteria | 2049 |
| 312 | Ga0207667_10208566 | 3300025949 | Bacteria | 2003 |
| 313 | Ga0207667_10368217 | 3300025949 | Bacteria | 1465 |
| 314 | Ga0207651_10037053 | 3300025960 | Bacteria | 3191 |
| 315 | Ga0207651_10118923 | 3300025960 | Bacteria | 2000 |
| 316 | Ga0207712_10114882 | 3300025961 | Bacteria | 2025 |
| 317 | Ga0207712_10124825 | 3300025961 | Bacteria | 1953 |
| 318 | Ga0207668_10205100 | 3300025972 | Bacteria | 1573 |
| 319 | Ga0207668_10282012 | 3300025972 | Bacteria | 1363 |
| 320 | Ga0207640_10021706 | 3300025981 | Bacteria | 3830 |
| 321 | Ga0207658_10343012 | 3300025986 | Bacteria | 1299 |
| 322 | Ga0207677_10031213 | 3300026023 | Bacteria | 3411 |
| 323 | Ga0207677_10070131 | 3300026023 | Bacteria | 2468 |
| 324 | Ga0207677_10387821 | 3300026023 | Bacteria | 1181 |
| 325 | Ga0207639_10001388 | 3300026041 | Bacteria | 16358 |
| 326 | Ga0207639_10002746 | 3300026041 | Bacteria | 11813 |
| 327 | Ga0207639_10012095 | 3300026041 | Bacteria | 6003 |
| 328 | Ga0207639_10044708 | 3300026041 | Bacteria | 3332 |
| 329 | Ga0207639_10063212 | 3300026041 | Bacteria | 2865 |
| 330 | Ga0207639_10091876 | 3300026041 | Bacteria | 2431 |
| 331 | Ga0207639_10233769 | 3300026041 | Bacteria | 1595 |
| 332 | Ga0207678_10099852 | 3300026067 | Bacteria | 2479 |
| 333 | Ga0207678_10118529 | 3300026067 | Bacteria | 2259 |
| 334 | Ga0207678_10255147 | 3300026067 | Bacteria | 1502 |
| 335 | Ga0207702_10010549 | 3300026078 | Bacteria | 7724 |
| 336 | Ga0207702_10145112 | 3300026078 | Bacteria | 2153 |
| 337 | Ga0207641_10023324 | 3300026088 | Bacteria | 5099 |
| 338 | Ga0207641_10483410 | 3300026088 | Bacteria | 1200 |
| 339 | Ga0207648_10000529 | 3300026089 | Bacteria | 42805 |
| 340 | Ga0207674_10008653 | 3300026116 | Bacteria | 11724 |
| 341 | Ga0207674_10043602 | 3300026116 | Bacteria | 4625 |
| 342 | Ga0207674_10070147 | 3300026116 | Bacteria | 3523 |
| 343 | Ga0207675_100125328 | 3300026118 | Bacteria | 2433 |
| 344 | Ga0207683_10000805 | 3300026121 | Bacteria | 28690 |
| 345 | Ga0207683_10002525 | 3300026121 | Bacteria | 15981 |
| 346 | Ga0207683_10163804 | 3300026121 | Bacteria | 2011 |
| 347 | Ga0207698_10009007 | 3300026142 | Bacteria | 6338 |
| 348 | Ga0207698_10359039 | 3300026142 | Bacteria | 1379 |
| 349 | Ga0209179_1000117 | 3300027512 | Bacteria | 9238 |
| 350 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 351 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 352 | Ga0268266_10059539 | 3300028379 | Bacteria | 3291 |
| 353 | Ga0268265_10785618 | 3300028380 | Bacteria | 927 |
| 354 | Ga0268264_10019055 | 3300028381 | Bacteria | 5610 |
| 355 | Ga0268264_10072368 | 3300028381 | Bacteria | 2923 |
| 356 | Ga0307517_10013529 | 3300028786 | Bacteria | 11068 |
| 357 | Ga0265338_10057002 | 3300028800 | Bacteria | 3459 |
| 358 | Ga0265330_10034901 | 3300031235 | Bacteria | 2246 |
| 359 | Ga0265329_10043181 | 3300031242 | Bacteria | 1442 |
| 360 | Ga0265340_10138090 | 3300031247 | Bacteria | 1115 |
| 361 | Ga0265327_10135530 | 3300031251 | Bacteria | 1155 |
| 362 | Ga0265316_10005008 | 3300031344 | Bacteria | 13006 |
| 363 | Ga0265316_10011591 | 3300031344 | Bacteria | 7940 |
| 364 | Ga0307508_10191748 | 3300031616 | Bacteria | 1645 |
| 365 | Ga0265314_10032095 | 3300031711 | Bacteria | 3868 |
| 366 | Ga0265342_10021327 | 3300031712 | Bacteria | 4141 |
| 367 | Ga0307516_10155497 | 3300031730 | Bacteria | 2042 |
| 368 | Ga0307405_10000035 | 3300031731 | Bacteria | 92134 |
| 369 | Ga0307407_10000005 | 3300031903 | Bacteria | 233125 |
| 370 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 371 | Ga0307414_10059586 | 3300032004 | Bacteria | 2696 |
| 372 | Ga0307510_10001230 | 3300033180 | Bacteria | 27766 |
| 373 | Ga0373923_0038834 | 3300035111 | Bacteria | 1953 |
| 374 | Ga0373941_0055731 | 3300035115 | Bacteria | 1271 |
| 375 | Ga0373933_0058761 | 3300035724 | Bacteria | 2314 |
| 376 | Ga0373937_0133311 | 3300036401 | Bacteria | 2321 |
| 377 | Ga0373937_0353219 | 3300036401 | Bacteria | 1393 |
| 378 | Ga0373925_0049340 | 3300037068 | Bacteria | 3138 |
| 379 | Ga0395899_0000592 | 3300037312 | Bacteria | 38093 |
| 380 | Ga0395899_0131446 | 3300037312 | Bacteria | 1787 |
| 381 | Ga0395900_0000277 | 3300037418 | Bacteria | 77256 |
| 382 | Ga0395900_0070533 | 3300037418 | Bacteria | 3593 |
| 383 | Ga0395898_0014807 | 3300037466 | Bacteria | 8006 |
| 384 | Ga0395905_0000068 | 3300037471 | Bacteria | 177163 |
