F464261

General Info

Members Datasets Scaffolds Average Seq Length
565 290 1130 264

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10000084|Ga0157378_1000008432
Length 292
Sequence VDVAARADPAAARREHGRRAATPEGSRLMRQYLELLRHVLEHGDAKSDRTGTGTRSVFGYQMRFDLARGFPLLTTKKLHTKSIVYELLWFLRGETNIGYLNEHGVSIWDEWADAQGELGPVYGKQWRXXXXADGRTIDQISWVIDEIKRNPDSRRLVVSAWNVADLPKMALQPCHALFQFHVANGRLSCQLYQRSADIFLGVPFNIASYALLTHMVAQVCGLRPGDFVHTLGDAHLYNNHVEQAREQLKREPMALPTLKLNPAVRSIFDFSFADIALEGYTAHASIKAPIAV

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
204 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
205 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
260 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
267 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
268 2738541302 Pedobacter sp. CF074 Isolate Unclassified
269 2738543023 Pedobacter sp. OK628 Isolate Unclassified
270 2739367651 Pedobacter sp. OK291 Isolate Unclassified
271 2739367656 Pedobacter sp. CF523 Isolate Unclassified
272 2739367663 Pedobacter sp. YR510 Isolate Unclassified
273 2739367700 Dyella sp. YR388 Isolate Unclassified
274 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
275 2818991437 Pedobacter terrae 518 Isolate Unclassified
276 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
277 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
278 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
279 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
280 2884411467 Dyella sp. AD56 Isolate Rhizosphere
281 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
282 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
283 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
284 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
285 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
286 2928963466 Dyella japonica 1073 Isolate Unclassified
287 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
288 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
289 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
290 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.75
Metatranscriptomes 0
Isolates 4.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0
Rhizoplane 2.83
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_10000084 3300013297 Bacteria 87722
2 JGI24737J22298_10011344 3300001990 Unclassified 2922
3 JGI24033J26618_1000230 3300002155 Bacteria 6369
4 JGI25162J39368_1000469 3300002737 Bacteria 31140
5 JGI25162J39368_1001913 3300002737 Bacteria 9539
6 JGI25162J39368_1003611 3300002737 Bacteria 4286
7 JGI25157J39369_1001903 3300002741 Bacteria 6335
8 JGI25164J39214_1000269 3300002772 Bacteria 38654
9 JGI25164J39214_1001410 3300002772 Bacteria 5693
10 JGI25151J46595_10001114 3300003187 Bacteria 19608
11 JGI25165J46597_1000535 3300003214 Bacteria 35299
12 Ga0055542_1000234 3300003762 Bacteria 63993
13 Ga0055536_1000007 3300003781 Bacteria 345133
14 Ga0055530_10003348 3300003791 Bacteria 9192
15 Ga0065714_10007410 3300005288 Bacteria 4701
16 Ga0065714_10064842 3300005288 Bacteria 17197
17 Ga0065714_10065235 3300005288 Bacteria 11538
18 Ga0065714_10170270 3300005288 Bacteria 1000
19 Ga0065704_10073689 3300005289 Bacteria 6842
20 Ga0070658_10000018 3300005327 Bacteria 200558
21 Ga0070658_10014183 3300005327 Bacteria 6396
22 Ga0070658_10322396 3300005327 Bacteria 1319
23 Ga0070676_10002876 3300005328 Bacteria 8893
24 Ga0070683_100640697 3300005329 Bacteria 1017
25 Ga0070670_100069920 3300005331 Bacteria 3013
26 Ga0070670_100127408 3300005331 Bacteria 2197
27 Ga0068869_100007891 3300005334 Bacteria 6834
28 Ga0070666_10001536 3300005335 Bacteria 14027
29 Ga0070666_10027008 3300005335 Bacteria 3756
30 Ga0070666_10090224 3300005335 Bacteria 2104
31 Ga0070666_10197033 3300005335 Bacteria 1416
32 Ga0070666_10374421 3300005335 Bacteria 1021
33 Ga0070680_100125629 3300005336 Bacteria 2143
34 Ga0070680_100233519 3300005336 Bacteria 1554
35 Ga0070682_100066499 3300005337 Bacteria 2293
36 Ga0068868_100048161 3300005338 Bacteria 3343
37 Ga0068868_100175536 3300005338 Bacteria 1776
38 Ga0070660_100015151 3300005339 Bacteria 5562
39 Ga0070660_100045746 3300005339 Bacteria 3352
40 Ga0070660_100201483 3300005339 Bacteria 1614
41 Ga0070689_100031851 3300005340 Bacteria 4008
42 Ga0070661_100051220 3300005344 Bacteria 3021
43 Ga0070692_10007991 3300005345 Bacteria 4693
44 Ga0070692_10047329 3300005345 Bacteria 2226
45 Ga0070669_100165371 3300005353 Bacteria 1722
46 Ga0070675_100313692 3300005354 Bacteria 1384
47 Ga0070675_100381316 3300005354 Bacteria 1255
48 Ga0070671_100169989 3300005355 Bacteria 1843
49 Ga0070673_100104787 3300005364 Bacteria 2336
50 Ga0070688_100078975 3300005365 Bacteria 2124
51 Ga0070659_100064651 3300005366 Bacteria 2896
52 Ga0070659_100178384 3300005366 Bacteria 1742
53 Ga0070667_100021724 3300005367 Bacteria 5325
54 Ga0070667_100065972 3300005367 Bacteria 3074
55 Ga0070667_100182689 3300005367 Bacteria 1855
56 Ga0070667_100634723 3300005367 Bacteria 986
57 Ga0070714_100000020 3300005435 Bacteria 169262
58 Ga0070714_100003124 3300005435 Bacteria 12300
59 Ga0070714_100072138 3300005435 Bacteria 2989
60 Ga0070710_10032553 3300005437 Bacteria 2825
61 Ga0070710_10330168 3300005437 Bacteria 1004
62 Ga0070711_100050995 3300005439 Bacteria 2840
63 Ga0070711_100205295 3300005439 Bacteria 1523
64 Ga0070694_100006352 3300005444 Bacteria 7170
65 Ga0070663_100056138 3300005455 Bacteria 2821
66 Ga0070678_100000238 3300005456 Bacteria 25199
67 Ga0070662_100000343 3300005457 Bacteria 27936
