F464256

General Info

Members Datasets Scaffolds Average Seq Length
565 365 513 333

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10106747|Ga0105241_101067472
Length 392
Sequence MAALEIPAGNEGLQAGAGNDDRASQWLFGRKRPAKRRDLRRNGPVGVQFLFRTLECARGRRMSAVAPRHVSVLGREAVEMLSPHAGGIYVDATFGAGGYSRMILDTKGTRVIGIDRDRSAITSGFDLVDRADGRLTLVEDRFSNLAEVCAAQDIDAVDGVVMDVGVSSMQLDSAERGFSFRFGGPLDMRMGHDGPTAADVIAKASETDLANIIYIFGEERHSRGVARAIVAARKEAPITTTQALADIVGRVVRSKPNEIHPATRTFQALRIFVNAELDELHLALSAAERVLKPGGRLVVVSFHSLEDRIVKNFLNQRGKAGGGSRHLPEVAQAEPSFQILTRRPVTPGDAEISANPRARSAKLRAAERTAAPAHAADKLPAWPTIDAVMRGG

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
6 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
11 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
12 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
13 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
14 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
15 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
16 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
17 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
18 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
19 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
20 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
21 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
22 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
23 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
24 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
25 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
26 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
27 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
28 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
29 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
30 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
31 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
32 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
33 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
34 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
35 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
36 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
37 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
38 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
39 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
40 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
41 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
163 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
184 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
185 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
289 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
290 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
291 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
292 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
330 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
331 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
332 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
333 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
334 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
335 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
343 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
344 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
345 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
346 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
347 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
352 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
353 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
357 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
358 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
359 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
360 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
361 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
362 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
363 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
364 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
365 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.53
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.04
Nodule 6.55
Rhizoplane 6.9
Rhizosphere 61.77
Stem 0
Stem Tuber 0
Unclassified 12.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10003909 3300003659 Bacteria 2985
2 JGI25404J52841_10008965 3300003659 Bacteria 2137
3 JGI25404J52841_10018149 3300003659 Bacteria 1524
4 Ga0065165_1044756 3300005262 Bacteria 1293
5 Ga0068869_100265783 3300005334 Bacteria 1375
6 Ga0070680_100048472 3300005336 Bacteria 3462
7 Ga0070680_100078039 3300005336 Bacteria 2728
8 Ga0070660_100006941 3300005339 Bacteria 7854
9 Ga0070674_100051862 3300005356 Bacteria 2828
10 Ga0070659_100025076 3300005366 Bacteria 4578
11 Ga0070667_100113013 3300005367 Bacteria 2356
12 Ga0070714_100252782 3300005435 Bacteria 1630
13 Ga0070713_100000737 3300005436 Bacteria 20973
14 Ga0070663_100071388 3300005455 Bacteria 2526
15 Ga0070663_100139075 3300005455 Bacteria 1852
16 Ga0070663_100181878 3300005455 Bacteria 1631
17 Ga0070663_100228324 3300005455 Bacteria 1465
18 Ga0070663_100324018 3300005455 Bacteria 1240
19 Ga0070678_100033005 3300005456 Bacteria 3589
20 Ga0070678_100041257 3300005456 Bacteria 3270
21 Ga0070678_100165609 3300005456 Bacteria 1795
22 Ga0070681_10277291 3300005458 Bacteria 1587
23 Ga0068867_100046272 3300005459 Bacteria 3195
24 Ga0070707_100083285 3300005468 Bacteria 3090
25 Ga0070684_100078477 3300005535 Bacteria 2917
26 Ga0070684_100175605 3300005535 Bacteria 1947
27 Ga0070697_100012461 3300005536 Bacteria 6662
28 Ga0068853_100025677 3300005539 Bacteria 4944
29 Ga0068853_100035442 3300005539 Bacteria 4238
30 Ga0068853_100097075 3300005539 Bacteria 2600
31 Ga0068853_100135051 3300005539 Bacteria 2211
32 Ga0070665_100035286 3300005548 Bacteria 5028
33 Ga0068855_100110586 3300005563 Bacteria 3154
34 Ga0068855_100152079 3300005563 Bacteria 2631
35 Ga0070664_100122015 3300005564 Bacteria 2283
36 Ga0068857_100018285 3300005577 Bacteria 6148
37 Ga0068856_100018359 3300005614 Bacteria 6779
38 Ga0068852_100005171 3300005616 Bacteria 9302
39 Ga0068852_100251929 3300005616 Bacteria 1692
40 Ga0068864_100067374 3300005618 Bacteria 3108
41 Ga0068866_10029928 3300005718 Bacteria 2608
42 Ga0068861_100128785 3300005719 Bacteria 2052
43 Ga0068861_100190649 3300005719 Bacteria 1713
44 Ga0068851_10007403 3300005834 Bacteria 5038
45 Ga0068858_100079376 3300005842 Bacteria 3049
46 Ga0068860_100138436 3300005843 Bacteria 2338
47 Ga0068862_100348981 3300005844 Bacteria 1372
48 Ga0068862_100434549 3300005844 Bacteria 1234
49 Ga0081455_10004734 3300005937 Bacteria 15128
50 Ga0081455_10007808 3300005937 Bacteria 11208
51 Ga0081455_10016954 3300005937 Bacteria 7002
52 Ga0081540_1002304 3300005983 Bacteria 15663
53 Ga0081540_1006170 3300005983 Bacteria 8787
54 Ga0081540_1006942 3300005983 Bacteria 8161
55 Ga0081540_1009315 3300005983 Bacteria 6773
56 Ga0081540_1010096 3300005983 Bacteria 6425
57 Ga0081540_1016124 3300005983 Bacteria 4693
58 Ga0081540_1054617 3300005983 Bacteria 1951
59 Ga0081540_1084573 3300005983 Bacteria 1416
60 Ga0081539_10017928 3300005985 Bacteria 4941
61 Ga0070717_10005839 3300006028 Bacteria 9020
62 Ga0070717_10009960 3300006028 Bacteria 7151
63 Ga0070717_10328014 3300006028 Bacteria 1365
64 Ga0075365_10045342 3300006038 Bacteria 2884
65 Ga0075365_10060689 3300006038 Bacteria 2523
66 Ga0075368_10005882 3300006042 Bacteria 4246
67 Ga0075363_100008428 3300006048 Bacteria 4798
68 Ga0075363_100016844 3300006048 Bacteria 3614
69 Ga0075363_100136544 3300006048 Bacteria 1378
70 Ga0070712_100037139 3300006175 Bacteria 3319
71 Ga0075367_10010997 3300006178 Bacteria 4772
72 Ga0075367_10027799 3300006178 Bacteria 3221
73 Ga0075367_10030229 3300006178 Bacteria 3104
74 Ga0075369_10011679 3300006186 Bacteria 3458
75 Ga0075369_10129618 3300006186 Bacteria 1145
76 Ga0075366_10023699 3300006195 Bacteria 3576
77 Ga0075434_100335438 3300006871 Bacteria 1532
78 Ga0068865_100023996 3300006881 Bacteria 3998
79 Ga0097620_100442187 3300006931 Bacteria 1396
80 Ga0099824_1010925 3300006942 Bacteria 10470