| 385 | Ga0395905_0000727 | 3300037471 | Bacteria | 43437 |
| 386 | Ga0395905_0158649 | 3300037471 | Bacteria | 2127 |
| 387 | Ga0395901_0000199 | 3300038443 | Bacteria | 76415 |
| 388 | Ga0395901_0005884 | 3300038443 | Bacteria | 12410 |
| 389 | Ga0436365_0192168 | 3300039437 | Bacteria | 4325 |
| 390 | Ga0436361_0399615 | 3300039447 | Bacteria | 11828 |
| 391 | Ga0436363_1567754 | 3300039450 | Bacteria | 1650 |
| 392 | Ga0451793_1089417 | 3300041452 | Bacteria | 1284 |
| 393 | Ga0439448_0018148 | 3300042005 | Bacteria | 2153 |
| 394 | Ga0466972_0002599 | 3300044658 | Bacteria | 8954 |
| 395 | Ga0466963_0281646 | 3300044694 | Bacteria | 1168 |
| 396 | Ga0453684_0000159 | 3300044712 | Bacteria | 300297 |
| 397 | Ga0453684_0001394 | 3300044712 | Bacteria | 69957 |
| 398 | Ga0451576_0000401 | 3300045051 | Bacteria | 101008 |
| 399 | Ga0495629_0063328 | 3300046459 | Bacteria | 2583 |
| 400 | Ga0495638_0000608 | 3300046460 | Bacteria | 40068 |
| 401 | Ga0495650_0000561 | 3300046471 | Bacteria | 52692 |
| 402 | Ga0495580_0116580 | 3300046472 | Bacteria | 1855 |
| 403 | Ga0495582_0029671 | 3300046473 | Bacteria | 3002 |
| 404 | Ga0495594_0249578 | 3300046499 | Bacteria | 1011 |
| 405 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 406 | Ga0495606_0285228 | 3300046507 | Bacteria | 901 |
| 407 | Ga0495610_0000074 | 3300046512 | Bacteria | 120043 |
| 408 | Ga0495610_0000405 | 3300046512 | Bacteria | 44184 |
| 409 | Ga0495630_0183432 | 3300046517 | Bacteria | 1596 |
| 410 | Ga0495631_0003046 | 3300046518 | Bacteria | 9261 |
| 411 | Ga0495637_0075320 | 3300046520 | Bacteria | 1354 |
| 412 | Ga0495640_0268553 | 3300046533 | Bacteria | 1064 |
| 413 | Ga0495622_0159679 | 3300046557 | Bacteria | 1017 |
| 414 | Ga0495668_0145201 | 3300046616 | Bacteria | 1299 |
| 415 | Ga0495634_0162232 | 3300046642 | Bacteria | 1409 |
| 416 | Ga0495625_0116004 | 3300046660 | Bacteria | 1827 |
| 417 | Ga0495649_0001113 | 3300046694 | Bacteria | 20936 |
| 418 | Ga0495649_0031994 | 3300046694 | Bacteria | 2900 |
| 419 | Ga0495674_0133103 | 3300047319 | Bacteria | 2094 |
| 420 | Ga0495680_0003790 | 3300047322 | Bacteria | 14700 |
| 421 | Ga0495683_0083142 | 3300047323 | Bacteria | 1559 |
| 422 | Ga0495681_0025230 | 3300047470 | Bacteria | 3113 |
| 423 | Ga0495684_0047798 | 3300047471 | Bacteria | 3272 |
| 424 | Ga0495686_0000034 | 3300047472 | Bacteria | 325038 |
| 425 | Ga0496101_0714763 | 3300048904 | Bacteria | 791 |
| 426 | Ga0496102_0098583 | 3300048905 | Bacteria | 2712 |
| 427 | Ga0496103_0013055 | 3300048906 | Bacteria | 4925 |
| 428 | Ga0496104_0000041 | 3300048907 | Bacteria | 161394 |
| 429 | Ga0496104_0084089 | 3300048907 | Bacteria | 3036 |
| 430 | Ga0496105_0000022 | 3300048908 | Bacteria | 161208 |
| 431 | Ga0496109_0430585 | 3300048912 | Bacteria | 1246 |
| 432 | Ga0496110_0010940 | 3300048913 | Bacteria | 7400 |
| 433 | Ga0496110_0228291 | 3300048913 | Bacteria | 1693 |
| 434 | Ga0496111_0069550 | 3300048914 | Bacteria | 2560 |
| 435 | Ga0496113_0297173 | 3300048916 | Bacteria | 1293 |
| 436 | Ga0496114_0114596 | 3300048917 | Bacteria | 2312 |
| 437 | Ga0496114_0416734 | 3300048917 | Bacteria | 1189 |
| 438 | Ga0496115_0000741 | 3300048918 | Bacteria | 24104 |
| 439 | Ga0496115_0182626 | 3300048918 | Bacteria | 1734 |
| 440 | Ga0496118_0001034 | 3300048921 | Bacteria | 43301 |
| 441 | Ga0496118_0046777 | 3300048921 | Bacteria | 3361 |
| 442 | Ga0496118_0133339 | 3300048921 | Bacteria | 1590 |
| 443 | Ga0496122_0000390 | 3300048925 | Bacteria | 93522 |
| 444 | Ga0496124_0000001 | 3300048927 | Bacteria | 1747840 |
| 445 | Ga0496126_0003719 | 3300048929 | Bacteria | 19023 |
| 446 | Ga0496126_0035815 | 3300048929 | Bacteria | 4646 |
| 447 | Ga0495678_018456 | 3300049459 | Bacteria | 3136 |
| 448 | Ga0501031_0000726 | 3300049568 | Bacteria | 19747 |
| 449 | Ga0501031_0017984 | 3300049568 | Bacteria | 4598 |
| 450 | Ga0501032_0004918 | 3300049569 | Bacteria | 9996 |
| 451 | Ga0501032_0038006 | 3300049569 | Bacteria | 3280 |
| 452 | Ga0501033_0000673 | 3300049570 | Bacteria | 31522 |
| 453 | Ga0501033_0021334 | 3300049570 | Bacteria | 4885 |
| 454 | Ga0501033_0122033 | 3300049570 | Bacteria | 1890 |
| 455 | Ga0501034_0004751 | 3300049571 | Bacteria | 15037 |
| 456 | Ga0501034_0005765 | 3300049571 | Bacteria | 13466 |
| 457 | Ga0501034_0036202 | 3300049571 | Bacteria | 5001 |
| 458 | Ga0501034_0124385 | 3300049571 | Bacteria | 2564 |