68 Ga0070662_100449081 3300005457 Bacteria 1070
69 Ga0070681_10094279 3300005458 Bacteria 2942
70 Ga0070681_10146007 3300005458 Bacteria 2294
71 Ga0068867_100001894 3300005459 Bacteria 14557
72 Ga0070685_10014301 3300005466 Bacteria 4201
73 Ga0070679_100143552 3300005530 Bacteria 2366
74 Ga0070679_100177553 3300005530 Bacteria 2102
75 Ga0070684_100023894 3300005535 Bacteria 5121
76 Ga0070684_100277736 3300005535 Bacteria 1534
77 Ga0068853_100003732 3300005539 Bacteria 11684
78 Ga0068853_100007643 3300005539 Bacteria 8663
79 Ga0068853_100014673 3300005539 Bacteria 6426
80 Ga0068853_100023924 3300005539 Bacteria 5119
81 Ga0068853_100078383 3300005539 Bacteria 2887
82 Ga0068853_100111450 3300005539 Bacteria 2431
83 Ga0068853_100146195 3300005539 Bacteria 2125
84 Ga0070672_100034725 3300005543 Bacteria 3829
85 Ga0070695_100009050 3300005545 Bacteria 5920
86 Ga0070693_100017659 3300005547 Bacteria 3713
87 Ga0070665_100000026 3300005548 Bacteria 365176
88 Ga0070665_100000072 3300005548 Bacteria 198575
89 Ga0070665_100045983 3300005548 Bacteria 4385
90 Ga0068855_100011186 3300005563 Bacteria 10837
91 Ga0068855_100045231 3300005563 Bacteria 5206
92 Ga0068855_100242906 3300005563 Bacteria 2011
93 Ga0068855_100244225 3300005563 Bacteria 2005
94 Ga0068855_100428068 3300005563 Bacteria 1447
95 Ga0068855_100531945 3300005563 Bacteria 1274
96 Ga0068855_100621228 3300005563 Bacteria 1163
97 Ga0068857_100076736 3300005577 Bacteria 2980
98 Ga0068856_100007535 3300005614 Bacteria 10621
99 Ga0068856_100027783 3300005614 Bacteria 5520
100 Ga0068856_100382691 3300005614 Bacteria 1426
101 Ga0068856_100507085 3300005614 Bacteria 1227
102 Ga0068852_100000143 3300005616 Bacteria 48192
103 Ga0068852_100016382 3300005616 Bacteria 5778
104 Ga0068852_100082190 3300005616 Bacteria 2862
105 Ga0068864_100000400 3300005618 Bacteria 37634
106 Ga0068864_100321810 3300005618 Bacteria 1453
107 Ga0068864_100463653 3300005618 Bacteria 1213
108 Ga0068863_100027534 3300005841 Bacteria 5422
109 Ga0068863_100027921 3300005841 Bacteria 5386
110 Ga0068863_100584858 3300005841 Bacteria 1104
111 Ga0068863_100587694 3300005841 Bacteria 1101
112 Ga0068863_100684610 3300005841 Bacteria 1018
113 Ga0068862_100197401 3300005844 Bacteria 1813
114 Ga0081455_10294346 3300005937 Bacteria 1167
115 Ga0081455_10307537 3300005937 Bacteria 1134
116 Ga0081540_1011365 3300005983 Bacteria 5954
117 Ga0097621_100000028 3300006237 Bacteria 71678
118 Ga0097621_100032411 3300006237 Bacteria 4153
119 Ga0097621_100049554 3300006237 Bacteria 3412
120 Ga0097621_100126469 3300006237 Bacteria 2171
121 Ga0097621_100159001 3300006237 Bacteria 1941
122 Ga0068871_100000066 3300006358 Bacteria 57980
123 Ga0068871_100010632 3300006358 Bacteria 6726
124 Ga0068871_100103394 3300006358 Bacteria 2388
125 Ga0075428_100002048 3300006844 Bacteria 21752
126 Ga0075428_100072476 3300006844 Bacteria 3762
127 Ga0075430_100034901 3300006846 Bacteria 4270
128 Ga0075431_100000149 3300006847 Bacteria 47617
129 Ga0075429_100000056 3300006880 Bacteria 53996
130 Ga0068865_100000551 3300006881 Bacteria 20805
131 Ga0068865_100001490 3300006881 Bacteria 13649
132 Ga0068865_100216718 3300006881 Bacteria 1494
133 Ga0105244_10031962 3300009036 Bacteria 2791
134 Ga0105240_10007839 3300009093 Bacteria 15410
135 Ga0105240_10012898 3300009093 Bacteria 11510
136 Ga0105240_10013894 3300009093 Bacteria 11028
137 Ga0105240_10019601 3300009093 Bacteria 9034
138 Ga0105240_10053280 3300009093 Bacteria 5079
139 Ga0105245_10024611 3300009098 Bacteria 5288
140 Ga0105241_10000711 3300009174 Bacteria 25180
141 Ga0105241_10002900 3300009174 Bacteria 12814
142 Ga0105242_10006736 3300009176 Bacteria 8861
143 Ga0105242_10106803 3300009176 Bacteria 2380
144 Ga0105242_10136347 3300009176 Bacteria 2125
145 Ga0105242_10641034 3300009176 Bacteria 1032
146 Ga0105248_10024084 3300009177 Bacteria 6765
147 Ga0105237_10000491 3300009545 Bacteria 56127
148 Ga0105237_10001267 3300009545 Bacteria 33722
149 Ga0105237_10006108 3300009545 Bacteria 13461
150 Ga0105237_10035158 3300009545 Bacteria 5071
151 Ga0105238_10010062 3300009551 Bacteria 9488
152 Ga0105238_10013627 3300009551 Bacteria 8212
153 Ga0105238_10020069 3300009551 Bacteria 6802
154 Ga0105238_10035576 3300009551 Bacteria 5062
155 Ga0105238_10297896 3300009551 Bacteria 1596
156 Ga0105238_10422321 3300009551 Bacteria 1328
157 Ga0105238_10881303 3300009551 Bacteria 913
158 Ga0105249_10025357 3300009553 Bacteria 5337
159 Ga0099796_10000261 3300010159 Bacteria 8345
160 Ga0105239_10005993 3300010375 Bacteria 14144
161 Ga0105239_10007020 3300010375 Bacteria 12963
162 Ga0105239_10043959 3300010375 Bacteria 4899
163 Ga0105239_10065055 3300010375 Bacteria 4004
164 Ga0105239_10335422 3300010375 Bacteria 1706
165 Ga0157373_10013395 3300013100 Bacteria 6016
166 Ga0157371_10000901 3300013102 Bacteria 33476
167 Ga0157370_10004580 3300013104 Bacteria 15829
168 Ga0157370_10011717 3300013104 Bacteria 9154
169 Ga0157370_10012867 3300013104 Bacteria 8651
170 Ga0157370_10017982 3300013104 Bacteria 7116
171 Ga0157370_10034372 3300013104 Bacteria 4938
172 Ga0157370_10131866 3300013104 Bacteria 2331
173 Ga0157370_10152324 3300013104 Bacteria 2151
174 Ga0157370_10215150 3300013104 Bacteria 1780
175 Ga0157369_10000015 3300013105 Bacteria 262917
176 Ga0157369_10000030 3300013105 Bacteria 203569
177 Ga0157369_10046414 3300013105 Bacteria 4721
178 Ga0157369_10187559 3300013105 Bacteria 2174
179 Ga0157369_10328418 3300013105 Bacteria 1589
180 Ga0157374_10000174 3300013296 Bacteria 59597