81 Ga0099795_10017149 3300007788 Bacteria 2305
82 Ga0105240_10083712 3300009093 Bacteria 3913
83 Ga0105240_10212051 3300009093 Bacteria 2262
84 Ga0105240_10235415 3300009093 Bacteria 2125
85 Ga0111539_10050924 3300009094 Bacteria 4933
86 Ga0111539_10290469 3300009094 Bacteria 1903
87 Ga0105245_10025333 3300009098 Bacteria 5217
88 Ga0114129_10030205 3300009147 Bacteria 7674
89 Ga0105243_10155291 3300009148 Bacteria 1967
90 Ga0105241_10106747 3300009174 Bacteria 2235
91 Ga0105242_10135058 3300009176 Bacteria 2134
92 Ga0105248_10343959 3300009177 Bacteria 1679
93 Ga0105237_10008841 3300009545 Bacteria 10858
94 Ga0105238_10038174 3300009551 Bacteria 4878
95 Ga0105249_10245706 3300009553 Bacteria 1772
96 Ga0099796_10006685 3300010159 Bacteria 2969
97 Ga0105239_10044859 3300010375 Bacteria 4846
98 Ga0105239_10108687 3300010375 Bacteria 3073
99 Ga0105246_10187385 3300011119 Bacteria 1598
100 Ga0157370_10108080 3300013104 Bacteria 2601
101 Ga0157369_10037312 3300013105 Bacteria 5320
102 Ga0157378_10005423 3300013297 Bacteria 11182
103 Ga0163162_10039430 3300013306 Bacteria 4720
104 Ga0157372_10372253 3300013307 Bacteria 1664
105 Ga0157375_10018137 3300013308 Bacteria 6377
106 Ga0157375_10196693 3300013308 Bacteria 2171
107 Ga0163163_10054256 3300014325 Bacteria 3959
108 Ga0163163_10179875 3300014325 Bacteria 2162
109 Ga0157380_10118180 3300014326 Bacteria 2241
110 Ga0157380_10344369 3300014326 Bacteria 1392
111 Ga0157377_10102099 3300014745 Bacteria 1711
112 Ga0157379_10228269 3300014968 Bacteria 1687
113 Ga0157376_10110706 3300014969 Bacteria 2416
114 Ga0157376_10157934 3300014969 Bacteria 2053
115 Ga0206356_10999127 3300020070 Bacteria 1261
116 Ga0206353_10526543 3300020082 Bacteria 2458
117 Ga0213875_10004231 3300021388 Bacteria 7922
118 Ga0209233_1017502 3300025261 Bacteria 1950
119 Ga0209564_1000485 3300025295 Bacteria 66032
120 Ga0209758_1029463 3300025297 Bacteria 2294
121 Ga0207647_10116240 3300025904 Bacteria 1579
122 Ga0207645_10065282 3300025907 Bacteria 2326
123 Ga0207643_10037952 3300025908 Bacteria 2705
124 Ga0207705_10057717 3300025909 Bacteria 2800
125 Ga0207705_10199235 3300025909 Bacteria 1517
126 Ga0207654_10231413 3300025911 Bacteria 1231
127 Ga0207707_10009744 3300025912 Bacteria 8335
128 Ga0207695_10045639 3300025913 Bacteria 4650
129 Ga0207695_10103117 3300025913 Bacteria 2845
130 Ga0207695_10153360 3300025913 Bacteria 2241
131 Ga0207671_10165007 3300025914 Bacteria 1717
132 Ga0207693_10100202 3300025915 Bacteria 2271
133 Ga0207693_10152779 3300025915 Bacteria 1816
134 Ga0207663_10003103 3300025916 Bacteria 8061
135 Ga0207660_10017276 3300025917 Bacteria 4790
136 Ga0207660_10082761 3300025917 Bacteria 2362
137 Ga0207657_10002789 3300025919 Bacteria 18797
138 Ga0207657_10009166 3300025919 Bacteria 9982
139 Ga0207657_10223669 3300025919 Bacteria 1507
140 Ga0207649_10129436 3300025920 Bacteria 1712
141 Ga0207652_10026914 3300025921 Bacteria 4792
142 Ga0207652_10128177 3300025921 Bacteria 2261
143 Ga0207646_10044477 3300025922 Bacteria 3986
144 Ga0207700_10001341 3300025928 Bacteria 13962
145 Ga0207700_10052318 3300025928 Bacteria 3053
146 Ga0207664_10135871 3300025929 Bacteria 2075
147 Ga0207664_10213631 3300025929 Bacteria 1670
148 Ga0207644_10025924 3300025931 Bacteria 4035
149 Ga0207644_10271459 3300025931 Bacteria 1359
150 Ga0207690_10211414 3300025932 Bacteria 1479
151 Ga0207706_10030770 3300025933 Bacteria 4787
152 Ga0207706_10059207 3300025933 Bacteria 3373
153 Ga0207669_10049859 3300025937 Bacteria 2499
154 Ga0207704_10068997 3300025938 Bacteria 2231
155 Ga0207665_10060864 3300025939 Bacteria 2558
156 Ga0207665_10123310 3300025939 Bacteria 1832
157 Ga0207665_10361916 3300025939 Bacteria 1097
158 Ga0207691_10024095 3300025940 Bacteria 5724
159 Ga0207691_10107175 3300025940 Bacteria 2488
160 Ga0207711_10092636 3300025941 Bacteria 2660
161 Ga0207711_10131926 3300025941 Bacteria 2241
162 Ga0207689_10036612 3300025942 Bacteria 4073
163 Ga0207689_10112445 3300025942 Bacteria 2238
164 Ga0207689_10157449 3300025942 Bacteria 1872
165 Ga0207679_10014830 3300025945 Bacteria 5135
166 Ga0207667_10040971 3300025949 Bacteria 4929
167 Ga0207667_10205716 3300025949 Bacteria 2018
168 Ga0207667_10443534 3300025949 Bacteria 1319
169 Ga0207712_10281521 3300025961 Bacteria 1357
170 Ga0207668_10090473 3300025972 Bacteria 2246
171 Ga0207668_10254754 3300025972 Bacteria 1427
172 Ga0207668_10280298 3300025972 Bacteria 1366
173 Ga0207640_10072645 3300025981 Bacteria 2322
174 Ga0207658_10364229 3300025986 Bacteria 1262
175 Ga0207677_10071187 3300026023 Bacteria 2453
176 Ga0207703_10027603 3300026035 Bacteria 4470
177 Ga0207639_10042338 3300026041 Bacteria 3412
178 Ga0207639_10145880 3300026041 Bacteria 1977
179 Ga0207639_10223410 3300026041 Bacteria 1628
180 Ga0207678_10008446 3300026067 Bacteria 9083
181 Ga0207678_10040941 3300026067 Bacteria 4017
182 Ga0207678_10079088 3300026067 Bacteria 2816
183 Ga0207702_10015921 3300026078 Bacteria 6227
184 Ga0207641_10402499 3300026088 Bacteria 1314
185 Ga0207648_10132038 3300026089 Bacteria 2198
186 Ga0207674_10027243 3300026116 Bacteria 6050
187 Ga0207675_100374653 3300026118 Bacteria 1399
188 Ga0207675_100411464 3300026118 Bacteria 1334
189 Ga0207683_10037487 3300026121 Bacteria 4221
190 Ga0207683_10059426 3300026121 Bacteria 3358
191 Ga0207683_10082205 3300026121 Bacteria 2861
192 Ga0207683_10236526 3300026121 Bacteria 1666
193 Ga0207698_10066624 3300026142 Bacteria 2835
194 Ga0209389_1000023 3300027296 Bacteria 150730
195 Ga0209589_1000010 3300027357 Bacteria 237657
196 Ga0209489_100011 3300027361 Bacteria 244710
197 Ga0268266_10264387 3300028379 Bacteria 1595
198 Ga0268264_10000093 3300028381 Bacteria 232057
199 Ga0268264_10213648 3300028381 Bacteria 1772
200 Ga0265334_10011851 3300028573 Bacteria 3663
201 Ga0307517_10000085 3300028786 Bacteria 131200
202 Ga0307517_10150514 3300028786 Bacteria 1598
203 Ga0307515_10078972 3300028794 Bacteria 4318
204 Ga0307515_10242706 3300028794 Bacteria 1569
205 Ga0265330_10057589 3300031235 Bacteria 1695
206 Ga0265325_10049180 3300031241 Bacteria 2177
207 Ga0265340_10034255 3300031247 Bacteria 2526
208 Ga0265339_10042644 3300031249 Bacteria 2512
209 Ga0265331_10021773 3300031250 Bacteria 3276
210 Ga0307508_10049820 3300031616 Bacteria 3730
211 Ga0307508_10178732 3300031616 Bacteria 1725
212 Ga0265314_10148520 3300031711 Bacteria 1440
213 Ga0307516_10008463 3300031730 Bacteria 11640
214 Ga0307516_10195070 3300031730 Bacteria 1748
215 Ga0307516_10202264 3300031730 Bacteria 1705
216 Ga0307516_10309168 3300031730 Bacteria 1254
217 Ga0307410_10204207 3300031852 Bacteria 1511
218 Ga0307416_100217458 3300032002 Bacteria 1829
219 Ga0307415_100170540 3300032126 Bacteria 1696
220 Ga0307507_10147401 3300033179 Bacteria 1783
221 Ga0307510_10203875 3300033180 Bacteria 1509
222 Ga0315911_1000010 3300033442 Bacteria 322197
223 Ga0316215_1000538 3300033544 Bacteria 4160
224 Ga0373950_0014045 3300034818 Bacteria 1344
225 Ga0373928_0006063 3300035084 Bacteria 2318
226 Ga0373929_0016120 3300035085 Bacteria 1461
227 Ga0373934_0004243 3300035086 Bacteria 5288
228 Ga0373951_0045853 3300035091 Bacteria 1065
229 Ga0373923_0018561 3300035111 Bacteria 2679
230 Ga0373932_0004494 3300035112 Bacteria 3295
231 Ga0373936_0023057 3300035113 Bacteria 2424
232 Ga0373945_0108722 3300035116 Bacteria 1092
233 Ga0373953_0003844 3300035117 Bacteria 4728
234 Ga0373954_0003555 3300035118 Bacteria 6623
235 Ga0373957_0001601 3300035120 Bacteria 6192
236 Ga0373943_0002133 3300035170 Bacteria 8990
237 Ga0373946_0016813 3300035171 Bacteria 2792
238 Ga0373931_0011398 3300035691 Bacteria 4295
239 Ga0373935_0000259 3300035692 Bacteria 26229
240 Ga0373935_0031447 3300035692 Bacteria 3294
241 Ga0373927_0002522 3300035695 Bacteria 13350
242 Ga0373927_0007423 3300035695 Bacteria 7422
243 Ga0373927_0038511 3300035695 Bacteria 3104
244 Ga0373927_0089561 3300035695 Bacteria 1998
245 Ga0373927_0182849 3300035695 Bacteria 1375
246 Ga0373933_0008746 3300035724 Bacteria 5520
247 Ga0373947_0000217 3300035725 Bacteria 32254
248 Ga0373947_0013560 3300035725 Bacteria 4670
249 Ga0373937_0014756 3300036401 Bacteria 6898
