F464237

General Info

Members Datasets Scaffolds Average Seq Length
565 286 548 266

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10002997|Ga0070692_100029976
Length 299
Sequence MPGAFRDNERRAREGAAGAKHQGRFARDPVEIGMSYGPHRIVCLTEEPTEVLYALGEQDRIVGISGFTVRPPRARKEKPKVSAFTSAKIERILDLKPDMAIGFSDIQADIARELIKAGVEVWISNHRSVAGILAYIRRLGALVGAAEKVEAYARELEAHVERVRASGAALPRHPRVYFEEWDDPPITGIRWVAELIRIAGGEDVFPERAEQSLAKHRILSDPAEVISRQPDMILASWCGKKFQPASVAARPGWGAIPAVRNGELHEIKSPIILQPGPAALTDGLDALHAVIARWVLGGH

Samples

Sample ID Description Type Environment
1 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221660 Methylibium sp. Root1272 Isolate Unclassified
4 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
5 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
6 2734482264 Dyella sp. AD052 Isolate Unclassified
7 2738543009 Luteibacter sp. OK325 Isolate Unclassified
8 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
9 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
10 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
11 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
12 2919085039 Luteibacter sp. 1214 Isolate Unclassified
13 2919404418 Luteibacter sp. 3190 Isolate Unclassified
14 2928963466 Dyella japonica 1073 Isolate Unclassified
15 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
16 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
17 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
22 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
23 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
180 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
223 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
280 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
281 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
282 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.58
Metatranscriptomes 1.42
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.14
Nodule 0
Rhizoplane 1.95
Rhizosphere 80.71
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003426 3300001904 Bacteria 2751
2 JGI24741J21665_1000681 3300001915 Bacteria 10248
3 JGI24741J21665_1008685 3300001915 Bacteria 1906
4 JGI24740J21852_10002017 3300001979 Bacteria 9284
5 JGI24740J21852_10006374 3300001979 Bacteria 4892
6 Ga0055539_1007878 3300003752 Bacteria 1340
7 Ga0055533_1002033 3300003756 Bacteria 4908
8 Ga0055525_1000178 3300003759 Bacteria 79260
9 Ga0055527_1000090 3300003760 Bacteria 71093
10 Ga0055527_1000100 3300003760 Bacteria 63720
11 Ga0055535_1000201 3300003761 Bacteria 63716
12 Ga0055535_1000742 3300003761 Bacteria 24432
13 Ga0055535_1001175 3300003761 Bacteria 15158
14 Ga0055542_1000187 3300003762 Bacteria 76099
15 Ga0055542_1000191 3300003762 Bacteria 74866
16 Ga0055542_1000212 3300003762 Bacteria 71081
17 Ga0055542_1000236 3300003762 Bacteria 63720
18 Ga0055529_1000256 3300003763 Bacteria 63720
19 Ga0055529_1000259 3300003763 Bacteria 63245
20 Ga0058692_1000015 3300003856 Bacteria 295729
21 Ga0065707_10008645 3300005295 Bacteria 2864
22 Ga0070658_10001497 3300005327 Bacteria 19822
23 Ga0070658_10011621 3300005327 Bacteria 7063
24 Ga0070658_10331290 3300005327 Bacteria 1301
25 Ga0070683_100048770 3300005329 Bacteria 3915
26 Ga0070683_100088218 3300005329 Bacteria 2910
27 Ga0070670_100071853 3300005331 Bacteria 2971
28 Ga0070677_10011734 3300005333 Bacteria 3028