181 Ga0157374_10001861 3300013296 Bacteria 17768
182 Ga0157374_10015286 3300013296 Bacteria 6730
183 Ga0157374_10067873 3300013296 Bacteria 3354
184 Ga0157378_10013832 3300013297 Bacteria 7057
185 Ga0157378_10055544 3300013297 Bacteria 3528
186 Ga0163162_10000007 3300013306 Bacteria 368084
187 Ga0163162_10000010 3300013306 Bacteria 302032
188 Ga0163162_10007761 3300013306 Bacteria 10455
189 Ga0157372_10008558 3300013307 Bacteria 10867
190 Ga0157372_10027310 3300013307 Bacteria 6215
191 Ga0157372_10050841 3300013307 Bacteria 4610
192 Ga0157372_10220280 3300013307 Bacteria 2200
193 Ga0157372_10309327 3300013307 Bacteria 1839
194 Ga0157375_10005772 3300013308 Bacteria 10770
195 Ga0157375_10030316 3300013308 Bacteria 5099
196 Ga0163163_10000300 3300014325 Bacteria 48781
197 Ga0163163_10013575 3300014325 Bacteria 7461
198 Ga0163163_10407115 3300014325 Bacteria 1419
199 Ga0157380_10302629 3300014326 Bacteria 1474
200 Ga0182008_10000130 3300014497 Bacteria 57208
201 Ga0182008_10001316 3300014497 Bacteria 16944
202 Ga0182008_10028841 3300014497 Bacteria 2806
203 Ga0182008_10033522 3300014497 Bacteria 2576
204 Ga0182008_10036206 3300014497 Bacteria 2470
205 Ga0182008_10073328 3300014497 Bacteria 1684
206 Ga0157377_10044175 3300014745 Bacteria 2483
207 Ga0157379_10005114 3300014968 Bacteria 11247
208 Ga0157376_10006575 3300014969 Bacteria 8226
209 Ga0157376_10014791 3300014969 Bacteria 5873
210 Ga0157376_10117075 3300014969 Bacteria 2355
211 Ga0182006_1001053 3300015261 Bacteria 17809
212 Ga0182006_1001108 3300015261 Bacteria 17182
213 Ga0182006_1002573 3300015261 Bacteria 9833
214 Ga0182006_1004766 3300015261 Bacteria 6614
215 Ga0182006_1018359 3300015261 Bacteria 2957
216 Ga0182007_10000010 3300015262 Bacteria 286070
217 Ga0182007_10002352 3300015262 Bacteria 9470
218 Ga0182007_10030385 3300015262 Bacteria 1847
219 Ga0183373_1005 3300015682 Bacteria 351562
220 Ga0163161_10000206 3300017792 Bacteria 54119
221 Ga0163161_10000729 3300017792 Bacteria 25879
222 Ga0163161_10010548 3300017792 Bacteria 6399
223 Ga0209672_100411 3300025228 Bacteria 25324
224 Ga0207427_100157 3300025231 Bacteria 77115
225 Ga0207427_100235 3300025231 Bacteria 45748
226 Ga0207427_102188 3300025231 Bacteria 5545
227 Ga0209437_100202 3300025233 Bacteria 118709
228 Ga0209437_100223 3300025233 Bacteria 102763
229 Ga0209437_100254 3300025233 Bacteria 83422
230 Ga0209646_1002295 3300025246 Bacteria 4357
231 Ga0209026_1000077 3300025250 Bacteria 200561
232 Ga0209026_1000139 3300025250 Bacteria 115298
233 Ga0209026_1002607 3300025250 Bacteria 6606
234 Ga0209148_1000005 3300025254 Bacteria 1806504
235 Ga0209759_1008551 3300025256 Bacteria 3178
236 Ga0209759_1010910 3300025256 Bacteria 2626
237 Ga0209759_1015662 3300025256 Bacteria 1947
238 Ga0209233_1000252 3300025261 Bacteria 83708
239 Ga0209233_1000272 3300025261 Bacteria 73393
240 Ga0209233_1007249 3300025261 Bacteria 3526
241 Ga0209455_1000188 3300025272 Bacteria 92883
242 Ga0209455_1017598 3300025272 Bacteria 1493
243 Ga0209676_1000058 3300025292 Bacteria 345185
244 Ga0209050_1000054 3300025298 Bacteria 345186
245 Ga0207655_1076569 3300025728 Bacteria 1223
246 Ga0207692_10051132 3300025898 Bacteria 2094
247 Ga0207680_10001173 3300025903 Bacteria 12356
248 Ga0207680_10174137 3300025903 Bacteria 1451
249 Ga0207647_10000328 3300025904 Bacteria 38905
250 Ga0207647_10014181 3300025904 Bacteria 5501
251 Ga0207699_10008828 3300025906 Bacteria 4993
252 Ga0207645_10000190 3300025907 Bacteria 49657
253 Ga0207705_10000036 3300025909 Bacteria 200787
254 Ga0207705_10024735 3300025909 Bacteria 4285
255 Ga0207705_10127950 3300025909 Bacteria 1889
256 Ga0207654_10000978 3300025911 Bacteria 15688
257 Ga0207654_10110661 3300025911 Bacteria 1708
258 Ga0207707_10020119 3300025912 Bacteria 5825
259 Ga0207707_10223795 3300025912 Bacteria 1638
260 Ga0207695_10000112 3300025913 Bacteria 248037
261 Ga0207695_10000420 3300025913 Bacteria 94361
262 Ga0207695_10002721 3300025913 Bacteria 25814
263 Ga0207695_10005336 3300025913 Bacteria 17109
264 Ga0207695_10008101 3300025913 Bacteria 13214
265 Ga0207695_10026795 3300025913 Bacteria 6428
266 Ga0207671_10000610 3300025914 Bacteria 47260
267 Ga0207671_10001525 3300025914 Bacteria 26570
268 Ga0207671_10021503 3300025914 Bacteria 4892
269 Ga0207671_10023748 3300025914 Bacteria 4620
270 Ga0207671_10484671 3300025914 Bacteria 986
271 Ga0207657_10009926 3300025919 Bacteria 9528
272 Ga0207657_10196289 3300025919 Bacteria 1626
273 Ga0207649_10010149 3300025920 Bacteria 5169
274 Ga0207649_10137775 3300025920 Bacteria 1666
275 Ga0207652_10009487 3300025921 Bacteria 7824
276 Ga0207694_10003531 3300025924 Bacteria 12413
277 Ga0207694_10010134 3300025924 Bacteria 7103
278 Ga0207694_10011279 3300025924 Bacteria 6748
279 Ga0207694_10114396 3300025924 Bacteria 2149
280 Ga0207694_10158399 3300025924 Bacteria 1828
281 Ga0207694_10342961 3300025924 Bacteria 1235
282 Ga0207694_10489904 3300025924 Bacteria 1029
283 Ga0207650_10159495 3300025925 Bacteria 1786
284 Ga0207659_10088480 3300025926 Bacteria 2307
285 Ga0207687_10081650 3300025927 Bacteria 2337
286 Ga0207664_10000023 3300025929 Bacteria 204730
287 Ga0207664_10002288 3300025929 Bacteria 12631
288 Ga0207664_10428387 3300025929 Bacteria 1179
289 Ga0207644_10079343 3300025931 Bacteria 2422
290 Ga0207690_10008974 3300025932 Bacteria 5934
291 Ga0207690_10009308 3300025932 Bacteria 5836
292 Ga0207690_10009401 3300025932 Bacteria 5806
293 Ga0207690_10125842 3300025932 Bacteria 1868
294 Ga0207706_10000778 3300025933 Bacteria 33033