250 Ga0373937_0027287 3300036401 Bacteria 5164
251 Ga0372808_000294 3300036459 Bacteria 3496
252 Ga0373925_0003792 3300037068 Bacteria 11621
253 Ga0373925_0012744 3300037068 Bacteria 6092
254 Ga0373925_0226616 3300037068 Bacteria 1493
255 Ga0395900_0067826 3300037418 Bacteria 3665
256 Ga0395898_0137402 3300037466 Bacteria 2340
257 Ga0395901_0248873 3300038443 Bacteria 1852
258 Ga0436365_1200085 3300039437 Bacteria 5790
259 Ga0466972_0000520 3300044658 Bacteria 19029
260 Ga0466965_0140965 3300044683 Bacteria 1255
261 Ga0466966_0005474 3300044684 Bacteria 8351
262 Ga0466961_0000081 3300044693 Bacteria 59450
263 Ga0466963_0006536 3300044694 Bacteria 6904
264 Ga0466963_0104587 3300044694 Bacteria 1940
265 Ga0466959_0007840 3300045049 Bacteria 7516
266 Ga0466959_0088585 3300045049 Bacteria 2225
267 Ga0495592_0004003 3300046454 Bacteria 10691
268 Ga0495592_0010878 3300046454 Bacteria 6865
269 Ga0495603_0000352 3300046455 Bacteria 24722
270 Ga0495603_0009224 3300046455 Bacteria 5963
271 Ga0495629_0000341 3300046459 Bacteria 39851
272 Ga0495629_0090105 3300046459 Bacteria 2140
273 Ga0495638_0148152 3300046460 Bacteria 1363
274 Ga0495653_0003343 3300046463 Bacteria 12890
275 Ga0495580_0003184 3300046472 Bacteria 14061
276 Ga0495582_0000245 3300046473 Bacteria 30263
277 Ga0495639_0000275 3300046475 Bacteria 25388
278 Ga0495639_0038018 3300046475 Bacteria 2160
279 Ga0495662_0001790 3300046476 Bacteria 10755
280 Ga0495664_0017791 3300046477 Bacteria 4064
281 Ga0495584_0099900 3300046491 Bacteria 1466
282 Ga0495594_0001300 3300046499 Bacteria 13017
283 Ga0495607_0039517 3300046501 Bacteria 2817
284 Ga0495610_0044994 3300046512 Bacteria 2187
285 Ga0495610_0096503 3300046512 Bacteria 1331
286 Ga0495620_0037158 3300046515 Bacteria 2172
287 Ga0495628_0012504 3300046516 Bacteria 7154
288 Ga0495628_0039880 3300046516 Bacteria 3755
289 Ga0495630_0003021 3300046517 Bacteria 11666
290 Ga0495631_0015793 3300046518 Bacteria 3611
291 Ga0495648_0001680 3300046524 Bacteria 21407
292 Ga0495648_0003398 3300046524 Bacteria 13990
293 Ga0495648_0104146 3300046524 Bacteria 1559
294 Ga0495652_0077136 3300046529 Bacteria 2763
295 Ga0495665_0000042 3300046531 Bacteria 49467
296 Ga0495640_0011597 3300046533 Bacteria 6773
297 Ga0495598_0004661 3300046537 Bacteria 2984
298 Ga0495609_0024409 3300046538 Bacteria 2774
299 Ga0495621_0030236 3300046539 Bacteria 1850
300 Ga0495645_0001286 3300046543 Bacteria 17104
301 Ga0495622_0001455 3300046557 Bacteria 11926
302 Ga0495622_0002944 3300046557 Bacteria 8113
303 Ga0495622_0041288 3300046557 Bacteria 2145
304 Ga0495667_0003108 3300046559 Bacteria 11138
305 Ga0495656_0028293 3300046615 Bacteria 2247
306 Ga0495656_0039458 3300046615 Bacteria 1961
307 Ga0495668_0072209 3300046616 Bacteria 1896
308 Ga0495668_0115168 3300046616 Bacteria 1470
309 Ga0495668_0147802 3300046616 Bacteria 1287
310 Ga0495634_0000249 3300046642 Bacteria 50835
311 Ga0495634_0009610 3300046642 Bacteria 7125
312 Ga0495625_0024104 3300046660 Bacteria 4637
313 Ga0495635_0000239 3300046663 Bacteria 34889
314 Ga0495661_0024354 3300046665 Bacteria 3918
315 Ga0495588_0003608 3300046674 Bacteria 6764
316 Ga0495588_0044419 3300046674 Bacteria 2276
317 Ga0495599_0001118 3300046678 Bacteria 15101
318 Ga0495646_0008784 3300046680 Bacteria 6417
319 Ga0495646_0015009 3300046680 Bacteria 4919
320 Ga0495647_0000418 3300046681 Bacteria 12174
321 Ga0495658_0001216 3300046683 Bacteria 13515
322 Ga0495669_0043583 3300046684 Bacteria 1998
323 Ga0495669_0148817 3300046684 Bacteria 1108
324 Ga0495613_0000929 3300046689 Bacteria 22466
325 Ga0495613_0039302 3300046689 Bacteria 3508
326 Ga0495624_0000538 3300046690 Bacteria 29656
327 Ga0495671_0094728 3300046692 Bacteria 1461
328 Ga0495589_0112921 3300046794 Bacteria 1311
329 Ga0495600_0014818 3300046809 Bacteria 4917
330 Ga0495581_0033829 3300047315 Bacteria 2959
331 Ga0495604_0006592 3300047317 Bacteria 9201
332 Ga0495604_0151234 3300047317 Bacteria 1649
333 Ga0495674_0054370 3300047319 Bacteria 3516
334 Ga0495672_0026159 3300047320 Bacteria 3725
335 Ga0495672_0065065 3300047320 Bacteria 2085
336 Ga0495676_0103244 3300047321 Bacteria 2105
337 Ga0495676_0270084 3300047321 Bacteria 1154
338 Ga0495677_0009831 3300047445 Bacteria 3525
339 Ga0495673_0057087 3300047469 Bacteria 1686
340 Ga0495684_0004414 3300047471 Bacteria 11000
341 Ga0495686_0024862 3300047472 Bacteria 3930
342 Ga0495686_0040115 3300047472 Bacteria 2988
343 Ga0495686_0041306 3300047472 Bacteria 2937
344 Ga0495686_0092659 3300047472 Bacteria 1832
345 Ga0495593_0000034 3300047673 Bacteria 57993
346 Ga0495593_0004126 3300047673 Bacteria 8642
347 Ga0495602_0055208 3300048088 Bacteria 3499
348 Ga0495614_0002600 3300048089 Bacteria 8028
349 Ga0496100_0008416 3300048903 Bacteria 5753
350 Ga0496100_0092199 3300048903 Bacteria 2070
351 Ga0496100_0250415 3300048903 Bacteria 1310
352 Ga0496101_0086414 3300048904 Bacteria 2326
353 Ga0496101_0189061 3300048904 Bacteria 1588
354 Ga0496101_0247222 3300048904 Bacteria 1389
355 Ga0496101_0293108 3300048904 Bacteria 1273
356 Ga0496102_0025975 3300048905 Bacteria 5219
357 Ga0496102_0039294 3300048905 Bacteria 4275
358 Ga0496104_0281394 3300048907 Bacteria 1576
359 Ga0496105_0013770 3300048908 Bacteria 6422
360 Ga0496106_0000649 3300048909 Bacteria 24884
361 Ga0496106_0076272 3300048909 Bacteria 2569
362 Ga0496106_0099691 3300048909 Bacteria 2252
363 Ga0496107_0016695 3300048910 Bacteria 5160
364 Ga0496109_0006785 3300048912 Bacteria 9645
365 Ga0496109_0032069 3300048912 Bacteria 4720
366 Ga0496109_0304386 3300048912 Bacteria 1503
367 Ga0496110_0008221 3300048913 Bacteria 8385
368 Ga0496110_0021224 3300048913 Bacteria 5494
369 Ga0496110_0367228 3300048913 Bacteria 1311
370 Ga0496111_0161891 3300048914 Bacteria 1662
371 Ga0496111_0208400 3300048914 Bacteria 1452
372 Ga0496112_0000037 3300048915 Bacteria 96876
373 Ga0496112_0003961 3300048915 Bacteria 12409
374 Ga0496112_0021901 3300048915 Bacteria 6082
375 Ga0496112_0102784 3300048915 Bacteria 2827
376 Ga0496112_0165641 3300048915 Bacteria 2176
377 Ga0496112_0288946 3300048915 Bacteria 1586
378 Ga0496113_0159050 3300048916 Bacteria 1785
379 Ga0496114_0157357 3300048917 Bacteria 1973
380 Ga0496115_0007240 3300048918 Bacteria 8156
381 Ga0496115_0021816 3300048918 Bacteria 4951
382 Ga0496115_0032633 3300048918 Bacteria 4108
383 Ga0496115_0054375 3300048918 Bacteria 3215
384 Ga0496115_0124303 3300048918 Bacteria 2124
385 Ga0496115_0275365 3300048918 Bacteria 1382
386 Ga0496116_0026092 3300048919 Bacteria 4280
387 Ga0496116_0116602 3300048919 Bacteria 1556
388 Ga0496117_0006544 3300048920 Bacteria 11729
389 Ga0496117_0013445 3300048920 Bacteria 7141
390 Ga0496117_0075581 3300048920 Bacteria 2237
391 Ga0496117_0102629 3300048920 Bacteria 1804
392 Ga0496118_0003970 3300048921 Bacteria 18053
393 Ga0496118_0060107 3300048921 Bacteria 2824
394 Ga0496118_0076246 3300048921 Bacteria 2385
395 Ga0496119_0029785 3300048922 Bacteria 3692
396 Ga0496120_0026718 3300048923 Bacteria 3561
397 Ga0496121_0000476 3300048924 Bacteria 78015
398 Ga0496121_0001742 3300048924 Bacteria 35564
399 Ga0496121_0003089 3300048924 Bacteria 24095
400 Ga0496121_0007886 3300048924 Bacteria 12739
401 Ga0496121_0066441 3300048924 Bacteria 2928
402 Ga0496121_0073520 3300048924 Bacteria 2739
403 Ga0496121_0074570 3300048924 Bacteria 2713
404 Ga0496121_0157710 3300048924 Bacteria 1663
405 Ga0496122_0060286 3300048925 Bacteria 2795
406 Ga0496123_0077422 3300048926 Bacteria 2042
407 Ga0496123_0117547 3300048926 Bacteria 1503
408 Ga0496124_0001128 3300048927 Bacteria 42017
409 Ga0496124_0043677 3300048927 Bacteria 3852
410 Ga0496124_0214415 3300048927 Bacteria 1454
411 Ga0496125_0000154 3300048928 Bacteria 152240
412 Ga0496125_0001251 3300048928 Bacteria 37908
413 Ga0496125_0012395 3300048928 Bacteria 8467
414 Ga0496125_0044517 3300048928 Bacteria 3752
415 Ga0496126_0002744 3300048929 Bacteria 23267
416 Ga0496126_0005646 3300048929 Bacteria 14209
417 Ga0496126_0005790 3300048929 Bacteria 13970
418 Ga0496126_0019810 3300048929 Bacteria 6617
419 Ga0496126_0073181 3300048929 Bacteria 3047
420 Ga0496126_0136588 3300048929 Bacteria 2114
421 Ga0496126_0175809 3300048929 Bacteria 1821