| 459 | Ga0501034_0279379 | 3300049571 | Bacteria | 1609 |
| 460 | Ga0501034_0311986 | 3300049571 | Bacteria | 1507 |
| 461 | Ga0501036_0004254 | 3300049572 | Bacteria | 11545 |
| 462 | Ga0501036_0013764 | 3300049572 | Bacteria | 6729 |
| 463 | Ga0501037_0000547 | 3300049573 | Bacteria | 29890 |
| 464 | Ga0501037_0011223 | 3300049573 | Bacteria | 6594 |
| 465 | Ga0501037_0021831 | 3300049573 | Bacteria | 4738 |
| 466 | Ga0501037_0039989 | 3300049573 | Bacteria | 3451 |
| 467 | Ga0501038_0002529 | 3300049574 | Bacteria | 17046 |
| 468 | Ga0501038_0002643 | 3300049574 | Bacteria | 16763 |
| 469 | Ga0501038_0125528 | 3300049574 | Bacteria | 2112 |
| 470 | Ga0501038_0139616 | 3300049574 | Bacteria | 1983 |
| 471 | Ga0501038_0152039 | 3300049574 | Bacteria | 1886 |
| 472 | Ga0501040_0037723 | 3300049576 | Bacteria | 3284 |
| 473 | Ga0501042_0401520 | 3300049578 | Bacteria | 993 |
| 474 | Ga0501043_0040368 | 3300049579 | Bacteria | 3667 |
| 475 | Ga0501043_0063952 | 3300049579 | Bacteria | 2889 |
| 476 | Ga0501043_0165722 | 3300049579 | Bacteria | 1725 |
| 477 | Ga0501043_0233421 | 3300049579 | Bacteria | 1420 |
| 478 | Ga0501046_0001515 | 3300049580 | Bacteria | 22165 |
| 479 | Ga0501046_0002948 | 3300049580 | Bacteria | 15741 |
| 480 | Ga0501046_0011428 | 3300049580 | Bacteria | 7589 |
| 481 | Ga0501046_0098644 | 3300049580 | Bacteria | 2243 |
| 482 | Ga0501046_0301751 | 3300049580 | Bacteria | 1169 |
| 483 | Ga0501047_0004941 | 3300049581 | Bacteria | 12519 |
| 484 | Ga0501047_0012974 | 3300049581 | Bacteria | 7889 |
| 485 | Ga0501047_0039508 | 3300049581 | Bacteria | 4563 |
| 486 | Ga0501047_0074521 | 3300049581 | Bacteria | 3267 |
| 487 | Ga0501047_0113644 | 3300049581 | Bacteria | 2590 |
| 488 | Ga0501047_0179651 | 3300049581 | Bacteria | 1983 |
| 489 | Ga0501047_0500318 | 3300049581 | Bacteria | 1042 |
| 490 | Ga0501048_0035796 | 3300049582 | Bacteria | 3570 |
| 491 | Ga0501067_0003237 | 3300049583 | Bacteria | 8966 |
| 492 | Ga0501068_0027067 | 3300049584 | Bacteria | 3383 |
| 493 | Ga0501068_0069886 | 3300049584 | Bacteria | 2141 |
| 494 | Ga0501068_0069947 | 3300049584 | Bacteria | 2140 |
| 495 | Ga0501068_0218157 | 3300049584 | Bacteria | 1212 |
| 496 | Ga0501069_0019537 | 3300049585 | Bacteria | 3665 |
| 497 | Ga0501070_0157583 | 3300049586 | Bacteria | 1872 |
| 498 | Ga0501070_0299349 | 3300049586 | Bacteria | 1310 |
| 499 | Ga0501071_0024266 | 3300049587 | Bacteria | 4240 |
| 500 | Ga0501072_0136022 | 3300049588 | Bacteria | 1959 |
| 501 | Ga0501073_0007940 | 3300049589 | Bacteria | 7873 |
| 502 | Ga0501073_0119722 | 3300049589 | Bacteria | 1824 |
| 503 | Ga0501074_0002514 | 3300049590 | Bacteria | 12788 |
| 504 | Ga0501074_0017788 | 3300049590 | Bacteria | 5164 |
| 505 | Ga0501074_0055716 | 3300049590 | Bacteria | 2849 |
| 506 | Ga0501074_0209862 | 3300049590 | Bacteria | 1387 |
| 507 | Ga0501079_0074175 | 3300049741 | Bacteria | 2630 |
| 508 | Ga0501080_0013902 | 3300049742 | Bacteria | 7409 |
| 509 | Ga0501080_0015585 | 3300049742 | Bacteria | 7010 |
| 510 | Ga0501080_0020208 | 3300049742 | Bacteria | 6164 |
| 511 | Ga0501080_0026080 | 3300049742 | Bacteria | 5429 |
| 512 | Ga0501080_0052431 | 3300049742 | Bacteria | 3796 |
| 513 | Ga0501080_0164670 | 3300049742 | Bacteria | 2047 |
| 514 | Ga0501080_0190715 | 3300049742 | Bacteria | 1883 |
| 515 | Ga0501083_0009807 | 3300049744 | Bacteria | 6760 |
| 516 | Ga0501035_0013506 | 3300049822 | Bacteria | 7537 |
| 517 | Ga0501035_0026004 | 3300049822 | Bacteria | 5361 |
| 518 | Ga0501044_0005212 | 3300049823 | Bacteria | 14469 |
| 519 | Ga0501044_0006789 | 3300049823 | Bacteria | 12615 |
| 520 | Ga0501044_0014071 | 3300049823 | Bacteria | 8640 |
| 521 | Ga0501044_0064298 | 3300049823 | Bacteria | 3746 |
| 522 | Ga0501044_0078926 | 3300049823 | Bacteria | 3336 |
| 523 | Ga0501044_0147142 | 3300049823 | Bacteria | 2340 |
| 524 | Ga0501044_0242118 | 3300049823 | Bacteria | 1747 |
| 525 | Ga0501045_0017680 | 3300049824 | Bacteria | 5063 |
| 526 | nmdc:mga05p37_160244_c1 | 3300050507 | Bacteria | 2748 |
| 527 | nmdc:mga09592_4282_c1 | 3300050508 | Bacteria | 11531 |
| 528 | nmdc:mga08y16_763574_c1 | 3300050511 | Bacteria | 962 |
| 529 | Ga0495612_0033652 | 3300053078 | Bacteria | 2074 |
| 530 | Ga0500644_0000718 | 3300053088 | Bacteria | 11724 |
| 531 | Ga0500651_0000183 | 3300053093 | Bacteria | 40305 |
| 532 | Ga0500651_0002980 | 3300053093 | Bacteria | 9126 |
| 533 | Ga0500651_0012667 | 3300053093 | Bacteria | 5116 |