295 Ga0207706_10078895 3300025933 Bacteria 2896
296 Ga0207670_10021106 3300025936 Bacteria 4013
297 Ga0207704_10000073 3300025938 Bacteria 62449
298 Ga0207704_10009480 3300025938 Bacteria 4700
299 Ga0207691_10034462 3300025940 Bacteria 4707
300 Ga0207691_10201572 3300025940 Bacteria 1731
301 Ga0207711_10023332 3300025941 Bacteria 5178
302 Ga0207689_10043784 3300025942 Bacteria 3700
303 Ga0207689_10233228 3300025942 Bacteria 1521
304 Ga0207689_10257361 3300025942 Bacteria 1444
305 Ga0207661_10263782 3300025944 Bacteria 1535
306 Ga0207667_10015380 3300025949 Bacteria 8697
307 Ga0207667_10029739 3300025949 Bacteria 5919
308 Ga0207667_10031421 3300025949 Bacteria 5732
309 Ga0207667_10054676 3300025949 Bacteria 4199
310 Ga0207667_10147481 3300025949 Bacteria 2422
311 Ga0207667_10200120 3300025949 Bacteria 2049
312 Ga0207667_10208566 3300025949 Bacteria 2003
313 Ga0207667_10368217 3300025949 Bacteria 1465
314 Ga0207651_10037053 3300025960 Bacteria 3191
315 Ga0207651_10118923 3300025960 Bacteria 2000
316 Ga0207712_10114882 3300025961 Bacteria 2025
317 Ga0207712_10124825 3300025961 Bacteria 1953
318 Ga0207668_10205100 3300025972 Bacteria 1573
319 Ga0207668_10282012 3300025972 Bacteria 1363
320 Ga0207640_10021706 3300025981 Bacteria 3830
321 Ga0207658_10343012 3300025986 Bacteria 1299
322 Ga0207677_10031213 3300026023 Bacteria 3411
323 Ga0207677_10070131 3300026023 Bacteria 2468
324 Ga0207677_10387821 3300026023 Bacteria 1181
325 Ga0207639_10001388 3300026041 Bacteria 16358
326 Ga0207639_10002746 3300026041 Bacteria 11813
327 Ga0207639_10012095 3300026041 Bacteria 6003
328 Ga0207639_10044708 3300026041 Bacteria 3332
329 Ga0207639_10063212 3300026041 Bacteria 2865
330 Ga0207639_10091876 3300026041 Bacteria 2431
331 Ga0207639_10233769 3300026041 Bacteria 1595
332 Ga0207678_10099852 3300026067 Bacteria 2479
333 Ga0207678_10118529 3300026067 Bacteria 2259
334 Ga0207678_10255147 3300026067 Bacteria 1502
335 Ga0207702_10010549 3300026078 Bacteria 7724
336 Ga0207702_10145112 3300026078 Bacteria 2153
337 Ga0207641_10023324 3300026088 Bacteria 5099
338 Ga0207641_10483410 3300026088 Bacteria 1200
339 Ga0207648_10000529 3300026089 Bacteria 42805
340 Ga0207674_10008653 3300026116 Bacteria 11724
341 Ga0207674_10043602 3300026116 Bacteria 4625
342 Ga0207674_10070147 3300026116 Bacteria 3523
343 Ga0207675_100125328 3300026118 Bacteria 2433
344 Ga0207683_10000805 3300026121 Bacteria 28690
345 Ga0207683_10002525 3300026121 Bacteria 15981
346 Ga0207683_10163804 3300026121 Bacteria 2011
347 Ga0207698_10009007 3300026142 Bacteria 6338
348 Ga0207698_10359039 3300026142 Bacteria 1379
349 Ga0209179_1000117 3300027512 Bacteria 9238
350 Ga0268266_10000001 3300028379 Bacteria 4040580
351 Ga0268266_10000089 3300028379 Bacteria 198566
352 Ga0268266_10059539 3300028379 Bacteria 3291
353 Ga0268265_10785618 3300028380 Bacteria 927
354 Ga0268264_10019055 3300028381 Bacteria 5610
355 Ga0268264_10072368 3300028381 Bacteria 2923
356 Ga0307517_10013529 3300028786 Bacteria 11068
357 Ga0265338_10057002 3300028800 Bacteria 3459
358 Ga0265330_10034901 3300031235 Bacteria 2246
359 Ga0265329_10043181 3300031242 Bacteria 1442
360 Ga0265340_10138090 3300031247 Bacteria 1115
361 Ga0265327_10135530 3300031251 Bacteria 1155
362 Ga0265316_10005008 3300031344 Bacteria 13006
363 Ga0265316_10011591 3300031344 Bacteria 7940
364 Ga0307508_10191748 3300031616 Bacteria 1645
365 Ga0265314_10032095 3300031711 Bacteria 3868
366 Ga0265342_10021327 3300031712 Bacteria 4141
367 Ga0307516_10155497 3300031730 Bacteria 2042
368 Ga0307405_10000035 3300031731 Bacteria 92134
369 Ga0307407_10000005 3300031903 Bacteria 233125
370 Ga0307416_100000001 3300032002 Bacteria 515017
371 Ga0307414_10059586 3300032004 Bacteria 2696
372 Ga0307510_10001230 3300033180 Bacteria 27766
373 Ga0373923_0038834 3300035111 Bacteria 1953
374 Ga0373941_0055731 3300035115 Bacteria 1271
375 Ga0373933_0058761 3300035724 Bacteria 2314
376 Ga0373937_0133311 3300036401 Bacteria 2321
377 Ga0373937_0353219 3300036401 Bacteria 1393
378 Ga0373925_0049340 3300037068 Bacteria 3138
379 Ga0395899_0000592 3300037312 Bacteria 38093
380 Ga0395899_0131446 3300037312 Bacteria 1787
381 Ga0395900_0000277 3300037418 Bacteria 77256
382 Ga0395900_0070533 3300037418 Bacteria 3593
383 Ga0395898_0014807 3300037466 Bacteria 8006
384 Ga0395905_0000068 3300037471 Bacteria 177163
385 Ga0395905_0000727 3300037471 Bacteria 43437
386 Ga0395905_0158649 3300037471 Bacteria 2127
387 Ga0395901_0000199 3300038443 Bacteria 76415
388 Ga0395901_0005884 3300038443 Bacteria 12410
389 Ga0436365_0192168 3300039437 Bacteria 4325
390 Ga0436361_0399615 3300039447 Bacteria 11828
391 Ga0436363_1567754 3300039450 Bacteria 1650
392 Ga0451793_1089417 3300041452 Bacteria 1284
393 Ga0439448_0018148 3300042005 Bacteria 2153
394 Ga0466972_0002599 3300044658 Bacteria 8954
395 Ga0466963_0281646 3300044694 Bacteria 1168
396 Ga0453684_0000159 3300044712 Bacteria 300297
397 Ga0453684_0001394 3300044712 Bacteria 69957
398 Ga0451576_0000401 3300045051 Bacteria 101008
399 Ga0495629_0063328 3300046459 Bacteria 2583
400 Ga0495638_0000608 3300046460 Bacteria 40068
401 Ga0495650_0000561 3300046471 Bacteria 52692
402 Ga0495580_0116580 3300046472 Bacteria 1855
403 Ga0495582_0029671 3300046473 Bacteria 3002
404 Ga0495594_0249578 3300046499 Bacteria 1011
405 Ga0495606_0000016 3300046507 Bacteria 284865
406 Ga0495606_0285228 3300046507 Bacteria 901
407 Ga0495610_0000074 3300046512 Bacteria 120043
408 Ga0495610_0000405 3300046512 Bacteria 44184