422 Ga0496126_0215657 3300048929 Bacteria 1614
423 Ga0496126_0271145 3300048929 Bacteria 1408
424 Ga0501031_0011177 3300049568 Bacteria 5850
425 Ga0501032_0003299 3300049569 Bacteria 12409
426 Ga0501033_0000124 3300049570 Bacteria 74731
427 Ga0501033_0037338 3300049570 Bacteria 3637
428 Ga0501036_0001379 3300049572 Bacteria 18654
429 Ga0501036_0057426 3300049572 Bacteria 3297
430 Ga0501037_0037968 3300049573 Bacteria 3550
431 Ga0501038_0000041 3300049574 Bacteria 120557
432 Ga0501038_0036322 3300049574 Bacteria 4325
433 Ga0501039_0000472 3300049575 Bacteria 29218
434 Ga0501039_0118576 3300049575 Bacteria 2073
435 Ga0501043_0022762 3300049579 Bacteria 4913
436 Ga0501047_0016600 3300049581 Bacteria 7028
437 Ga0501047_0023633 3300049581 Bacteria 5900
438 Ga0501067_0077869 3300049583 Bacteria 1837
439 Ga0501068_0021594 3300049584 Bacteria 3760
440 Ga0501069_0014051 3300049585 Bacteria 4277
441 Ga0501070_0004644 3300049586 Bacteria 11766
442 Ga0501070_0034844 3300049586 Bacteria 4207
443 Ga0501073_0028939 3300049589 Bacteria 3958
444 Ga0501080_0000638 3300049742 Bacteria 27778
445 Ga0501035_0002235 3300049822 Bacteria 19183
446 Ga0501035_0049374 3300049822 Bacteria 3771
447 Ga0501044_0071456 3300049823 Bacteria 3529
448 Ga0501045_0029715 3300049824 Bacteria 3952
449 nmdc:mga00v17_28583_c1 3300050491 Bacteria 3266
450 nmdc:mga00v17_94891_c1 3300050491 Bacteria 1877
451 nmdc:mga0yw44_19552_c1 3300050492 Bacteria 3738
452 nmdc:mga0yw44_31585_c1 3300050492 Bacteria 3081
453 nmdc:mga05p37_348275_c1 3300050507 Bacteria 1745
454 nmdc:mga08y16_158068_c1 3300050511 Bacteria 2355
455 nmdc:mga08y16_229255_c1 3300050511 Bacteria 1921
456 nmdc:mga0n895_53072_c1 3300050512 Bacteria 3981
457 nmdc:mga0a205_244607_c1 3300050515 Bacteria 1674
458 nmdc:mga0sz30_5341_c1 3300050516 Bacteria 4706
459 Ga0495601_0022259 3300053077 Bacteria 3890
460 Ga0495601_0113424 3300053077 Bacteria 1757
461 Ga0500635_0004467 3300053080 Bacteria 3609
462 Ga0495595_0004386 3300053084 Bacteria 5679
463 Ga0495595_0006944 3300053084 Bacteria 4623
464 Ga0495619_0004209 3300053085 Bacteria 9182
465 Ga0495619_0041813 3300053085 Bacteria 2999
466 Ga0500643_028088 3300053087 Bacteria 1742
467 Ga0500651_0000861 3300053093 Bacteria 14855
468 Ga0500651_0039325 3300053093 Bacteria 2978
469 Ga0500651_0183221 3300053093 Bacteria 1243
470 Ga0500566_0000157 3300053094 Bacteria 34534
471 Ga0500566_0016976 3300053094 Bacteria 4275
472 Ga0500566_0093266 3300053094 Bacteria 1661
473 Ga0500641_0006830 3300053096 Bacteria 4059
474 Ga0500641_0108380 3300053096 Bacteria 1194
475 Ga0500554_000813 3300053102 Bacteria 6155
476 Ga0500556_0000413 3300053104 Bacteria 31142
477 Ga0500557_000041 3300053105 Bacteria 64885
478 Ga0500592_001374 3300053116 Bacteria 3938
479 Ga0500595_000331 3300053119 Bacteria 31133
480 Ga0500595_001464 3300053119 Bacteria 12587
481 Ga0500595_005225 3300053119 Bacteria 5688
482 Ga0500595_011823 3300053119 Bacteria 3399
483 Ga0500642_0000005 3300053130 Bacteria 422725
484 Ga0500642_0025239 3300053130 Bacteria 2412
485 Ga0500655_011033 3300053133 Bacteria 1635
486 Ga0500658_0071925 3300053134 Bacteria 1461
487 Ga0500658_0092536 3300053134 Bacteria 1309
488 Ga0500559_0002794 3300053136 Bacteria 8831
489 Ga0500559_0030986 3300053136 Bacteria 2294
490 Ga0500568_0002149 3300053139 Bacteria 11891
491 Ga0500568_0014348 3300053139 Bacteria 3581
492 Ga0500568_0097246 3300053139 Bacteria 1107
493 Ga0500573_0002307 3300053140 Bacteria 9486
494 Ga0500586_004415 3300053145 Bacteria 3439
495 Ga0500588_0010416 3300053146 Bacteria 2244
496 Ga0500590_030324 3300053148 Bacteria 2806
497 Ga0500603_001303 3300053150 Bacteria 5725
498 Ga0500603_048710 3300053150 Bacteria 1153
499 Ga0500604_0001450 3300053151 Bacteria 6633
500 Ga0500604_0044019 3300053151 Bacteria 1358
501 Ga0500616_0000180 3300053153 Bacteria 106053
502 Ga0500622_0022981 3300053156 Bacteria 3302
503 Ga0500627_0117127 3300053158 Bacteria 1200
504 Ga0500634_0120028 3300053161 Bacteria 1281
505 Ga0500638_000259 3300053162 Bacteria 11614
506 Ga0500638_065247 3300053162 Bacteria 1746
507 Ga0500636_0002272 3300053177 Bacteria 10660
508 Ga0500637_0001727 3300053178 Bacteria 9419
509 Ga0500637_0011620 3300053178 Bacteria 4559
510 Ga0500645_011768 3300053730 Bacteria 2845
511 Ga0500601_002924 3300053737 Bacteria 1844
512 Ga0466962_0061795 3300061719 Bacteria 1788
513 Ga0466962_0077129 3300061719 Bacteria 1593

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006931 Ga0097620_100442187 Ga0097620_1004421872 313
2 3300047472 Ga0495686_0040115 Ga0495686_0040115_94_1089 316
3 3300048918 Ga0496115_0021816 Ga0496115_0021816_50_1018 320
4 3300046684 Ga0495669_0148817 Ga0495669_0148817_37_1002 321
5 3300025261 Ga0209233_1017502 Ga0209233_10175021 322
6 3300005336 Ga0070680_100078039 Ga0070680_1000780393 324
7 3300005366 Ga0070659_100025076 Ga0070659_1000250762 324
8 3300005435 Ga0070714_100252782 Ga0070714_1002527822 324
9 3300005563 Ga0068855_100152079 Ga0068855_1001520793 324
10 3300005614 Ga0068856_100018359 Ga0068856_1000183593 324
11 3300005616 Ga0068852_100005171 Ga0068852_1000051717 324
12 3300013307 Ga0157372_10372253 Ga0157372_103722532 324
13 3300025917 Ga0207660_10082761 Ga0207660_100827613 324
14 3300025929 Ga0207664_10213631 Ga0207664_102136313 324
15 3300025932 Ga0207690_10211414 Ga0207690_102114142 324
16 3300025949 Ga0207667_10040971 Ga0207667_100409714 324
17 3300025981 Ga0207640_10072645 Ga0207640_100726453 324
18 3300026078 Ga0207702_10015921 Ga0207702_100159213 324
19 3300048915 Ga0496112_0288946 Ga0496112_0288946_420_1415 324
20 iso_pu_bacteria 2515154112 2515625428 325
21 iso_pu_bacteria 2841941048 2841943198 325
22 iso_pu_bacteria 2841974524 2841976629 325
23 iso_pu_bacteria 2885409591 2885413423 325
24 iso_pu_bacteria 2935959822 2935962036 325
25 iso_pu_bacteria 3005506211 3005507116 325
26 3300021388 Ga0213875_10004231 Ga0213875_100042314 326
27 3300061719 Ga0466962_0061795 Ga0466962_0061795_215_1195 326
28 iso_pu_bacteria 2513237098 2513677804 326
29 iso_pu_bacteria 2524023210 2524464083 326
30 iso_pu_bacteria 2885383462 2885384498 326
31 iso_pu_bacteria 2903768456 2903773634 326
32 iso_pu_bacteria 8056681323 8056682374 326
33 3300006942 Ga0099824_1010925 Ga0099824_10109254 327
34 3300027296 Ga0209389_1000023 Ga0209389_10000232 327
35 3300027357 Ga0209589_1000010 Ga0209589_1000010157 327
36 3300027361 Ga0209489_100011 Ga0209489_10001179 327
37 3300034818 Ga0373950_0014045 Ga0373950_0014045_331_1320 327
38 3300044658 Ga0466972_0000520 Ga0466972_0000520_16567_17556 327
39 3300044683 Ga0466965_0140965 Ga0466965_0140965_108_1097 327
40 3300044684 Ga0466966_0005474 Ga0466966_0005474_5424_6413 327
41 3300044693 Ga0466961_0000081 Ga0466961_0000081_50093_51082 327
42 3300044694 Ga0466963_0006536 Ga0466963_0006536_1017_2006 327
43 3300045049 Ga0466959_0007840 Ga0466959_0007840_5416_6405 327
44 3300047472 Ga0495686_0092659 Ga0495686_0092659_186_1175 327
45 3300048904 Ga0496101_0247222 Ga0496101_0247222_306_1295 327
46 3300053105 Ga0500557_000041 Ga0500557_000041_29759_30748 327
47 iso_pu_bacteria 2513237096 2513655034 327
48 iso_pu_bacteria 2513237101 2513697443 327
49 iso_pu_bacteria 2513237137 2513861050 327
50 iso_pu_bacteria 2513237145 2513915943 327
51 iso_pu_bacteria 2517572143 2517894752 327
52 iso_pu_bacteria 2602042107 2603862607 327
53 iso_pu_bacteria 2667528175 2671119166 327
54 iso_pu_bacteria 2721755755 2723843064 327
55 iso_pu_bacteria 2791355197 2793071227 327
56 iso_pu_bacteria 2791355199 2793079527 327
57 iso_pu_bacteria 2857524615 2857529952 327
58 iso_pu_bacteria 2874604998 2874612604 327
59 iso_pu_bacteria 2876808645 2876812881 327
60 iso_pu_bacteria 2879110137 2879118043 327
61 iso_pu_bacteria 2885374607 2885378774 327
62 iso_pu_bacteria 2889033259 2889033634 327
63 iso_pu_bacteria 2893066018 2893069404 327
64 iso_pu_bacteria 2903748898 2903751434 327
65 iso_pu_bacteria 2904690495 2904697735 327
66 iso_pu_bacteria 2904699407 2904705885 327
67 iso_pu_bacteria 2906610324 2906611472 327
68 iso_pu_bacteria 2906635258 2906641691 327
69 iso_pu_bacteria 2906660503 2906660793 327
70 iso_pu_bacteria 2908739725 2908745064 327
71 iso_pu_bacteria 2908756301 2908757168 327