| 534 | Ga0500568_0000844 | 3300053139 | Bacteria | 21551 |
| 535 | Ga0500634_0138442 | 3300053161 | Bacteria | 1157 |
| 536 | Ga0501084_0000690 | 3300054114 | Bacteria | 25838 |
| 537 | Ga0501084_0014880 | 3300054114 | Bacteria | 6452 |
| 538 | Ga0501084_0017566 | 3300054114 | Bacteria | 5950 |
| 539 | Ga0501082_0000275 | 3300060353 | Bacteria | 45431 |
| 540 | Ga0501082_0079210 | 3300060353 | Bacteria | 2834 |
| 541 | Ga0530510_0128554 | 3300061734 | Bacteria | 1863 |
| 542 | 2586208513 | 2585427687 | Bacteria | 5544917 |
| 543 | 2738856660 | 2738541302 | Bacteria | 5944758 |
| 544 | 2739301795 | 2738543023 | Bacteria | 6767879 |
| 545 | 2739590106 | 2739367651 | Bacteria | 6359826 |
| 546 | 2739615343 | 2739367656 | Bacteria | 5152243 |
| 547 | 2739644307 | 2739367663 | Bacteria | 5040914 |
| 548 | 2739730027 | 2739367700 | Bacteria | 4747630 |
| 549 | 2745162257 | 2744054655 | Bacteria | 3552603 |
| 550 | 2819548505 | 2818991437 | Bacteria | 5805520 |
| 551 | 2842722921 | 2842722452 | Bacteria | 6263924 |
| 552 | 2842913336 | 2842909656 | Bacteria | 6185908 |
| 553 | 2849286663 | 2849281842 | Bacteria | 6065644 |
| 554 | 2852627730 | 2852627209 | Bacteria | 5896285 |
| 555 | 2884414226 | 2884411467 | Bacteria | 5246714 |
| 556 | 2889308810 | 2889306138 | Bacteria | 6358934 |
| 557 | 2895397191 | 2895395659 | Bacteria | 3983269 |
| 558 | 2904448510 | 2904445276 | Bacteria | 5310396 |
| 559 | 2917704800 | 2917699015 | Bacteria | 7043791 |
| 560 | 2919187907 | 2919186247 | Bacteria | 6244071 |
| 561 | 2928965775 | 2928963466 | Bacteria | 5165703 |
| 562 | 2939612821 | 2939611941 | Bacteria | 3892017 |
| 563 | 2945999884 | 2945997725 | Bacteria | 6404843 |
| 564 | 2954016498 | 2954016120 | Bacteria | 6446024 |
| 565 | 8015559701 | 8015556637 | Bacteria | 3582323 |
| 566 | Ga0157378_10000084 | |||
| 567 | JGI24737J22298_10011344 | |||
| 568 | JGI24033J26618_1000230 | |||
| 569 | JGI25162J39368_1000469 | |||
| 570 | JGI25162J39368_1001913 | |||
| 571 | JGI25162J39368_1003611 | |||
| 572 | JGI25157J39369_1001903 | |||
| 573 | JGI25164J39214_1000269 | |||
| 574 | JGI25164J39214_1001410 | |||
| 575 | JGI25151J46595_10001114 | |||
| 576 | JGI25165J46597_1000535 | |||
| 577 | Ga0055542_1000234 | |||
| 578 | Ga0055536_1000007 | |||
| 579 | Ga0055530_10003348 | |||
| 580 | Ga0065714_10007410 | |||
| 581 | Ga0065714_10064842 | |||
| 582 | Ga0065714_10065235 | |||
| 583 | Ga0065714_10170270 | |||
| 584 | Ga0065704_10073689 | |||
| 585 | Ga0070658_10000018 | |||
| 586 | Ga0070658_10014183 | |||
| 587 | Ga0070658_10322396 | |||
| 588 | Ga0070676_10002876 | |||
| 589 | Ga0070683_100640697 | |||
| 590 | Ga0070670_100069920 | |||
| 591 | Ga0070670_100127408 | |||
| 592 | Ga0068869_100007891 | |||
| 593 | Ga0070666_10001536 | |||
| 594 | Ga0070666_10027008 | |||
| 595 | Ga0070666_10090224 | |||
| 596 | Ga0070666_10197033 | |||
| 597 | Ga0070666_10374421 | |||
| 598 | Ga0070680_100125629 | |||
| 599 | Ga0070680_100233519 | |||
| 600 | Ga0070682_100066499 | |||
| 601 | Ga0068868_100048161 | |||
| 602 | Ga0068868_100175536 | |||
| 603 | Ga0070660_100015151 | |||
| 604 | Ga0070660_100045746 | |||
| 605 | Ga0070660_100201483 | |||
| 606 | Ga0070689_100031851 | |||
| 607 | Ga0070661_100051220 | |||
| 608 | Ga0070692_10007991 | |||
| 609 | Ga0070692_10047329 | |||
| 610 | Ga0070669_100165371 | |||
| 611 | Ga0070675_100313692 | |||
| 612 | Ga0070675_100381316 | |||
| 613 | Ga0070671_100169989 | |||
| 614 | Ga0070673_100104787 | |||
| 615 | Ga0070688_100078975 | |||
| 616 | Ga0070659_100064651 | |||
| 617 | Ga0070659_100178384 | |||
| 618 | Ga0070667_100021724 | |||
| 619 | Ga0070667_100065972 | |||
| 620 | Ga0070667_100182689 | |||
| 621 | Ga0070667_100634723 | |||
| 622 | Ga0070714_100000020 | |||
| 623 | Ga0070714_100003124 | |||
| 624 | Ga0070714_100072138 | |||
| 625 | Ga0070710_10032553 | |||
| 626 | Ga0070710_10330168 | |||
| 627 | Ga0070711_100050995 | |||
| 628 | Ga0070711_100205295 | |||
| 629 | Ga0070694_100006352 | |||
| 630 | Ga0070663_100056138 | |||
| 631 | Ga0070678_100000238 | |||
| 632 | Ga0070662_100000343 | |||
| 633 | Ga0070662_100449081 | |||
| 634 | Ga0070681_10094279 | |||
| 635 | Ga0070681_10146007 | |||
| 636 | Ga0068867_100001894 | |||
| 637 | Ga0070685_10014301 | |||
| 638 | Ga0070679_100143552 | |||
| 639 | Ga0070679_100177553 | |||
| 640 | Ga0070684_100023894 | |||
| 641 | Ga0070684_100277736 | |||