409 Ga0495630_0183432 3300046517 Bacteria 1596
410 Ga0495631_0003046 3300046518 Bacteria 9261
411 Ga0495637_0075320 3300046520 Bacteria 1354
412 Ga0495640_0268553 3300046533 Bacteria 1064
413 Ga0495622_0159679 3300046557 Bacteria 1017
414 Ga0495668_0145201 3300046616 Bacteria 1299
415 Ga0495634_0162232 3300046642 Bacteria 1409
416 Ga0495625_0116004 3300046660 Bacteria 1827
417 Ga0495649_0001113 3300046694 Bacteria 20936
418 Ga0495649_0031994 3300046694 Bacteria 2900
419 Ga0495674_0133103 3300047319 Bacteria 2094
420 Ga0495680_0003790 3300047322 Bacteria 14700
421 Ga0495683_0083142 3300047323 Bacteria 1559
422 Ga0495681_0025230 3300047470 Bacteria 3113
423 Ga0495684_0047798 3300047471 Bacteria 3272
424 Ga0495686_0000034 3300047472 Bacteria 325038
425 Ga0496101_0714763 3300048904 Bacteria 791
426 Ga0496102_0098583 3300048905 Bacteria 2712
427 Ga0496103_0013055 3300048906 Bacteria 4925
428 Ga0496104_0000041 3300048907 Bacteria 161394
429 Ga0496104_0084089 3300048907 Bacteria 3036
430 Ga0496105_0000022 3300048908 Bacteria 161208
431 Ga0496109_0430585 3300048912 Bacteria 1246
432 Ga0496110_0010940 3300048913 Bacteria 7400
433 Ga0496110_0228291 3300048913 Bacteria 1693
434 Ga0496111_0069550 3300048914 Bacteria 2560
435 Ga0496113_0297173 3300048916 Bacteria 1293
436 Ga0496114_0114596 3300048917 Bacteria 2312
437 Ga0496114_0416734 3300048917 Bacteria 1189
438 Ga0496115_0000741 3300048918 Bacteria 24104
439 Ga0496115_0182626 3300048918 Bacteria 1734
440 Ga0496118_0001034 3300048921 Bacteria 43301
441 Ga0496118_0046777 3300048921 Bacteria 3361
442 Ga0496118_0133339 3300048921 Bacteria 1590
443 Ga0496122_0000390 3300048925 Bacteria 93522
444 Ga0496124_0000001 3300048927 Bacteria 1747840
445 Ga0496126_0003719 3300048929 Bacteria 19023
446 Ga0496126_0035815 3300048929 Bacteria 4646
447 Ga0495678_018456 3300049459 Bacteria 3136
448 Ga0501031_0000726 3300049568 Bacteria 19747
449 Ga0501031_0017984 3300049568 Bacteria 4598
450 Ga0501032_0004918 3300049569 Bacteria 9996
451 Ga0501032_0038006 3300049569 Bacteria 3280
452 Ga0501033_0000673 3300049570 Bacteria 31522
453 Ga0501033_0021334 3300049570 Bacteria 4885
454 Ga0501033_0122033 3300049570 Bacteria 1890
455 Ga0501034_0004751 3300049571 Bacteria 15037
456 Ga0501034_0005765 3300049571 Bacteria 13466
457 Ga0501034_0036202 3300049571 Bacteria 5001
458 Ga0501034_0124385 3300049571 Bacteria 2564
459 Ga0501034_0279379 3300049571 Bacteria 1609
460 Ga0501034_0311986 3300049571 Bacteria 1507
461 Ga0501036_0004254 3300049572 Bacteria 11545
462 Ga0501036_0013764 3300049572 Bacteria 6729
463 Ga0501037_0000547 3300049573 Bacteria 29890
464 Ga0501037_0011223 3300049573 Bacteria 6594
465 Ga0501037_0021831 3300049573 Bacteria 4738
466 Ga0501037_0039989 3300049573 Bacteria 3451
467 Ga0501038_0002529 3300049574 Bacteria 17046
468 Ga0501038_0002643 3300049574 Bacteria 16763
469 Ga0501038_0125528 3300049574 Bacteria 2112
470 Ga0501038_0139616 3300049574 Bacteria 1983
471 Ga0501038_0152039 3300049574 Bacteria 1886
472 Ga0501040_0037723 3300049576 Bacteria 3284
473 Ga0501042_0401520 3300049578 Bacteria 993
474 Ga0501043_0040368 3300049579 Bacteria 3667
475 Ga0501043_0063952 3300049579 Bacteria 2889
476 Ga0501043_0165722 3300049579 Bacteria 1725
477 Ga0501043_0233421 3300049579 Bacteria 1420
478 Ga0501046_0001515 3300049580 Bacteria 22165
479 Ga0501046_0002948 3300049580 Bacteria 15741
480 Ga0501046_0011428 3300049580 Bacteria 7589
481 Ga0501046_0098644 3300049580 Bacteria 2243
482 Ga0501046_0301751 3300049580 Bacteria 1169
483 Ga0501047_0004941 3300049581 Bacteria 12519
484 Ga0501047_0012974 3300049581 Bacteria 7889
485 Ga0501047_0039508 3300049581 Bacteria 4563
486 Ga0501047_0074521 3300049581 Bacteria 3267
487 Ga0501047_0113644 3300049581 Bacteria 2590
488 Ga0501047_0179651 3300049581 Bacteria 1983
489 Ga0501047_0500318 3300049581 Bacteria 1042
490 Ga0501048_0035796 3300049582 Bacteria 3570
491 Ga0501067_0003237 3300049583 Bacteria 8966
492 Ga0501068_0027067 3300049584 Bacteria 3383
493 Ga0501068_0069886 3300049584 Bacteria 2141
494 Ga0501068_0069947 3300049584 Bacteria 2140
495 Ga0501068_0218157 3300049584 Bacteria 1212
496 Ga0501069_0019537 3300049585 Bacteria 3665
497 Ga0501070_0157583 3300049586 Bacteria 1872
498 Ga0501070_0299349 3300049586 Bacteria 1310
499 Ga0501071_0024266 3300049587 Bacteria 4240
500 Ga0501072_0136022 3300049588 Bacteria 1959
501 Ga0501073_0007940 3300049589 Bacteria 7873
502 Ga0501073_0119722 3300049589 Bacteria 1824
503 Ga0501074_0002514 3300049590 Bacteria 12788
504 Ga0501074_0017788 3300049590 Bacteria 5164
505 Ga0501074_0055716 3300049590 Bacteria 2849
506 Ga0501074_0209862 3300049590 Bacteria 1387
507 Ga0501079_0074175 3300049741 Bacteria 2630
508 Ga0501080_0013902 3300049742 Bacteria 7409
509 Ga0501080_0015585 3300049742 Bacteria 7010
510 Ga0501080_0020208 3300049742 Bacteria 6164
511 Ga0501080_0026080 3300049742 Bacteria 5429
512 Ga0501080_0052431 3300049742 Bacteria 3796
513 Ga0501080_0164670 3300049742 Bacteria 2047
514 Ga0501080_0190715 3300049742 Bacteria 1883
515 Ga0501083_0009807 3300049744 Bacteria 6760
516 Ga0501035_0013506 3300049822 Bacteria 7537
517 Ga0501035_0026004 3300049822 Bacteria 5361
518 Ga0501044_0005212 3300049823 Bacteria 14469
519 Ga0501044_0006789 3300049823 Bacteria 12615
520 Ga0501044_0014071 3300049823 Bacteria 8640
521 Ga0501044_0064298 3300049823 Bacteria 3746
522 Ga0501044_0078926 3300049823 Bacteria 3336
523 Ga0501044_0147142 3300049823 Bacteria 2340
524 Ga0501044_0242118 3300049823 Bacteria 1747