72 iso_pu_bacteria 2919073203 2919077194 327
73 iso_pu_bacteria 2922361189 2922367000 327
74 iso_pu_bacteria 2922386360 2922390217 327
75 iso_pu_bacteria 2922425934 2922427885 327
76 iso_pu_bacteria 2935630451 2935632187 327
77 iso_pu_bacteria 2941507105 2941508135 327
78 iso_pu_bacteria 2941515067 2941515360 327
79 iso_pu_bacteria 2941523033 2941524065 327
80 iso_pu_bacteria 3005474847 3005477595 327
81 iso_pu_bacteria 8006933436 8006933624 327
82 iso_pu_bacteria 8006964411 8006966536 327
83 iso_pu_bacteria 8006984368 8006989365 327
84 iso_pu_bacteria 8006994254 8006997848 327
85 iso_pu_bacteria 8019555841 8019559567 327
86 iso_pu_bacteria 8019565922 8019569667 327
87 iso_pu_bacteria 8056673599 8056674882 327
88 3300005535 Ga0070684_100175605 Ga0070684_1001756053 328
89 3300009093 Ga0105240_10212051 Ga0105240_102120513 328
90 3300020082 Ga0206353_10526543 Ga0206353_105265431 328
91 3300025913 Ga0207695_10045639 Ga0207695_100456394 328
92 3300025928 Ga0207700_10052318 Ga0207700_100523183 328
93 3300025949 Ga0207667_10443534 Ga0207667_104435341 328
94 3300035725 Ga0373947_0013560 Ga0373947_0013560_1911_2903 328
95 3300037068 Ga0373925_0226616 Ga0373925_0226616_215_1207 328
96 3300037418 Ga0395900_0067826 Ga0395900_0067826_2341_3333 328
97 3300039437 Ga0436365_1200085 Ga0436365_1200085_518_1510 328
98 3300048929 Ga0496126_0002744 Ga0496126_0002744_6946_8124 328
99 3300048929 Ga0496126_0271145 Ga0496126_0271145_355_1347 328
100 3300049570 Ga0501033_0037338 Ga0501033_0037338_2240_3232 328
101 3300049574 Ga0501038_0036322 Ga0501038_0036322_120_1112 328
102 3300049575 Ga0501039_0118576 Ga0501039_0118576_956_1948 328
103 3300049581 Ga0501047_0023633 Ga0501047_0023633_3747_4739 328
104 3300049586 Ga0501070_0034844 Ga0501070_0034844_2099_3091 328
105 3300049822 Ga0501035_0049374 Ga0501035_0049374_2048_3040 328
106 3300049823 Ga0501044_0071456 Ga0501044_0071456_594_1586 328
107 3300053119 Ga0500595_005225 Ga0500595_005225_4100_5092 328
108 3300061719 Ga0466962_0077129 Ga0466962_0077129_191_1183 328
109 3300003659 JGI25404J52841_10003909 JGI25404J52841_100039091 329
110 3300003659 JGI25404J52841_10008965 JGI25404J52841_100089653 329
111 3300003659 JGI25404J52841_10018149 JGI25404J52841_100181492 329
112 3300005262 Ga0065165_1044756 Ga0065165_10447561 329
113 3300005334 Ga0068869_100265783 Ga0068869_1002657831 329
114 3300005336 Ga0070680_100048472 Ga0070680_1000484722 329
115 3300005339 Ga0070660_100006941 Ga0070660_1000069414 329
116 3300005356 Ga0070674_100051862 Ga0070674_1000518622 329
117 3300005367 Ga0070667_100113013 Ga0070667_1001130132 329
118 3300005436 Ga0070713_100000737 Ga0070713_1000007373 329
119 3300005455 Ga0070663_100071388 Ga0070663_1000713883 329
120 3300005455 Ga0070663_100139075 Ga0070663_1001390752 329
121 3300005455 Ga0070663_100181878 Ga0070663_1001818782 329
122 3300005455 Ga0070663_100228324 Ga0070663_1002283242 329
123 3300005455 Ga0070663_100324018 Ga0070663_1003240182 329
124 3300005456 Ga0070678_100033005 Ga0070678_1000330052 329
125 3300005456 Ga0070678_100041257 Ga0070678_1000412573 329
126 3300005456 Ga0070678_100165609 Ga0070678_1001656093 329
127 3300005458 Ga0070681_10277291 Ga0070681_102772912 329
128 3300005459 Ga0068867_100046272 Ga0068867_1000462723 329
129 3300005468 Ga0070707_100083285 Ga0070707_1000832852 329
130 3300005535 Ga0070684_100078477 Ga0070684_1000784773 329
131 3300005536 Ga0070697_100012461 Ga0070697_1000124614 329
132 3300005539 Ga0068853_100025677 Ga0068853_1000256772 329
133 3300005539 Ga0068853_100035442 Ga0068853_1000354424 329
134 3300005539 Ga0068853_100097075 Ga0068853_1000970753 329
135 3300005539 Ga0068853_100135051 Ga0068853_1001350511 329
136 3300005548 Ga0070665_100035286 Ga0070665_1000352864 329
137 3300005563 Ga0068855_100110586 Ga0068855_1001105862 329
138 3300005564 Ga0070664_100122015 Ga0070664_1001220153 329
139 3300005577 Ga0068857_100018285 Ga0068857_1000182854 329
140 3300005616 Ga0068852_100251929 Ga0068852_1002519292 329
141 3300005618 Ga0068864_100067374 Ga0068864_1000673742 329
142 3300005718 Ga0068866_10029928 Ga0068866_100299283 329
143 3300005719 Ga0068861_100128785 Ga0068861_1001287852 329
144 3300005719 Ga0068861_100190649 Ga0068861_1001906492 329
145 3300005834 Ga0068851_10007403 Ga0068851_100074033 329
146 3300005842 Ga0068858_100079376 Ga0068858_1000793762 329
147 3300005843 Ga0068860_100138436 Ga0068860_1001384363 329
148 3300005844 Ga0068862_100348981 Ga0068862_1003489812 329
149 3300005844 Ga0068862_100434549 Ga0068862_1004345491 329
150 3300005937 Ga0081455_10004734 Ga0081455_1000473410 329
151 3300005937 Ga0081455_10007808 Ga0081455_100078082 329
152 3300005937 Ga0081455_10016954 Ga0081455_100169544 329
153 3300005983 Ga0081540_1002304 Ga0081540_10023045 329
154 3300005983 Ga0081540_1006170 Ga0081540_10061705 329
155 3300005983 Ga0081540_1006942 Ga0081540_10069424 329
156 3300005983 Ga0081540_1009315 Ga0081540_10093151 329
157 3300005983 Ga0081540_1010096 Ga0081540_10100966 329
158 3300005983 Ga0081540_1016124 Ga0081540_10161244 329
159 3300005983 Ga0081540_1054617 Ga0081540_10546173 329
160 3300005983 Ga0081540_1084573 Ga0081540_10845731 329
161 3300005985 Ga0081539_10017928 Ga0081539_100179283 329
162 3300006028 Ga0070717_10005839 Ga0070717_100058394 329
163 3300006028 Ga0070717_10009960 Ga0070717_100099603 329
164 3300006028 Ga0070717_10328014 Ga0070717_103280142 329
165 3300006038 Ga0075365_10045342 Ga0075365_100453421 329
166 3300006038 Ga0075365_10060689 Ga0075365_100606891 329
167 3300006042 Ga0075368_10005882 Ga0075368_100058823 329
168 3300006048 Ga0075363_100008428 Ga0075363_1000084284 329
169 3300006048 Ga0075363_100016844 Ga0075363_1000168441 329
170 3300006048 Ga0075363_100136544 Ga0075363_1001365442 329
171 3300006175 Ga0070712_100037139 Ga0070712_1000371393 329
172 3300006178 Ga0075367_10010997 Ga0075367_100109974 329
173 3300006178 Ga0075367_10027799 Ga0075367_100277992 329
174 3300006178 Ga0075367_10030229 Ga0075367_100302293 329
175 3300006186 Ga0075369_10011679 Ga0075369_100116792 329
176 3300006186 Ga0075369_10129618 Ga0075369_101296181 329
177 3300006195 Ga0075366_10023699 Ga0075366_100236993 329
178 3300006871 Ga0075434_100335438 Ga0075434_1003354381 329
179 3300006881 Ga0068865_100023996 Ga0068865_1000239962 329
180 3300007788 Ga0099795_10017149 Ga0099795_100171493 329
181 3300009093 Ga0105240_10083712 Ga0105240_100837123 329
182 3300009093 Ga0105240_10235415 Ga0105240_102354151 329
183 3300009094 Ga0111539_10050924 Ga0111539_100509245 329
184 3300009094 Ga0111539_10290469 Ga0111539_102904693 329
185 3300009098 Ga0105245_10025333 Ga0105245_100253335 329
186 3300009147 Ga0114129_10030205 Ga0114129_100302058 329
187 3300009148 Ga0105243_10155291 Ga0105243_101552912 329
188 3300009174 Ga0105241_10106747 Ga0105241_101067472 329
189 3300009176 Ga0105242_10135058 Ga0105242_101350581 329
190 3300009177 Ga0105248_10343959 Ga0105248_103439592 329
191 3300009545 Ga0105237_10008841 Ga0105237_100088417 329
192 3300009551 Ga0105238_10038174 Ga0105238_100381744 329
193 3300009553 Ga0105249_10245706 Ga0105249_102457062 329
194 3300010159 Ga0099796_10006685 Ga0099796_100066851 329
195 3300010375 Ga0105239_10044859 Ga0105239_100448594 329
196 3300010375 Ga0105239_10108687 Ga0105239_101086872 329
197 3300011119 Ga0105246_10187385 Ga0105246_101873852 329
198 3300013104 Ga0157370_10108080 Ga0157370_101080803 329
199 3300013105 Ga0157369_10037312 Ga0157369_100373122 329
200 3300013297 Ga0157378_10005423 Ga0157378_100054239 329
201 3300013306 Ga0163162_10039430 Ga0163162_100394303 329
202 3300013308 Ga0157375_10018137 Ga0157375_100181374 329
203 3300013308 Ga0157375_10196693 Ga0157375_101966933 329
204 3300014325 Ga0163163_10054256 Ga0163163_100542564 329
205 3300014325 Ga0163163_10179875 Ga0163163_101798751 329
206 3300014326 Ga0157380_10118180 Ga0157380_101181802 329
207 3300014326 Ga0157380_10344369 Ga0157380_103443691 329
208 3300014745 Ga0157377_10102099 Ga0157377_101020991 329
209 3300014968 Ga0157379_10228269 Ga0157379_102282692 329
210 3300014969 Ga0157376_10110706 Ga0157376_101107063 329
211 3300014969 Ga0157376_10157934 Ga0157376_101579341 329