| 642 | Ga0068853_100003732 | |||
| 643 | Ga0068853_100007643 | |||
| 644 | Ga0068853_100014673 | |||
| 645 | Ga0068853_100023924 | |||
| 646 | Ga0068853_100078383 | |||
| 647 | Ga0068853_100111450 | |||
| 648 | Ga0068853_100146195 | |||
| 649 | Ga0070672_100034725 | |||
| 650 | Ga0070695_100009050 | |||
| 651 | Ga0070693_100017659 | |||
| 652 | Ga0070665_100000026 | |||
| 653 | Ga0070665_100000072 | |||
| 654 | Ga0070665_100045983 | |||
| 655 | Ga0068855_100011186 | |||
| 656 | Ga0068855_100045231 | |||
| 657 | Ga0068855_100242906 | |||
| 658 | Ga0068855_100244225 | |||
| 659 | Ga0068855_100428068 | |||
| 660 | Ga0068855_100531945 | |||
| 661 | Ga0068855_100621228 | |||
| 662 | Ga0068857_100076736 | |||
| 663 | Ga0068856_100007535 | |||
| 664 | Ga0068856_100027783 | |||
| 665 | Ga0068856_100382691 | |||
| 666 | Ga0068856_100507085 | |||
| 667 | Ga0068852_100000143 | |||
| 668 | Ga0068852_100016382 | |||
| 669 | Ga0068852_100082190 | |||
| 670 | Ga0068864_100000400 | |||
| 671 | Ga0068864_100321810 | |||
| 672 | Ga0068864_100463653 | |||
| 673 | Ga0068863_100027534 | |||
| 674 | Ga0068863_100027921 | |||
| 675 | Ga0068863_100584858 | |||
| 676 | Ga0068863_100587694 | |||
| 677 | Ga0068863_100684610 | |||
| 678 | Ga0068862_100197401 | |||
| 679 | Ga0081455_10294346 | |||
| 680 | Ga0081455_10307537 | |||
| 681 | Ga0081540_1011365 | |||
| 682 | Ga0097621_100000028 | |||
| 683 | Ga0097621_100032411 | |||
| 684 | Ga0097621_100049554 | |||
| 685 | Ga0097621_100126469 | |||
| 686 | Ga0097621_100159001 | |||
| 687 | Ga0068871_100000066 | |||
| 688 | Ga0068871_100010632 | |||
| 689 | Ga0068871_100103394 | |||
| 690 | Ga0075428_100002048 | |||
| 691 | Ga0075428_100072476 | |||
| 692 | Ga0075430_100034901 | |||
| 693 | Ga0075431_100000149 | |||
| 694 | Ga0075429_100000056 | |||
| 695 | Ga0068865_100000551 | |||
| 696 | Ga0068865_100001490 | |||
| 697 | Ga0068865_100216718 | |||
| 698 | Ga0105244_10031962 | |||
| 699 | Ga0105240_10007839 | |||
| 700 | Ga0105240_10012898 | |||
| 701 | Ga0105240_10013894 | |||
| 702 | Ga0105240_10019601 | |||
| 703 | Ga0105240_10053280 | |||
| 704 | Ga0105245_10024611 | |||
| 705 | Ga0105241_10000711 | |||
| 706 | Ga0105241_10002900 | |||
| 707 | Ga0105242_10006736 | |||
| 708 | Ga0105242_10106803 | |||
| 709 | Ga0105242_10136347 | |||
| 710 | Ga0105242_10641034 | |||
| 711 | Ga0105248_10024084 | |||
| 712 | Ga0105237_10000491 | |||
| 713 | Ga0105237_10001267 | |||
| 714 | Ga0105237_10006108 | |||
| 715 | Ga0105237_10035158 | |||
| 716 | Ga0105238_10010062 | |||
| 717 | Ga0105238_10013627 | |||
| 718 | Ga0105238_10020069 | |||
| 719 | Ga0105238_10035576 | |||
| 720 | Ga0105238_10297896 | |||
| 721 | Ga0105238_10422321 | |||
| 722 | Ga0105238_10881303 | |||
| 723 | Ga0105249_10025357 | |||
| 724 | Ga0099796_10000261 | |||
| 725 | Ga0105239_10005993 | |||
| 726 | Ga0105239_10007020 | |||
| 727 | Ga0105239_10043959 | |||
| 728 | Ga0105239_10065055 | |||
| 729 | Ga0105239_10335422 | |||
| 730 | Ga0157373_10013395 | |||
| 731 | Ga0157371_10000901 | |||
| 732 | Ga0157370_10004580 | |||
| 733 | Ga0157370_10011717 | |||
| 734 | Ga0157370_10012867 | |||
| 735 | Ga0157370_10017982 | |||
| 736 | Ga0157370_10034372 | |||
| 737 | Ga0157370_10131866 | |||
| 738 | Ga0157370_10152324 | |||
| 739 | Ga0157370_10215150 | |||
| 740 | Ga0157369_10000015 | |||
| 741 | Ga0157369_10000030 | |||
| 742 | Ga0157369_10046414 | |||
| 743 | Ga0157369_10187559 | |||
| 744 | Ga0157369_10328418 | |||
| 745 | Ga0157374_10000174 | |||
| 746 | Ga0157374_10001861 | |||
| 747 | Ga0157374_10015286 | |||
| 748 | Ga0157374_10067873 | |||
| 749 | Ga0157378_10013832 | |||
| 750 | Ga0157378_10055544 | |||
| 751 | Ga0163162_10000007 | |||
| 752 | Ga0163162_10000010 | |||
| 753 | Ga0163162_10007761 | |||
| 754 | Ga0157372_10008558 | |||
| 755 | Ga0157372_10027310 | |||
| 756 | Ga0157372_10050841 | |||
| 757 | Ga0157372_10220280 | |||
| 758 | Ga0157372_10309327 | |||
| 759 | Ga0157375_10005772 | |||
| 760 | Ga0157375_10030316 | |||
| 761 | Ga0163163_10000300 | |||
| 762 | Ga0163163_10013575 | |||
| 763 | Ga0163163_10407115 | |||
| 764 | Ga0157380_10302629 | |||
| 765 | Ga0182008_10000130 | |||
| 766 | Ga0182008_10001316 | |||
| 767 | Ga0182008_10028841 | |||
| 768 | Ga0182008_10033522 | |||
| 769 | Ga0182008_10036206 | |||
| 770 | Ga0182008_10073328 | |||
| 771 | Ga0157377_10044175 | |||
| 772 | Ga0157379_10005114 | |||
| 773 | Ga0157376_10006575 | |||