525 Ga0501045_0017680 3300049824 Bacteria 5063
526 nmdc:mga05p37_160244_c1 3300050507 Bacteria 2748
527 nmdc:mga09592_4282_c1 3300050508 Bacteria 11531
528 nmdc:mga08y16_763574_c1 3300050511 Bacteria 962
529 Ga0495612_0033652 3300053078 Bacteria 2074
530 Ga0500644_0000718 3300053088 Bacteria 11724
531 Ga0500651_0000183 3300053093 Bacteria 40305
532 Ga0500651_0002980 3300053093 Bacteria 9126
533 Ga0500651_0012667 3300053093 Bacteria 5116
534 Ga0500568_0000844 3300053139 Bacteria 21551
535 Ga0500634_0138442 3300053161 Bacteria 1157
536 Ga0501084_0000690 3300054114 Bacteria 25838
537 Ga0501084_0014880 3300054114 Bacteria 6452
538 Ga0501084_0017566 3300054114 Bacteria 5950
539 Ga0501082_0000275 3300060353 Bacteria 45431
540 Ga0501082_0079210 3300060353 Bacteria 2834
541 Ga0530510_0128554 3300061734 Bacteria 1863
542 2586208513 2585427687 Bacteria 5544917
543 2738856660 2738541302 Bacteria 5944758
544 2739301795 2738543023 Bacteria 6767879
545 2739590106 2739367651 Bacteria 6359826
546 2739615343 2739367656 Bacteria 5152243
547 2739644307 2739367663 Bacteria 5040914
548 2739730027 2739367700 Bacteria 4747630
549 2745162257 2744054655 Bacteria 3552603
550 2819548505 2818991437 Bacteria 5805520
551 2842722921 2842722452 Bacteria 6263924
552 2842913336 2842909656 Bacteria 6185908
553 2849286663 2849281842 Bacteria 6065644
554 2852627730 2852627209 Bacteria 5896285
555 2884414226 2884411467 Bacteria 5246714
556 2889308810 2889306138 Bacteria 6358934
557 2895397191 2895395659 Bacteria 3983269
558 2904448510 2904445276 Bacteria 5310396
559 2917704800 2917699015 Bacteria 7043791
560 2919187907 2919186247 Bacteria 6244071
561 2928965775 2928963466 Bacteria 5165703
562 2939612821 2939611941 Bacteria 3892017
563 2945999884 2945997725 Bacteria 6404843
564 2954016498 2954016120 Bacteria 6446024
565 8015559701 8015556637 Bacteria 3582323
566 Ga0157378_10000084
567 JGI24737J22298_10011344
568 JGI24033J26618_1000230
569 JGI25162J39368_1000469
570 JGI25162J39368_1001913
571 JGI25162J39368_1003611
572 JGI25157J39369_1001903
573 JGI25164J39214_1000269
574 JGI25164J39214_1001410
575 JGI25151J46595_10001114
576 JGI25165J46597_1000535
577 Ga0055542_1000234
578 Ga0055536_1000007
579 Ga0055530_10003348
580 Ga0065714_10007410
581 Ga0065714_10064842
582 Ga0065714_10065235
583 Ga0065714_10170270
584 Ga0065704_10073689
585 Ga0070658_10000018
586 Ga0070658_10014183
587 Ga0070658_10322396
588 Ga0070676_10002876
589 Ga0070683_100640697
590 Ga0070670_100069920
591 Ga0070670_100127408
592 Ga0068869_100007891
593 Ga0070666_10001536
594 Ga0070666_10027008
595 Ga0070666_10090224
596 Ga0070666_10197033
597 Ga0070666_10374421
598 Ga0070680_100125629
599 Ga0070680_100233519
600 Ga0070682_100066499
601 Ga0068868_100048161
602 Ga0068868_100175536
603 Ga0070660_100015151
604 Ga0070660_100045746
605 Ga0070660_100201483
606 Ga0070689_100031851
607 Ga0070661_100051220
608 Ga0070692_10007991
609 Ga0070692_10047329
610 Ga0070669_100165371
611 Ga0070675_100313692
612 Ga0070675_100381316
613 Ga0070671_100169989
614 Ga0070673_100104787
615 Ga0070688_100078975
616 Ga0070659_100064651
617 Ga0070659_100178384
618 Ga0070667_100021724
619 Ga0070667_100065972
620 Ga0070667_100182689
621 Ga0070667_100634723
622 Ga0070714_100000020
623 Ga0070714_100003124
624 Ga0070714_100072138
625 Ga0070710_10032553
626 Ga0070710_10330168
627 Ga0070711_100050995
628 Ga0070711_100205295
629 Ga0070694_100006352
630 Ga0070663_100056138
631 Ga0070678_100000238
632 Ga0070662_100000343
633 Ga0070662_100449081
634 Ga0070681_10094279
635 Ga0070681_10146007
636 Ga0068867_100001894
637 Ga0070685_10014301
638 Ga0070679_100143552
639 Ga0070679_100177553
640 Ga0070684_100023894
641 Ga0070684_100277736
642 Ga0068853_100003732
643 Ga0068853_100007643
644 Ga0068853_100014673
645 Ga0068853_100023924
646 Ga0068853_100078383
647 Ga0068853_100111450
648 Ga0068853_100146195
649 Ga0070672_100034725
650 Ga0070695_100009050
651 Ga0070693_100017659
652 Ga0070665_100000026
653 Ga0070665_100000072
654 Ga0070665_100045983
655 Ga0068855_100011186
656 Ga0068855_100045231
657 Ga0068855_100242906
658 Ga0068855_100244225
659 Ga0068855_100428068
660 Ga0068855_100531945
661 Ga0068855_100621228
662 Ga0068857_100076736
663 Ga0068856_100007535
664 Ga0068856_100027783
665 Ga0068856_100382691
666 Ga0068856_100507085
667 Ga0068852_100000143
668 Ga0068852_100016382
669 Ga0068852_100082190
670 Ga0068864_100000400
671 Ga0068864_100321810
672 Ga0068864_100463653
673 Ga0068863_100027534
674 Ga0068863_100027921
675 Ga0068863_100584858
676 Ga0068863_100587694
677 Ga0068863_100684610
678 Ga0068862_100197401
679 Ga0081455_10294346
680 Ga0081455_10307537
681 Ga0081540_1011365
682 Ga0097621_100000028
683 Ga0097621_100032411
684 Ga0097621_100049554
685 Ga0097621_100126469
686 Ga0097621_100159001
687 Ga0068871_100000066
688 Ga0068871_100010632
689 Ga0068871_100103394
690 Ga0075428_100002048
691 Ga0075428_100072476
692 Ga0075430_100034901
693 Ga0075431_100000149
694 Ga0075429_100000056
695 Ga0068865_100000551
696 Ga0068865_100001490
697 Ga0068865_100216718
698 Ga0105244_10031962
699 Ga0105240_10007839
700 Ga0105240_10012898
701 Ga0105240_10013894
702 Ga0105240_10019601
703 Ga0105240_10053280
704 Ga0105245_10024611
705 Ga0105241_10000711
706 Ga0105241_10002900
707 Ga0105242_10006736
708 Ga0105242_10106803
709 Ga0105242_10136347
710 Ga0105242_10641034
711 Ga0105248_10024084
712 Ga0105237_10000491
713 Ga0105237_10001267
714 Ga0105237_10006108
715 Ga0105237_10035158
716 Ga0105238_10010062
717 Ga0105238_10013627
718 Ga0105238_10020069