212 3300020070 Ga0206356_10999127 Ga0206356_109991272 329
213 3300025295 Ga0209564_1000485 Ga0209564_100048536 329
214 3300025297 Ga0209758_1029463 Ga0209758_10294633 329
215 3300025904 Ga0207647_10116240 Ga0207647_101162402 329
216 3300025907 Ga0207645_10065282 Ga0207645_100652823 329
217 3300025908 Ga0207643_10037952 Ga0207643_100379522 329
218 3300025909 Ga0207705_10057717 Ga0207705_100577172 329
219 3300025909 Ga0207705_10199235 Ga0207705_101992352 329
220 3300025911 Ga0207654_10231413 Ga0207654_102314131 329
221 3300025912 Ga0207707_10009744 Ga0207707_100097444 329
222 3300025913 Ga0207695_10103117 Ga0207695_101031172 329
223 3300025913 Ga0207695_10153360 Ga0207695_101533601 329
224 3300025914 Ga0207671_10165007 Ga0207671_101650072 329
225 3300025915 Ga0207693_10100202 Ga0207693_101002023 329
226 3300025915 Ga0207693_10152779 Ga0207693_101527791 329
227 3300025916 Ga0207663_10003103 Ga0207663_100031035 329
228 3300025917 Ga0207660_10017276 Ga0207660_100172761 329
229 3300025919 Ga0207657_10002789 Ga0207657_1000278916 329
230 3300025919 Ga0207657_10009166 Ga0207657_100091664 329
231 3300025919 Ga0207657_10223669 Ga0207657_102236691 329
232 3300025920 Ga0207649_10129436 Ga0207649_101294362 329
233 3300025921 Ga0207652_10026914 Ga0207652_100269143 329
234 3300025921 Ga0207652_10128177 Ga0207652_101281773 329
235 3300025922 Ga0207646_10044477 Ga0207646_100444773 329
236 3300025928 Ga0207700_10001341 Ga0207700_1000134111 329
237 3300025929 Ga0207664_10135871 Ga0207664_101358711 329
238 3300025931 Ga0207644_10025924 Ga0207644_100259242 329
239 3300025931 Ga0207644_10271459 Ga0207644_102714591 329
240 3300025933 Ga0207706_10030770 Ga0207706_100307703 329
241 3300025933 Ga0207706_10059207 Ga0207706_100592073 329
242 3300025937 Ga0207669_10049859 Ga0207669_100498593 329
243 3300025938 Ga0207704_10068997 Ga0207704_100689972 329
244 3300025939 Ga0207665_10060864 Ga0207665_100608643 329
245 3300025939 Ga0207665_10123310 Ga0207665_101233102 329
246 3300025939 Ga0207665_10361916 Ga0207665_103619161 329
247 3300025940 Ga0207691_10024095 Ga0207691_100240953 329
248 3300025940 Ga0207691_10107175 Ga0207691_101071753 329
249 3300025941 Ga0207711_10092636 Ga0207711_100926363 329
250 3300025941 Ga0207711_10131926 Ga0207711_101319262 329
251 3300025942 Ga0207689_10036612 Ga0207689_100366123 329
252 3300025942 Ga0207689_10112445 Ga0207689_101124452 329
253 3300025942 Ga0207689_10157449 Ga0207689_101574492 329
254 3300025945 Ga0207679_10014830 Ga0207679_100148303 329
255 3300025949 Ga0207667_10205716 Ga0207667_102057161 329
256 3300025961 Ga0207712_10281521 Ga0207712_102815211 329
257 3300025972 Ga0207668_10090473 Ga0207668_100904733 329
258 3300025972 Ga0207668_10254754 Ga0207668_102547541 329
259 3300025972 Ga0207668_10280298 Ga0207668_102802982 329
260 3300025986 Ga0207658_10364229 Ga0207658_103642292 329
261 3300026023 Ga0207677_10071187 Ga0207677_100711872 329
262 3300026035 Ga0207703_10027603 Ga0207703_100276034 329
263 3300026041 Ga0207639_10042338 Ga0207639_100423383 329
264 3300026041 Ga0207639_10145880 Ga0207639_101458801 329
265 3300026041 Ga0207639_10223410 Ga0207639_102234102 329
266 3300026067 Ga0207678_10008446 Ga0207678_100084467 329
267 3300026067 Ga0207678_10040941 Ga0207678_100409413 329
268 3300026067 Ga0207678_10079088 Ga0207678_100790882 329
269 3300026088 Ga0207641_10402499 Ga0207641_104024991 329
270 3300026089 Ga0207648_10132038 Ga0207648_101320382 329
271 3300026116 Ga0207674_10027243 Ga0207674_100272434 329
272 3300026118 Ga0207675_100374653 Ga0207675_1003746532 329
273 3300026118 Ga0207675_100411464 Ga0207675_1004114641 329
274 3300026121 Ga0207683_10037487 Ga0207683_100374873 329
275 3300026121 Ga0207683_10059426 Ga0207683_100594263 329
276 3300026121 Ga0207683_10082205 Ga0207683_100822051 329
277 3300026121 Ga0207683_10236526 Ga0207683_102365261 329
278 3300026142 Ga0207698_10066624 Ga0207698_100666242 329
279 3300028379 Ga0268266_10264387 Ga0268266_102643872 329
280 3300028381 Ga0268264_10000093 Ga0268264_10000093126 329
281 3300028381 Ga0268264_10213648 Ga0268264_102136482 329
282 3300028573 Ga0265334_10011851 Ga0265334_100118513 329
283 3300028786 Ga0307517_10000085 Ga0307517_10000085123 329
284 3300028786 Ga0307517_10150514 Ga0307517_101505141 329
285 3300028794 Ga0307515_10078972 Ga0307515_100789723 329
286 3300028794 Ga0307515_10242706 Ga0307515_102427061 329
287 3300031235 Ga0265330_10057589 Ga0265330_100575893 329
288 3300031241 Ga0265325_10049180 Ga0265325_100491801 329
289 3300031247 Ga0265340_10034255 Ga0265340_100342552 329
290 3300031249 Ga0265339_10042644 Ga0265339_100426441 329
291 3300031250 Ga0265331_10021773 Ga0265331_100217733 329
292 3300031616 Ga0307508_10049820 Ga0307508_100498202 329
293 3300031616 Ga0307508_10178732 Ga0307508_101787321 329
294 3300031711 Ga0265314_10148520 Ga0265314_101485201 329
295 3300031730 Ga0307516_10008463 Ga0307516_100084639 329
296 3300031730 Ga0307516_10195070 Ga0307516_101950701 329
297 3300031730 Ga0307516_10202264 Ga0307516_102022641 329
298 3300031730 Ga0307516_10309168 Ga0307516_103091681 329
299 3300031852 Ga0307410_10204207 Ga0307410_102042072 329
300 3300032002 Ga0307416_100217458 Ga0307416_1002174582 329
301 3300032126 Ga0307415_100170540 Ga0307415_1001705402 329
302 3300033179 Ga0307507_10147401 Ga0307507_101474012 329
303 3300033180 Ga0307510_10203875 Ga0307510_102038752 329
304 3300033442 Ga0315911_1000010 Ga0315911_1000010155 329
305 3300033544 Ga0316215_1000538 Ga0316215_10005382 329
306 3300035084 Ga0373928_0006063 Ga0373928_0006063_936_1931 329
307 3300035085 Ga0373929_0016120 Ga0373929_0016120_115_1293 329
308 3300035086 Ga0373934_0004243 Ga0373934_0004243_118_1113 329
309 3300035091 Ga0373951_0045853 Ga0373951_0045853_34_1029 329
310 3300035111 Ga0373923_0018561 Ga0373923_0018561_1382_2377 329
311 3300035112 Ga0373932_0004494 Ga0373932_0004494_1370_2365 329
312 3300035113 Ga0373936_0023057 Ga0373936_0023057_501_1496 329
313 3300035116 Ga0373945_0108722 Ga0373945_0108722_28_1023 329
314 3300035117 Ga0373953_0003844 Ga0373953_0003844_2327_3322 329
315 3300035118 Ga0373954_0003555 Ga0373954_0003555_3569_4564 329
316 3300035120 Ga0373957_0001601 Ga0373957_0001601_4050_5045 329
317 3300035170 Ga0373943_0002133 Ga0373943_0002133_3632_4627 329
318 3300035171 Ga0373946_0016813 Ga0373946_0016813_1472_2467 329
319 3300035691 Ga0373931_0011398 Ga0373931_0011398_1175_2170 329
320 3300035692 Ga0373935_0000259 Ga0373935_0000259_3680_4675 329
321 3300035692 Ga0373935_0031447 Ga0373935_0031447_293_1291 329
322 3300035695 Ga0373927_0002522 Ga0373927_0002522_10514_11509 329
323 3300035695 Ga0373927_0007423 Ga0373927_0007423_4273_5271 329
324 3300035695 Ga0373927_0038511 Ga0373927_0038511_930_1925 329
325 3300035695 Ga0373927_0089561 Ga0373927_0089561_821_1816 329
326 3300035695 Ga0373927_0182849 Ga0373927_0182849_84_1262 329
327 3300035724 Ga0373933_0008746 Ga0373933_0008746_843_1838 329
328 3300035725 Ga0373947_0000217 Ga0373947_0000217_1646_2641 329
329 3300036401 Ga0373937_0014756 Ga0373937_0014756_1146_2141 329
330 3300036401 Ga0373937_0027287 Ga0373937_0027287_832_1836 329
331 3300036459 Ga0372808_000294 Ga0372808_000294_2157_3164 329
332 3300037068 Ga0373925_0003792 Ga0373925_0003792_9882_10877 329
333 3300037068 Ga0373925_0012744 Ga0373925_0012744_1980_2978 329
334 3300037466 Ga0395898_0137402 Ga0395898_0137402_309_1304 329
335 3300038443 Ga0395901_0248873 Ga0395901_0248873_409_1404 329
336 3300044694 Ga0466963_0104587 Ga0466963_0104587_892_1887 329
337 3300045049 Ga0466959_0088585 Ga0466959_0088585_302_1297 329
338 3300046454 Ga0495592_0004003 Ga0495592_0004003_1815_2810 329
339 3300046454 Ga0495592_0010878 Ga0495592_0010878_4897_5892 329
340 3300046455 Ga0495603_0000352 Ga0495603_0000352_20308_21303 329
341 3300046455 Ga0495603_0009224 Ga0495603_0009224_4753_5748 329
342 3300046459 Ga0495629_0000341 Ga0495629_0000341_7769_8764 329
343 3300046459 Ga0495629_0090105 Ga0495629_0090105_198_1193 329
344 3300046460 Ga0495638_0148152 Ga0495638_0148152_283_1278 329
345 3300046463 Ga0495653_0003343 Ga0495653_0003343_8970_9965 329
346 3300046472 Ga0495580_0003184 Ga0495580_0003184_8576_9571 329