| 774 | Ga0157376_10014791 | |||
| 775 | Ga0157376_10117075 | |||
| 776 | Ga0182006_1001053 | |||
| 777 | Ga0182006_1001108 | |||
| 778 | Ga0182006_1002573 | |||
| 779 | Ga0182006_1004766 | |||
| 780 | Ga0182006_1018359 | |||
| 781 | Ga0182007_10000010 | |||
| 782 | Ga0182007_10002352 | |||
| 783 | Ga0182007_10030385 | |||
| 784 | Ga0183373_1005 | |||
| 785 | Ga0163161_10000206 | |||
| 786 | Ga0163161_10000729 | |||
| 787 | Ga0163161_10010548 | |||
| 788 | Ga0209672_100411 | |||
| 789 | Ga0207427_100157 | |||
| 790 | Ga0207427_100235 | |||
| 791 | Ga0207427_102188 | |||
| 792 | Ga0209437_100202 | |||
| 793 | Ga0209437_100223 | |||
| 794 | Ga0209437_100254 | |||
| 795 | Ga0209646_1002295 | |||
| 796 | Ga0209026_1000077 | |||
| 797 | Ga0209026_1000139 | |||
| 798 | Ga0209026_1002607 | |||
| 799 | Ga0209148_1000005 | |||
| 800 | Ga0209759_1008551 | |||
| 801 | Ga0209759_1010910 | |||
| 802 | Ga0209759_1015662 | |||
| 803 | Ga0209233_1000252 | |||
| 804 | Ga0209233_1000272 | |||
| 805 | Ga0209233_1007249 | |||
| 806 | Ga0209455_1000188 | |||
| 807 | Ga0209455_1017598 | |||
| 808 | Ga0209676_1000058 | |||
| 809 | Ga0209050_1000054 | |||
| 810 | Ga0207655_1076569 | |||
| 811 | Ga0207692_10051132 | |||
| 812 | Ga0207680_10001173 | |||
| 813 | Ga0207680_10174137 | |||
| 814 | Ga0207647_10000328 | |||
| 815 | Ga0207647_10014181 | |||
| 816 | Ga0207699_10008828 | |||
| 817 | Ga0207645_10000190 | |||
| 818 | Ga0207705_10000036 | |||
| 819 | Ga0207705_10024735 | |||
| 820 | Ga0207705_10127950 | |||
| 821 | Ga0207654_10000978 | |||
| 822 | Ga0207654_10110661 | |||
| 823 | Ga0207707_10020119 | |||
| 824 | Ga0207707_10223795 | |||
| 825 | Ga0207695_10000112 | |||
| 826 | Ga0207695_10000420 | |||
| 827 | Ga0207695_10002721 | |||
| 828 | Ga0207695_10005336 | |||
| 829 | Ga0207695_10008101 | |||
| 830 | Ga0207695_10026795 | |||
| 831 | Ga0207671_10000610 | |||
| 832 | Ga0207671_10001525 | |||
| 833 | Ga0207671_10021503 | |||
| 834 | Ga0207671_10023748 | |||
| 835 | Ga0207671_10484671 | |||
| 836 | Ga0207657_10009926 | |||
| 837 | Ga0207657_10196289 | |||
| 838 | Ga0207649_10010149 | |||
| 839 | Ga0207649_10137775 | |||
| 840 | Ga0207652_10009487 | |||
| 841 | Ga0207694_10003531 | |||
| 842 | Ga0207694_10010134 | |||
| 843 | Ga0207694_10011279 | |||
| 844 | Ga0207694_10114396 | |||
| 845 | Ga0207694_10158399 | |||
| 846 | Ga0207694_10342961 | |||
| 847 | Ga0207694_10489904 | |||
| 848 | Ga0207650_10159495 | |||
| 849 | Ga0207659_10088480 | |||
| 850 | Ga0207687_10081650 | |||
| 851 | Ga0207664_10000023 | |||
| 852 | Ga0207664_10002288 | |||
| 853 | Ga0207664_10428387 | |||
| 854 | Ga0207644_10079343 | |||
| 855 | Ga0207690_10008974 | |||
| 856 | Ga0207690_10009308 | |||
| 857 | Ga0207690_10009401 | |||
| 858 | Ga0207690_10125842 | |||
| 859 | Ga0207706_10000778 | |||
| 860 | Ga0207706_10078895 | |||
| 861 | Ga0207670_10021106 | |||
| 862 | Ga0207704_10000073 | |||
| 863 | Ga0207704_10009480 | |||
| 864 | Ga0207691_10034462 | |||
| 865 | Ga0207691_10201572 | |||
| 866 | Ga0207711_10023332 | |||
| 867 | Ga0207689_10043784 | |||
| 868 | Ga0207689_10233228 | |||
| 869 | Ga0207689_10257361 | |||
| 870 | Ga0207661_10263782 | |||
| 871 | Ga0207667_10015380 | |||
| 872 | Ga0207667_10029739 | |||
| 873 | Ga0207667_10031421 | |||
| 874 | Ga0207667_10054676 | |||
| 875 | Ga0207667_10147481 | |||
| 876 | Ga0207667_10200120 | |||
| 877 | Ga0207667_10208566 | |||
| 878 | Ga0207667_10368217 | |||
| 879 | Ga0207651_10037053 | |||
| 880 | Ga0207651_10118923 | |||
| 881 | Ga0207712_10114882 | |||
| 882 | Ga0207712_10124825 | |||
| 883 | Ga0207668_10205100 | |||
| 884 | Ga0207668_10282012 | |||
| 885 | Ga0207640_10021706 | |||
| 886 | Ga0207658_10343012 | |||
| 887 | Ga0207677_10031213 | |||
| 888 | Ga0207677_10070131 | |||
| 889 | Ga0207677_10387821 | |||
| 890 | Ga0207639_10001388 | |||
| 891 | Ga0207639_10002746 | |||
| 892 | Ga0207639_10012095 | |||
| 893 | Ga0207639_10044708 | |||
| 894 | Ga0207639_10063212 | |||
| 895 | Ga0207639_10091876 | |||
| 896 | Ga0207639_10233769 | |||
| 897 | Ga0207678_10099852 | |||
| 898 | Ga0207678_10118529 | |||
| 899 | Ga0207678_10255147 | |||
| 900 | Ga0207702_10010549 | |||
| 901 | Ga0207702_10145112 | |||
| 902 | Ga0207641_10023324 | |||
| 903 | Ga0207641_10483410 | |||
| 904 | Ga0207648_10000529 | |||
| 905 | Ga0207674_10008653 | |||
| 906 | Ga0207674_10043602 | |||
| 907 | Ga0207674_10070147 | |||
| 908 | Ga0207675_100125328 | |||