719 Ga0105238_10035576
720 Ga0105238_10297896
721 Ga0105238_10422321
722 Ga0105238_10881303
723 Ga0105249_10025357
724 Ga0099796_10000261
725 Ga0105239_10005993
726 Ga0105239_10007020
727 Ga0105239_10043959
728 Ga0105239_10065055
729 Ga0105239_10335422
730 Ga0157373_10013395
731 Ga0157371_10000901
732 Ga0157370_10004580
733 Ga0157370_10011717
734 Ga0157370_10012867
735 Ga0157370_10017982
736 Ga0157370_10034372
737 Ga0157370_10131866
738 Ga0157370_10152324
739 Ga0157370_10215150
740 Ga0157369_10000015
741 Ga0157369_10000030
742 Ga0157369_10046414
743 Ga0157369_10187559
744 Ga0157369_10328418
745 Ga0157374_10000174
746 Ga0157374_10001861
747 Ga0157374_10015286
748 Ga0157374_10067873
749 Ga0157378_10013832
750 Ga0157378_10055544
751 Ga0163162_10000007
752 Ga0163162_10000010
753 Ga0163162_10007761
754 Ga0157372_10008558
755 Ga0157372_10027310
756 Ga0157372_10050841
757 Ga0157372_10220280
758 Ga0157372_10309327
759 Ga0157375_10005772
760 Ga0157375_10030316
761 Ga0163163_10000300
762 Ga0163163_10013575
763 Ga0163163_10407115
764 Ga0157380_10302629
765 Ga0182008_10000130
766 Ga0182008_10001316
767 Ga0182008_10028841
768 Ga0182008_10033522
769 Ga0182008_10036206
770 Ga0182008_10073328
771 Ga0157377_10044175
772 Ga0157379_10005114
773 Ga0157376_10006575
774 Ga0157376_10014791
775 Ga0157376_10117075
776 Ga0182006_1001053
777 Ga0182006_1001108
778 Ga0182006_1002573
779 Ga0182006_1004766
780 Ga0182006_1018359
781 Ga0182007_10000010
782 Ga0182007_10002352
783 Ga0182007_10030385
784 Ga0183373_1005
785 Ga0163161_10000206
786 Ga0163161_10000729
787 Ga0163161_10010548
788 Ga0209672_100411
789 Ga0207427_100157
790 Ga0207427_100235
791 Ga0207427_102188
792 Ga0209437_100202
793 Ga0209437_100223
794 Ga0209437_100254
795 Ga0209646_1002295
796 Ga0209026_1000077
797 Ga0209026_1000139
798 Ga0209026_1002607
799 Ga0209148_1000005
800 Ga0209759_1008551
801 Ga0209759_1010910
802 Ga0209759_1015662
803 Ga0209233_1000252
804 Ga0209233_1000272
805 Ga0209233_1007249
806 Ga0209455_1000188
807 Ga0209455_1017598
808 Ga0209676_1000058
809 Ga0209050_1000054
810 Ga0207655_1076569
811 Ga0207692_10051132
812 Ga0207680_10001173
813 Ga0207680_10174137
814 Ga0207647_10000328
815 Ga0207647_10014181
816 Ga0207699_10008828
817 Ga0207645_10000190
818 Ga0207705_10000036
819 Ga0207705_10024735
820 Ga0207705_10127950
821 Ga0207654_10000978
822 Ga0207654_10110661
823 Ga0207707_10020119
824 Ga0207707_10223795
825 Ga0207695_10000112
826 Ga0207695_10000420
827 Ga0207695_10002721
828 Ga0207695_10005336
829 Ga0207695_10008101
830 Ga0207695_10026795
831 Ga0207671_10000610
832 Ga0207671_10001525
833 Ga0207671_10021503
834 Ga0207671_10023748
835 Ga0207671_10484671
836 Ga0207657_10009926
837 Ga0207657_10196289
838 Ga0207649_10010149
839 Ga0207649_10137775
840 Ga0207652_10009487
841 Ga0207694_10003531
842 Ga0207694_10010134
843 Ga0207694_10011279
844 Ga0207694_10114396
845 Ga0207694_10158399
846 Ga0207694_10342961
847 Ga0207694_10489904
848 Ga0207650_10159495
849 Ga0207659_10088480
850 Ga0207687_10081650
851 Ga0207664_10000023
852 Ga0207664_10002288
853 Ga0207664_10428387
854 Ga0207644_10079343
855 Ga0207690_10008974
856 Ga0207690_10009308
857 Ga0207690_10009401
858 Ga0207690_10125842
859 Ga0207706_10000778
860 Ga0207706_10078895
861 Ga0207670_10021106
862 Ga0207704_10000073
863 Ga0207704_10009480
864 Ga0207691_10034462
865 Ga0207691_10201572
866 Ga0207711_10023332
867 Ga0207689_10043784
868 Ga0207689_10233228
869 Ga0207689_10257361
870 Ga0207661_10263782
871 Ga0207667_10015380
872 Ga0207667_10029739
873 Ga0207667_10031421
874 Ga0207667_10054676
875 Ga0207667_10147481
876 Ga0207667_10200120
877 Ga0207667_10208566
878 Ga0207667_10368217
879 Ga0207651_10037053
880 Ga0207651_10118923
881 Ga0207712_10114882
882 Ga0207712_10124825
883 Ga0207668_10205100
884 Ga0207668_10282012
885 Ga0207640_10021706
886 Ga0207658_10343012
887 Ga0207677_10031213
888 Ga0207677_10070131
889 Ga0207677_10387821
890 Ga0207639_10001388
891 Ga0207639_10002746
892 Ga0207639_10012095
893 Ga0207639_10044708
894 Ga0207639_10063212
895 Ga0207639_10091876
896 Ga0207639_10233769
897 Ga0207678_10099852
898 Ga0207678_10118529
899 Ga0207678_10255147
900 Ga0207702_10010549
901 Ga0207702_10145112
902 Ga0207641_10023324
903 Ga0207641_10483410
904 Ga0207648_10000529
905 Ga0207674_10008653
906 Ga0207674_10043602
907 Ga0207674_10070147
908 Ga0207675_100125328
909 Ga0207683_10000805
910 Ga0207683_10002525
911 Ga0207683_10163804
912 Ga0207698_10009007
913 Ga0207698_10359039
914 Ga0209179_1000117
915 Ga0268266_10000001
916 Ga0268266_10000089
917 Ga0268266_10059539
918 Ga0268265_10785618
919 Ga0268264_10019055
920 Ga0268264_10072368
921 Ga0307517_10013529
922 Ga0265338_10057002
923 Ga0265330_10034901
924 Ga0265329_10043181
925 Ga0265340_10138090
926 Ga0265327_10135530
927 Ga0265316_10005008
928 Ga0265316_10011591
929 Ga0307508_10191748
930 Ga0265314_10032095
931 Ga0265342_10021327
932 Ga0307516_10155497
933 Ga0307405_10000035
934 Ga0307407_10000005
935 Ga0307416_100000001
936 Ga0307414_10059586
937 Ga0307510_10001230
938 Ga0373923_0038834
939 Ga0373941_0055731
940 Ga0373933_0058761
941 Ga0373937_0133311
942 Ga0373937_0353219
943 Ga0373925_0049340
944 Ga0395899_0000592
945 Ga0395899_0131446
946 Ga0395900_0000277
947 Ga0395900_0070533
948 Ga0395898_0014807
949 Ga0395905_0000068
950 Ga0395905_0000727
951 Ga0395905_0158649
952 Ga0395901_0000199
953 Ga0395901_0005884
954 Ga0436365_0192168
955 Ga0436361_0399615
956 Ga0436363_1567754
957 Ga0451793_1089417
958 Ga0439448_0018148
959 Ga0466972_0002599