347 3300046473 Ga0495582_0000245 Ga0495582_0000245_15788_16783 329
348 3300046475 Ga0495639_0000275 Ga0495639_0000275_15916_16911 329
349 3300046475 Ga0495639_0038018 Ga0495639_0038018_593_1588 329
350 3300046476 Ga0495662_0001790 Ga0495662_0001790_4256_5251 329
351 3300046477 Ga0495664_0017791 Ga0495664_0017791_2108_3103 329
352 3300046491 Ga0495584_0099900 Ga0495584_0099900_158_1153 329
353 3300046499 Ga0495594_0001300 Ga0495594_0001300_604_1599 329
354 3300046501 Ga0495607_0039517 Ga0495607_0039517_457_1452 329
355 3300046512 Ga0495610_0044994 Ga0495610_0044994_360_1355 329
356 3300046512 Ga0495610_0096503 Ga0495610_0096503_25_1020 329
357 3300046515 Ga0495620_0037158 Ga0495620_0037158_976_1971 329
358 3300046516 Ga0495628_0012504 Ga0495628_0012504_2601_3596 329
359 3300046516 Ga0495628_0039880 Ga0495628_0039880_1310_2305 329
360 3300046517 Ga0495630_0003021 Ga0495630_0003021_1807_2802 329
361 3300046518 Ga0495631_0015793 Ga0495631_0015793_58_1053 329
362 3300046524 Ga0495648_0001680 Ga0495648_0001680_585_1580 329
363 3300046524 Ga0495648_0003398 Ga0495648_0003398_4502_5497 329
364 3300046524 Ga0495648_0104146 Ga0495648_0104146_106_1101 329
365 3300046529 Ga0495652_0077136 Ga0495652_0077136_418_1596 329
366 3300046531 Ga0495665_0000042 Ga0495665_0000042_42125_43120 329
367 3300046533 Ga0495640_0011597 Ga0495640_0011597_5316_6311 329
368 3300046537 Ga0495598_0004661 Ga0495598_0004661_1049_2044 329
369 3300046538 Ga0495609_0024409 Ga0495609_0024409_1601_2596 329
370 3300046539 Ga0495621_0030236 Ga0495621_0030236_525_1520 329
371 3300046543 Ga0495645_0001286 Ga0495645_0001286_10665_11660 329
372 3300046557 Ga0495622_0001455 Ga0495622_0001455_4748_5743 329
373 3300046557 Ga0495622_0002944 Ga0495622_0002944_953_1948 329
374 3300046557 Ga0495622_0041288 Ga0495622_0041288_734_1732 329
375 3300046559 Ga0495667_0003108 Ga0495667_0003108_7218_8213 329
376 3300046615 Ga0495656_0028293 Ga0495656_0028293_1008_2003 329
377 3300046615 Ga0495656_0039458 Ga0495656_0039458_445_1440 329
378 3300046616 Ga0495668_0072209 Ga0495668_0072209_702_1697 329
379 3300046616 Ga0495668_0115168 Ga0495668_0115168_148_1143 329
380 3300046616 Ga0495668_0147802 Ga0495668_0147802_17_1015 329
381 3300046642 Ga0495634_0000249 Ga0495634_0000249_19612_20607 329
382 3300046642 Ga0495634_0009610 Ga0495634_0009610_3556_4551 329
383 3300046660 Ga0495625_0024104 Ga0495625_0024104_3134_4129 329
384 3300046663 Ga0495635_0000239 Ga0495635_0000239_17271_18266 329
385 3300046665 Ga0495661_0024354 Ga0495661_0024354_1689_2684 329
386 3300046674 Ga0495588_0003608 Ga0495588_0003608_3818_4813 329
387 3300046674 Ga0495588_0044419 Ga0495588_0044419_370_1365 329
388 3300046678 Ga0495599_0001118 Ga0495599_0001118_8551_9546 329
389 3300046680 Ga0495646_0008784 Ga0495646_0008784_1640_2635 329
390 3300046680 Ga0495646_0015009 Ga0495646_0015009_3615_4610 329
391 3300046681 Ga0495647_0000418 Ga0495647_0000418_3469_4464 329
392 3300046683 Ga0495658_0001216 Ga0495658_0001216_1892_2887 329
393 3300046684 Ga0495669_0043583 Ga0495669_0043583_555_1550 329
394 3300046689 Ga0495613_0000929 Ga0495613_0000929_3142_4137 329
395 3300046689 Ga0495613_0039302 Ga0495613_0039302_1871_2866 329
396 3300046690 Ga0495624_0000538 Ga0495624_0000538_12166_13161 329
397 3300046692 Ga0495671_0094728 Ga0495671_0094728_309_1304 329
398 3300046794 Ga0495589_0112921 Ga0495589_0112921_32_1027 329
399 3300046809 Ga0495600_0014818 Ga0495600_0014818_2997_3992 329
400 3300047315 Ga0495581_0033829 Ga0495581_0033829_1179_2174 329
401 3300047317 Ga0495604_0006592 Ga0495604_0006592_6014_7009 329
402 3300047317 Ga0495604_0151234 Ga0495604_0151234_64_1059 329
403 3300047319 Ga0495674_0054370 Ga0495674_0054370_1884_2879 329
404 3300047320 Ga0495672_0026159 Ga0495672_0026159_1403_2398 329
405 3300047320 Ga0495672_0065065 Ga0495672_0065065_325_1503 329
406 3300047321 Ga0495676_0103244 Ga0495676_0103244_659_1654 329
407 3300047321 Ga0495676_0270084 Ga0495676_0270084_123_1118 329
408 3300047445 Ga0495677_0009831 Ga0495677_0009831_1850_2845 329
409 3300047469 Ga0495673_0057087 Ga0495673_0057087_87_1082 329
410 3300047471 Ga0495684_0004414 Ga0495684_0004414_6256_7251 329
411 3300047472 Ga0495686_0024862 Ga0495686_0024862_921_1916 329
412 3300047472 Ga0495686_0041306 Ga0495686_0041306_1775_2770 329
413 3300047673 Ga0495593_0000034 Ga0495593_0000034_38239_39234 329
414 3300047673 Ga0495593_0004126 Ga0495593_0004126_3609_4604 329
415 3300048088 Ga0495602_0055208 Ga0495602_0055208_312_1307 329
416 3300048089 Ga0495614_0002600 Ga0495614_0002600_6267_7262 329
417 3300048903 Ga0496100_0008416 Ga0496100_0008416_818_1813 329
418 3300048903 Ga0496100_0092199 Ga0496100_0092199_589_1584 329
419 3300048903 Ga0496100_0250415 Ga0496100_0250415_305_1300 329
420 3300048904 Ga0496101_0086414 Ga0496101_0086414_562_1557 329
421 3300048904 Ga0496101_0189061 Ga0496101_0189061_330_1325 329
422 3300048904 Ga0496101_0293108 Ga0496101_0293108_129_1124 329
423 3300048905 Ga0496102_0025975 Ga0496102_0025975_2768_3763 329
424 3300048905 Ga0496102_0039294 Ga0496102_0039294_1522_2517 329
425 3300048907 Ga0496104_0281394 Ga0496104_0281394_56_1051 329
426 3300048908 Ga0496105_0013770 Ga0496105_0013770_316_1311 329
427 3300048909 Ga0496106_0000649 Ga0496106_0000649_2411_3409 329
428 3300048909 Ga0496106_0076272 Ga0496106_0076272_283_1278 329
429 3300048909 Ga0496106_0099691 Ga0496106_0099691_1127_2161 329
430 3300048910 Ga0496107_0016695 Ga0496107_0016695_3989_4984 329
431 3300048912 Ga0496109_0006785 Ga0496109_0006785_8234_9229 329
432 3300048912 Ga0496109_0032069 Ga0496109_0032069_3157_4152 329
433 3300048912 Ga0496109_0304386 Ga0496109_0304386_247_1242 329
434 3300048913 Ga0496110_0008221 Ga0496110_0008221_388_1383 329
435 3300048913 Ga0496110_0021224 Ga0496110_0021224_4363_5358 329
436 3300048913 Ga0496110_0367228 Ga0496110_0367228_235_1230 329
437 3300048914 Ga0496111_0161891 Ga0496111_0161891_386_1381 329
438 3300048914 Ga0496111_0208400 Ga0496111_0208400_45_1040 329
439 3300048915 Ga0496112_0000037 Ga0496112_0000037_2242_3237 329
440 3300048915 Ga0496112_0003961 Ga0496112_0003961_8950_9945 329
441 3300048915 Ga0496112_0021901 Ga0496112_0021901_179_1174 329
442 3300048915 Ga0496112_0102784 Ga0496112_0102784_1176_2171 329
443 3300048915 Ga0496112_0165641 Ga0496112_0165641_94_1089 329
444 3300048916 Ga0496113_0159050 Ga0496113_0159050_588_1583 329
445 3300048917 Ga0496114_0157357 Ga0496114_0157357_526_1521 329
446 3300048918 Ga0496115_0007240 Ga0496115_0007240_2006_3001 329
447 3300048918 Ga0496115_0032633 Ga0496115_0032633_1724_2719 329
448 3300048918 Ga0496115_0054375 Ga0496115_0054375_893_1888 329
449 3300048918 Ga0496115_0124303 Ga0496115_0124303_801_1796 329
450 3300048918 Ga0496115_0275365 Ga0496115_0275365_90_1085 329
451 3300048919 Ga0496116_0026092 Ga0496116_0026092_500_1534 329
452 3300048919 Ga0496116_0116602 Ga0496116_0116602_347_1345 329
453 3300048920 Ga0496117_0006544 Ga0496117_0006544_1549_2547 329
454 3300048920 Ga0496117_0013445 Ga0496117_0013445_5523_6557 329
455 3300048920 Ga0496117_0075581 Ga0496117_0075581_546_1541 329
456 3300048920 Ga0496117_0102629 Ga0496117_0102629_740_1735 329
457 3300048921 Ga0496118_0003970 Ga0496118_0003970_5000_5998 329
458 3300048921 Ga0496118_0060107 Ga0496118_0060107_566_1561 329
459 3300048921 Ga0496118_0076246 Ga0496118_0076246_285_1319 329
460 3300048922 Ga0496119_0029785 Ga0496119_0029785_2305_3474 329
461 3300048923 Ga0496120_0026718 Ga0496120_0026718_145_1140 329
462 3300048924 Ga0496121_0000476 Ga0496121_0000476_51760_52758 329
463 3300048924 Ga0496121_0001742 Ga0496121_0001742_337_1332 329
464 3300048924 Ga0496121_0003089 Ga0496121_0003089_3432_4427 329
465 3300048924 Ga0496121_0007886 Ga0496121_0007886_288_1457 329
466 3300048924 Ga0496121_0066441 Ga0496121_0066441_1426_2604 329
467 3300048924 Ga0496121_0073520 Ga0496121_0073520_1104_2096 329
468 3300048924 Ga0496121_0074570 Ga0496121_0074570_1500_2495 329
469 3300048924 Ga0496121_0157710 Ga0496121_0157710_59_1054 329
470 3300048925 Ga0496122_0060286 Ga0496122_0060286_1282_2274 329
471 3300048926 Ga0496123_0077422 Ga0496123_0077422_497_1489 329
472 3300048926 Ga0496123_0117547 Ga0496123_0117547_453_1448 329