| 909 | Ga0207683_10000805 | |||
| 910 | Ga0207683_10002525 | |||
| 911 | Ga0207683_10163804 | |||
| 912 | Ga0207698_10009007 | |||
| 913 | Ga0207698_10359039 | |||
| 914 | Ga0209179_1000117 | |||
| 915 | Ga0268266_10000001 | |||
| 916 | Ga0268266_10000089 | |||
| 917 | Ga0268266_10059539 | |||
| 918 | Ga0268265_10785618 | |||
| 919 | Ga0268264_10019055 | |||
| 920 | Ga0268264_10072368 | |||
| 921 | Ga0307517_10013529 | |||
| 922 | Ga0265338_10057002 | |||
| 923 | Ga0265330_10034901 | |||
| 924 | Ga0265329_10043181 | |||
| 925 | Ga0265340_10138090 | |||
| 926 | Ga0265327_10135530 | |||
| 927 | Ga0265316_10005008 | |||
| 928 | Ga0265316_10011591 | |||
| 929 | Ga0307508_10191748 | |||
| 930 | Ga0265314_10032095 | |||
| 931 | Ga0265342_10021327 | |||
| 932 | Ga0307516_10155497 | |||
| 933 | Ga0307405_10000035 | |||
| 934 | Ga0307407_10000005 | |||
| 935 | Ga0307416_100000001 | |||
| 936 | Ga0307414_10059586 | |||
| 937 | Ga0307510_10001230 | |||
| 938 | Ga0373923_0038834 | |||
| 939 | Ga0373941_0055731 | |||
| 940 | Ga0373933_0058761 | |||
| 941 | Ga0373937_0133311 | |||
| 942 | Ga0373937_0353219 | |||
| 943 | Ga0373925_0049340 | |||
| 944 | Ga0395899_0000592 | |||
| 945 | Ga0395899_0131446 | |||
| 946 | Ga0395900_0000277 | |||
| 947 | Ga0395900_0070533 | |||
| 948 | Ga0395898_0014807 | |||
| 949 | Ga0395905_0000068 | |||
| 950 | Ga0395905_0000727 | |||
| 951 | Ga0395905_0158649 | |||
| 952 | Ga0395901_0000199 | |||
| 953 | Ga0395901_0005884 | |||
| 954 | Ga0436365_0192168 | |||
| 955 | Ga0436361_0399615 | |||
| 956 | Ga0436363_1567754 | |||
| 957 | Ga0451793_1089417 | |||
| 958 | Ga0439448_0018148 | |||
| 959 | Ga0466972_0002599 | |||
| 960 | Ga0466963_0281646 | |||
| 961 | Ga0453684_0000159 | |||
| 962 | Ga0453684_0001394 | |||
| 963 | Ga0451576_0000401 | |||
| 964 | Ga0495629_0063328 | |||
| 965 | Ga0495638_0000608 | |||
| 966 | Ga0495650_0000561 | |||
| 967 | Ga0495580_0116580 | |||
| 968 | Ga0495582_0029671 | |||
| 969 | Ga0495594_0249578 | |||
| 970 | Ga0495606_0000016 | |||
| 971 | Ga0495606_0285228 | |||
| 972 | Ga0495610_0000074 | |||
| 973 | Ga0495610_0000405 | |||
| 974 | Ga0495630_0183432 | |||
| 975 | Ga0495631_0003046 | |||
| 976 | Ga0495637_0075320 | |||
| 977 | Ga0495640_0268553 | |||
| 978 | Ga0495622_0159679 | |||
| 979 | Ga0495668_0145201 | |||
| 980 | Ga0495634_0162232 | |||
| 981 | Ga0495625_0116004 | |||
| 982 | Ga0495649_0001113 | |||
| 983 | Ga0495649_0031994 | |||
| 984 | Ga0495674_0133103 | |||
| 985 | Ga0495680_0003790 | |||
| 986 | Ga0495683_0083142 | |||
| 987 | Ga0495681_0025230 | |||
| 988 | Ga0495684_0047798 | |||
| 989 | Ga0495686_0000034 | |||
| 990 | Ga0496101_0714763 | |||
| 991 | Ga0496102_0098583 | |||
| 992 | Ga0496103_0013055 | |||
| 993 | Ga0496104_0000041 | |||
| 994 | Ga0496104_0084089 | |||
| 995 | Ga0496105_0000022 | |||
| 996 | Ga0496109_0430585 | |||
| 997 | Ga0496110_0010940 | |||
| 998 | Ga0496110_0228291 | |||
| 999 | Ga0496111_0069550 | |||
| 1000 | Ga0496113_0297173 | |||
| 1001 | Ga0496114_0114596 | |||
| 1002 | Ga0496114_0416734 | |||
| 1003 | Ga0496115_0000741 | |||
| 1004 | Ga0496115_0182626 | |||
| 1005 | Ga0496118_0001034 | |||
| 1006 | Ga0496118_0046777 | |||
| 1007 | Ga0496118_0133339 | |||
| 1008 | Ga0496122_0000390 | |||
| 1009 | Ga0496124_0000001 | |||
| 1010 | Ga0496126_0003719 | |||
| 1011 | Ga0496126_0035815 | |||
| 1012 | Ga0495678_018456 | |||
| 1013 | Ga0501031_0000726 | |||
| 1014 | Ga0501031_0017984 | |||
| 1015 | Ga0501032_0004918 | |||
| 1016 | Ga0501032_0038006 | |||
| 1017 | Ga0501033_0000673 | |||
| 1018 | Ga0501033_0021334 | |||
| 1019 | Ga0501033_0122033 | |||
| 1020 | Ga0501034_0004751 | |||
| 1021 | Ga0501034_0005765 | |||
| 1022 | Ga0501034_0036202 | |||
| 1023 | Ga0501034_0124385 | |||
| 1024 | Ga0501034_0279379 | |||
| 1025 | Ga0501034_0311986 | |||
| 1026 | Ga0501036_0004254 | |||
| 1027 | Ga0501036_0013764 | |||
| 1028 | Ga0501037_0000547 | |||
| 1029 | Ga0501037_0011223 | |||
| 1030 | Ga0501037_0021831 | |||
| 1031 | Ga0501037_0039989 | |||
| 1032 | Ga0501038_0002529 | |||
| 1033 | Ga0501038_0002643 | |||
| 1034 | Ga0501038_0125528 | |||
| 1035 | Ga0501038_0139616 | |||
| 1036 | Ga0501038_0152039 | |||
| 1037 | Ga0501040_0037723 | |||
| 1038 | Ga0501042_0401520 | |||
| 1039 | Ga0501043_0040368 | |||
| 1040 | Ga0501043_0063952 | |||
| 1041 | Ga0501043_0165722 | |||
| 1042 | Ga0501043_0233421 | |||
| 1043 | Ga0501046_0001515 | |||