960 Ga0466963_0281646
961 Ga0453684_0000159
962 Ga0453684_0001394
963 Ga0451576_0000401
964 Ga0495629_0063328
965 Ga0495638_0000608
966 Ga0495650_0000561
967 Ga0495580_0116580
968 Ga0495582_0029671
969 Ga0495594_0249578
970 Ga0495606_0000016
971 Ga0495606_0285228
972 Ga0495610_0000074
973 Ga0495610_0000405
974 Ga0495630_0183432
975 Ga0495631_0003046
976 Ga0495637_0075320
977 Ga0495640_0268553
978 Ga0495622_0159679
979 Ga0495668_0145201
980 Ga0495634_0162232
981 Ga0495625_0116004
982 Ga0495649_0001113
983 Ga0495649_0031994
984 Ga0495674_0133103
985 Ga0495680_0003790
986 Ga0495683_0083142
987 Ga0495681_0025230
988 Ga0495684_0047798
989 Ga0495686_0000034
990 Ga0496101_0714763
991 Ga0496102_0098583
992 Ga0496103_0013055
993 Ga0496104_0000041
994 Ga0496104_0084089
995 Ga0496105_0000022
996 Ga0496109_0430585
997 Ga0496110_0010940
998 Ga0496110_0228291
999 Ga0496111_0069550
1000 Ga0496113_0297173
1001 Ga0496114_0114596
1002 Ga0496114_0416734
1003 Ga0496115_0000741
1004 Ga0496115_0182626
1005 Ga0496118_0001034
1006 Ga0496118_0046777
1007 Ga0496118_0133339
1008 Ga0496122_0000390
1009 Ga0496124_0000001
1010 Ga0496126_0003719
1011 Ga0496126_0035815
1012 Ga0495678_018456
1013 Ga0501031_0000726
1014 Ga0501031_0017984
1015 Ga0501032_0004918
1016 Ga0501032_0038006
1017 Ga0501033_0000673
1018 Ga0501033_0021334
1019 Ga0501033_0122033
1020 Ga0501034_0004751
1021 Ga0501034_0005765
1022 Ga0501034_0036202
1023 Ga0501034_0124385
1024 Ga0501034_0279379
1025 Ga0501034_0311986
1026 Ga0501036_0004254
1027 Ga0501036_0013764
1028 Ga0501037_0000547
1029 Ga0501037_0011223
1030 Ga0501037_0021831
1031 Ga0501037_0039989
1032 Ga0501038_0002529
1033 Ga0501038_0002643
1034 Ga0501038_0125528
1035 Ga0501038_0139616
1036 Ga0501038_0152039
1037 Ga0501040_0037723
1038 Ga0501042_0401520
1039 Ga0501043_0040368
1040 Ga0501043_0063952
1041 Ga0501043_0165722
1042 Ga0501043_0233421
1043 Ga0501046_0001515
1044 Ga0501046_0002948
1045 Ga0501046_0011428
1046 Ga0501046_0098644
1047 Ga0501046_0301751
1048 Ga0501047_0004941
1049 Ga0501047_0012974
1050 Ga0501047_0039508
1051 Ga0501047_0074521
1052 Ga0501047_0113644
1053 Ga0501047_0179651
1054 Ga0501047_0500318
1055 Ga0501048_0035796
1056 Ga0501067_0003237
1057 Ga0501068_0027067
1058 Ga0501068_0069886
1059 Ga0501068_0069947
1060 Ga0501068_0218157
1061 Ga0501069_0019537
1062 Ga0501070_0157583
1063 Ga0501070_0299349
1064 Ga0501071_0024266
1065 Ga0501072_0136022
1066 Ga0501073_0007940
1067 Ga0501073_0119722
1068 Ga0501074_0002514
1069 Ga0501074_0017788
1070 Ga0501074_0055716
1071 Ga0501074_0209862
1072 Ga0501079_0074175
1073 Ga0501080_0013902
1074 Ga0501080_0015585
1075 Ga0501080_0020208
1076 Ga0501080_0026080
1077 Ga0501080_0052431
1078 Ga0501080_0164670
1079 Ga0501080_0190715
1080 Ga0501083_0009807
1081 Ga0501035_0013506
1082 Ga0501035_0026004
1083 Ga0501044_0005212
1084 Ga0501044_0006789
1085 Ga0501044_0014071
1086 Ga0501044_0064298
1087 Ga0501044_0078926
1088 Ga0501044_0147142
1089 Ga0501044_0242118
1090 Ga0501045_0017680
1091 nmdc:mga05p37_160244_c1
1092 nmdc:mga09592_4282_c1
1093 nmdc:mga08y16_763574_c1
1094 Ga0495612_0033652
1095 Ga0500644_0000718
1096 Ga0500651_0000183
1097 Ga0500651_0002980
1098 Ga0500651_0012667
1099 Ga0500568_0000844
1100 Ga0500634_0138442
1101 Ga0501084_0000690
1102 Ga0501084_0014880
1103 Ga0501084_0017566
1104 Ga0501082_0000275
1105 Ga0501082_0079210
1106 Ga0530510_0128554
1107 2586208513
1108 2738856660
1109 2739301795
1110 2739590106
1111 2739615343
1112 2739644307
1113 2739730027
1114 2745162257
1115 2819548505
1116 2842722921
1117 2842913336
1118 2849286663
1119 2852627730
1120 2884414226
1121 2889308810
1122 2895397191
1123 2904448510
1124 2917704800
1125 2919187907
1126 2928965775
1127 2939612821
1128 2945999884
1129 2954016498
1130 8015559701

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00303

Thymidylat_synt

Thymidylate synthase

30

292

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g8x-assembly1.cif.gz_B escherichia coli y209w apoprotein 0.993 3 262
4fog-assembly2.cif.gz_B crystal structure of mtb thya in complex with 5-fluoro-dump and 5-methyltetrahydrofolic acid 0.9927 1 261
3bfi-assembly1.cif.gz_A-2 e. coli thymidylate synthase y209m mutant complexed with 5-nitro-dump 0.9924 3 264
4h0r-assembly1.cif.gz_A crystal structure of thymidylate synthase from corynebacterium glutamicum 0.9918 3 258
4h0u-assembly1.cif.gz_B crystal structure of thymidylate synthase from corynebacterium glutamicum in complex with dump 0.9915 3 259
ID Description Score Start End Superfamily
3ix6B00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9772 2 251 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9759 2 264 3.30.572.10
1bo7A00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9686 2 264 3.30.572.10
6qyaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9646 2 262 3.30.572.10
3dgaC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.9638 2 259 3.30.572.10
ID Description Score Start End GO Terms
AF-A0A059X1I7-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 1.001 29 209 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A528BC42-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 1.001 49 237 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A6N8MV19-F1-model_v4 deleted 1.001 37 190
AF-A0A1G0F8E3-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 1.001 66 204 GO:0004799
GO:0005829
GO:0006231
GO:0032259
AF-A0A355C418-F1-model_v4 Thymidylate synthase (EC 2.1.1.45) 1 1 222 GO:0004799
GO:0005829
GO:0006231
GO:0032259

Map