473 3300048927 Ga0496124_0001128 Ga0496124_0001128_20866_21864 329
474 3300048927 Ga0496124_0043677 Ga0496124_0043677_912_1904 329
475 3300048927 Ga0496124_0214415 Ga0496124_0214415_186_1181 329
476 3300048928 Ga0496125_0000154 Ga0496125_0000154_56200_57195 329
477 3300048928 Ga0496125_0001251 Ga0496125_0001251_36257_37252 329
478 3300048928 Ga0496125_0012395 Ga0496125_0012395_3337_4335 329
479 3300048928 Ga0496125_0044517 Ga0496125_0044517_1806_2801 329
480 3300048929 Ga0496126_0005646 Ga0496126_0005646_1796_2794 329
481 3300048929 Ga0496126_0005790 Ga0496126_0005790_6457_7452 329
482 3300048929 Ga0496126_0019810 Ga0496126_0019810_3633_4628 329
483 3300048929 Ga0496126_0073181 Ga0496126_0073181_1578_2612 329
484 3300048929 Ga0496126_0136588 Ga0496126_0136588_887_1882 329
485 3300048929 Ga0496126_0175809 Ga0496126_0175809_571_1605 329
486 3300048929 Ga0496126_0215657 Ga0496126_0215657_55_1050 329
487 3300049568 Ga0501031_0011177 Ga0501031_0011177_616_1614 329
488 3300049569 Ga0501032_0003299 Ga0501032_0003299_4589_5587 329
489 3300049570 Ga0501033_0000124 Ga0501033_0000124_67261_68259 329
490 3300049572 Ga0501036_0001379 Ga0501036_0001379_4589_5587 329
491 3300049572 Ga0501036_0057426 Ga0501036_0057426_1757_2752 329
492 3300049573 Ga0501037_0037968 Ga0501037_0037968_1368_2366 329
493 3300049574 Ga0501038_0000041 Ga0501038_0000041_5809_6807 329
494 3300049575 Ga0501039_0000472 Ga0501039_0000472_17757_18755 329
495 3300049579 Ga0501043_0022762 Ga0501043_0022762_3434_4432 329
496 3300049581 Ga0501047_0016600 Ga0501047_0016600_4973_5971 329
497 3300049583 Ga0501067_0077869 Ga0501067_0077869_318_1316 329
498 3300049584 Ga0501068_0021594 Ga0501068_0021594_2153_3151 329
499 3300049585 Ga0501069_0014051 Ga0501069_0014051_478_1476 329
500 3300049586 Ga0501070_0004644 Ga0501070_0004644_9558_10556 329
501 3300049589 Ga0501073_0028939 Ga0501073_0028939_170_1168 329
502 3300049742 Ga0501080_0000638 Ga0501080_0000638_4361_5359 329
503 3300049822 Ga0501035_0002235 Ga0501035_0002235_6075_7073 329
504 3300049824 Ga0501045_0029715 Ga0501045_0029715_2172_3170 329
505 3300050491 nmdc:mga00v17_28583_c1 nmdc:mga00v17_28583_c1_119_1114 329
506 3300050491 nmdc:mga00v17_94891_c1 nmdc:mga00v17_94891_c1_320_1315 329
507 3300050492 nmdc:mga0yw44_19552_c1 nmdc:mga0yw44_19552_c1_1548_2543 329
508 3300050492 nmdc:mga0yw44_31585_c1 nmdc:mga0yw44_31585_c1_1342_2376 329
509 3300050507 nmdc:mga05p37_348275_c1 nmdc:mga05p37_348275_c1_524_1519 329
510 3300050511 nmdc:mga08y16_158068_c1 nmdc:mga08y16_158068_c1_1052_2047 329
511 3300050511 nmdc:mga08y16_229255_c1 nmdc:mga08y16_229255_c1_590_1585 329
512 3300050512 nmdc:mga0n895_53072_c1 nmdc:mga0n895_53072_c1_2654_3649 329
513 3300050515 nmdc:mga0a205_244607_c1 nmdc:mga0a205_244607_c1_370_1365 329
514 3300050516 nmdc:mga0sz30_5341_c1 nmdc:mga0sz30_5341_c1_2224_3258 329
515 3300053077 Ga0495601_0022259 Ga0495601_0022259_1660_2838 329
516 3300053077 Ga0495601_0113424 Ga0495601_0113424_45_1223 329
517 3300053080 Ga0500635_0004467 Ga0500635_0004467_1757_2752 329
518 3300053084 Ga0495595_0004386 Ga0495595_0004386_1688_2683 329
519 3300053084 Ga0495595_0006944 Ga0495595_0006944_433_1611 329
520 3300053085 Ga0495619_0004209 Ga0495619_0004209_4036_5031 329
521 3300053085 Ga0495619_0041813 Ga0495619_0041813_1234_2412 329
522 3300053087 Ga0500643_028088 Ga0500643_028088_262_1257 329
523 3300053093 Ga0500651_0000861 Ga0500651_0000861_1513_2508 329
524 3300053093 Ga0500651_0039325 Ga0500651_0039325_91_1086 329
525 3300053093 Ga0500651_0183221 Ga0500651_0183221_170_1165 329
526 3300053094 Ga0500566_0000157 Ga0500566_0000157_18338_19333 329
527 3300053094 Ga0500566_0016976 Ga0500566_0016976_3126_4121 329
528 3300053094 Ga0500566_0093266 Ga0500566_0093266_561_1559 329
529 3300053096 Ga0500641_0006830 Ga0500641_0006830_2726_3721 329
530 3300053096 Ga0500641_0108380 Ga0500641_0108380_17_1012 329
531 3300053102 Ga0500554_000813 Ga0500554_000813_2001_2996 329
532 3300053104 Ga0500556_0000413 Ga0500556_0000413_15831_16826 329
533 3300053116 Ga0500592_001374 Ga0500592_001374_2801_3796 329
534 3300053119 Ga0500595_000331 Ga0500595_000331_26278_27273 329
535 3300053119 Ga0500595_001464 Ga0500595_001464_1006_2001 329
536 3300053119 Ga0500595_011823 Ga0500595_011823_953_1948 329
537 3300053130 Ga0500642_0000005 Ga0500642_0000005_14352_15347 329
538 3300053130 Ga0500642_0025239 Ga0500642_0025239_1174_2169 329
539 3300053133 Ga0500655_011033 Ga0500655_011033_244_1239 329
540 3300053134 Ga0500658_0071925 Ga0500658_0071925_227_1222 329
541 3300053134 Ga0500658_0092536 Ga0500658_0092536_140_1135 329
542 3300053136 Ga0500559_0002794 Ga0500559_0002794_3969_4964 329
543 3300053136 Ga0500559_0030986 Ga0500559_0030986_213_1211 329
544 3300053139 Ga0500568_0002149 Ga0500568_0002149_3211_4206 329
545 3300053139 Ga0500568_0014348 Ga0500568_0014348_1141_2136 329
546 3300053139 Ga0500568_0097246 Ga0500568_0097246_61_1065 329
547 3300053140 Ga0500573_0002307 Ga0500573_0002307_2759_3757 329
548 3300053145 Ga0500586_004415 Ga0500586_004415_171_1166 329
549 3300053146 Ga0500588_0010416 Ga0500588_0010416_1231_2226 329
550 3300053148 Ga0500590_030324 Ga0500590_030324_1792_2787 329
551 3300053150 Ga0500603_001303 Ga0500603_001303_3282_4277 329
552 3300053150 Ga0500603_048710 Ga0500603_048710_26_1024 329
553 3300053151 Ga0500604_0001450 Ga0500604_0001450_2149_3144 329
554 3300053151 Ga0500604_0044019 Ga0500604_0044019_68_1063 329
555 3300053153 Ga0500616_0000180 Ga0500616_0000180_90684_91679 329
556 3300053156 Ga0500622_0022981 Ga0500622_0022981_2106_3101 329
557 3300053158 Ga0500627_0117127 Ga0500627_0117127_18_1013 329
558 3300053161 Ga0500634_0120028 Ga0500634_0120028_270_1265 329
559 3300053162 Ga0500638_000259 Ga0500638_000259_3414_4409 329
560 3300053162 Ga0500638_065247 Ga0500638_065247_691_1689 329
561 3300053177 Ga0500636_0002272 Ga0500636_0002272_7746_8741 329
562 3300053178 Ga0500637_0001727 Ga0500637_0001727_2124_3119 329
563 3300053178 Ga0500637_0011620 Ga0500637_0011620_3087_4082 329
564 3300053730 Ga0500645_011768 Ga0500645_011768_257_1252 329
565 3300053737 Ga0500601_002924 Ga0500601_002924_180_1361 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01795

Methyltransf_5

MraW methylase family

66

369

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8992 6 303
1wg8-assembly2.cif.gz_B crystal structure of a predicted s-adenosylmethionine-dependent methyltransferase tt1512 from thermus thermophilus hb8. 0.8932 6 303
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.8905 13 304
3tka-assembly1.cif.gz_A-2 crystal structure and solution saxs of methyltransferase rsmh from e.coli 0.8694 13 304
1n2x-assembly1.cif.gz_A crystal structure analysis of tm0872, a putative sam-dependent methyltransferase, complexed with sam 0.853 6 301
ID Description Score Start End Superfamily
af_F7F172_184_294_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9254 120 208 1.10.150.170
af_K7MMS9_87_190_1.10.150.170 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative methyltransferase TM0872, insert domain 0.9106 120 210 1.10.150.170
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9072 6 303 3.40.50.150
af_F7F172_79_179_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9049 15 102 3.40.50.150
1wg8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8974 6 303 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A382S8E5-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase 0.9477 205 302 GO:0070475
GO:0071424
AF-A0A847JHT4-F1-model_v4 16S rRNA (Cytosine(1402)-N(4))-methyltransferase (EC 2.1.1.199) 0.9353 1 105 GO:0005737
GO:0070475
GO:0071424
AF-A0A176Z2R9-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9345 1 325 GO:0005737
GO:0070475
GO:0071424
AF-A0A176Z2R9-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9317 1 325 GO:0005737
GO:0070475
GO:0071424
AF-A0A346A2Y3-F1-model_v4 Ribosomal RNA small subunit methyltransferase H (EC 2.1.1.199) (16S rRNA m(4)C1402 methyltransferase) (rRNA (cytosine-N(4)-)-methyltransferase RsmH) 0.9292 1 325 GO:0005737
GO:0070475
GO:0071424

Feature Viewer

pLDDT pTM Quality
87.05 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map