| 1044 | Ga0501046_0002948 | |||
| 1045 | Ga0501046_0011428 | |||
| 1046 | Ga0501046_0098644 | |||
| 1047 | Ga0501046_0301751 | |||
| 1048 | Ga0501047_0004941 | |||
| 1049 | Ga0501047_0012974 | |||
| 1050 | Ga0501047_0039508 | |||
| 1051 | Ga0501047_0074521 | |||
| 1052 | Ga0501047_0113644 | |||
| 1053 | Ga0501047_0179651 | |||
| 1054 | Ga0501047_0500318 | |||
| 1055 | Ga0501048_0035796 | |||
| 1056 | Ga0501067_0003237 | |||
| 1057 | Ga0501068_0027067 | |||
| 1058 | Ga0501068_0069886 | |||
| 1059 | Ga0501068_0069947 | |||
| 1060 | Ga0501068_0218157 | |||
| 1061 | Ga0501069_0019537 | |||
| 1062 | Ga0501070_0157583 | |||
| 1063 | Ga0501070_0299349 | |||
| 1064 | Ga0501071_0024266 | |||
| 1065 | Ga0501072_0136022 | |||
| 1066 | Ga0501073_0007940 | |||
| 1067 | Ga0501073_0119722 | |||
| 1068 | Ga0501074_0002514 | |||
| 1069 | Ga0501074_0017788 | |||
| 1070 | Ga0501074_0055716 | |||
| 1071 | Ga0501074_0209862 | |||
| 1072 | Ga0501079_0074175 | |||
| 1073 | Ga0501080_0013902 | |||
| 1074 | Ga0501080_0015585 | |||
| 1075 | Ga0501080_0020208 | |||
| 1076 | Ga0501080_0026080 | |||
| 1077 | Ga0501080_0052431 | |||
| 1078 | Ga0501080_0164670 | |||
| 1079 | Ga0501080_0190715 | |||
| 1080 | Ga0501083_0009807 | |||
| 1081 | Ga0501035_0013506 | |||
| 1082 | Ga0501035_0026004 | |||
| 1083 | Ga0501044_0005212 | |||
| 1084 | Ga0501044_0006789 | |||
| 1085 | Ga0501044_0014071 | |||
| 1086 | Ga0501044_0064298 | |||
| 1087 | Ga0501044_0078926 | |||
| 1088 | Ga0501044_0147142 | |||
| 1089 | Ga0501044_0242118 | |||
| 1090 | Ga0501045_0017680 | |||
| 1091 | nmdc:mga05p37_160244_c1 | |||
| 1092 | nmdc:mga09592_4282_c1 | |||
| 1093 | nmdc:mga08y16_763574_c1 | |||
| 1094 | Ga0495612_0033652 | |||
| 1095 | Ga0500644_0000718 | |||
| 1096 | Ga0500651_0000183 | |||
| 1097 | Ga0500651_0002980 | |||
| 1098 | Ga0500651_0012667 | |||
| 1099 | Ga0500568_0000844 | |||
| 1100 | Ga0500634_0138442 | |||
| 1101 | Ga0501084_0000690 | |||
| 1102 | Ga0501084_0014880 | |||
| 1103 | Ga0501084_0017566 | |||
| 1104 | Ga0501082_0000275 | |||
| 1105 | Ga0501082_0079210 | |||
| 1106 | Ga0530510_0128554 | |||
| 1107 | 2586208513 | |||
| 1108 | 2738856660 | |||
| 1109 | 2739301795 | |||
| 1110 | 2739590106 | |||
| 1111 | 2739615343 | |||
| 1112 | 2739644307 | |||
| 1113 | 2739730027 | |||
| 1114 | 2745162257 | |||
| 1115 | 2819548505 | |||
| 1116 | 2842722921 | |||
| 1117 | 2842913336 | |||
| 1118 | 2849286663 | |||
| 1119 | 2852627730 | |||
| 1120 | 2884414226 | |||
| 1121 | 2889308810 | |||
| 1122 | 2895397191 | |||
| 1123 | 2904448510 | |||
| 1124 | 2917704800 | |||
| 1125 | 2919187907 | |||
| 1126 | 2928965775 | |||
| 1127 | 2939612821 | |||
| 1128 | 2945999884 | |||
| 1129 | 2954016498 | |||
| 1130 | 8015559701 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g8x-assembly1.cif.gz_B | escherichia coli y209w apoprotein | 0.993 | 3 | 262 |
| 4fog-assembly2.cif.gz_B | crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid | 0.9927 | 1 | 261 |
| 3bfi-assembly1.cif.gz_A-2 | e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump | 0.9924 | 3 | 264 |
| 4h0r-assembly1.cif.gz_A | crystal structure of thymidylate synthase from corynebacterium glutamicum | 0.9918 | 3 | 258 |
| 4h0u-assembly1.cif.gz_B | crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump | 0.9915 | 3 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ix6B00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9772 | 2 | 251 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9759 | 2 | 264 | 3.30.572.10 |
| 1bo7A00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9686 | 2 | 264 | 3.30.572.10 |
| 6qyaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9646 | 2 | 262 | 3.30.572.10 |
| 3dgaC00 | Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain | 0.9638 | 2 | 259 | 3.30.572.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059X1I7-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 1.001 | 29 | 209 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A528BC42-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 1.001 | 49 | 237 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A6N8MV19-F1-model_v4 | deleted | 1.001 | 37 | 190 |
|
| AF-A0A1G0F8E3-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 1.001 | 66 | 204 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |
| AF-A0A355C418-F1-model_v4 | Thymidylate synthase (EC 2.1.1.45) | 1 | 1 | 222 |
GO:0004799
GO:0005829 GO:0006231 GO:0032259 |