29 Ga0068869_100175413 3300005334 Bacteria 1677
30 Ga0070666_10000013 3300005335 Bacteria 230442
31 Ga0070680_100003199 3300005336 Bacteria 12174
32 Ga0070680_100020813 3300005336 Bacteria 5206
33 Ga0070680_100043710 3300005336 Bacteria 3639
34 Ga0070680_100050715 3300005336 Bacteria 3385
35 Ga0070680_100088523 3300005336 Bacteria 2561
36 Ga0070682_100001531 3300005337 Bacteria 12957
37 Ga0070682_100040815 3300005337 Bacteria 2857
38 Ga0070682_100080903 3300005337 Bacteria 2102
39 Ga0070660_100045685 3300005339 Bacteria 3354
40 Ga0070660_100049161 3300005339 Bacteria 3241
41 Ga0070660_100068709 3300005339 Bacteria 2762
42 Ga0070691_10003728 3300005341 Bacteria 6881
43 Ga0070691_10013583 3300005341 Bacteria 3731
44 Ga0070661_100005231 3300005344 Bacteria 8936
45 Ga0070661_100007885 3300005344 Bacteria 7353
46 Ga0070661_100051308 3300005344 Bacteria 3019
47 Ga0070661_100086661 3300005344 Bacteria 2315
48 Ga0070661_100369011 3300005344 Bacteria 1129
49 Ga0070692_10002997 3300005345 Bacteria 6723
50 Ga0070692_10013814 3300005345 Bacteria 3774
51 Ga0070692_10021053 3300005345 Bacteria 3170
52 Ga0070669_100016333 3300005353 Bacteria 5295
53 Ga0070673_100381814 3300005364 Bacteria 1256
54 Ga0070659_100005909 3300005366 Bacteria 8819
55 Ga0070659_100030751 3300005366 Bacteria 4155
56 Ga0070659_100218530 3300005366 Bacteria 1572
57 Ga0070667_100014067 3300005367 Bacteria 6612
58 Ga0070714_100521861 3300005435 Bacteria 1135
59 Ga0070713_100007977 3300005436 Bacteria 7483
60 Ga0070663_100003461 3300005455 Bacteria 9097
61 Ga0070663_100005923 3300005455 Bacteria 7317
62 Ga0070663_100015446 3300005455 Bacteria 4930
63 Ga0070663_100065322 3300005455 Bacteria 2633
64 Ga0070681_10000721 3300005458 Bacteria 27370
65 Ga0070681_10000934 3300005458 Bacteria 24585
66 Ga0070681_10010860 3300005458 Bacteria 9001
67 Ga0070681_10073268 3300005458 Bacteria 3386
68 Ga0068867_100145442 3300005459 Bacteria 1857
69 Ga0070706_100021362 3300005467 Bacteria 5962
70 Ga0070706_100025560 3300005467 Bacteria 5436
71 Ga0070679_100000417 3300005530 Bacteria 36272
72 Ga0070679_100009935 3300005530 Bacteria 9008
73 Ga0070679_100064877 3300005530 Bacteria 3640
74 Ga0070684_100037216 3300005535 Bacteria 4172
75 Ga0070684_100042703 3300005535 Bacteria 3915
76 Ga0070672_100018953 3300005543 Bacteria 4985
77 Ga0070696_100001686 3300005546 Bacteria 14471
78 Ga0070696_100030549 3300005546 Bacteria 3689
79 Ga0070696_100037647 3300005546 Bacteria 3337
80 Ga0070693_100004068 3300005547 Bacteria 6885
81 Ga0070693_100179185 3300005547 Bacteria 1363
82 Ga0070665_100000333 3300005548 Bacteria 72698
83 Ga0068855_100019050 3300005563 Bacteria 8251
84 Ga0068855_100513013 3300005563 Bacteria 1301
85 Ga0068857_100044998 3300005577 Bacteria 3915
86 Ga0068857_100065959 3300005577 Bacteria 3220
87 Ga0068857_100102397 3300005577 Bacteria 2570
88 Ga0068857_100353015 3300005577 Bacteria 1362
89 Ga0068854_100289958 3300005578 Bacteria 1320
90 Ga0068856_100000797 3300005614 Bacteria 33958
91 Ga0068856_100005119 3300005614 Bacteria 12956
92 Ga0068856_100064205 3300005614 Bacteria 3628
93 Ga0068852_100040728 3300005616 Bacteria 3921
94 Ga0068852_100149769 3300005616 Bacteria 2169
95 Ga0068852_100377819 3300005616 Bacteria 1389
96 Ga0068859_100107681 3300005617 Bacteria 2848
97 Ga0068859_100418112 3300005617 Bacteria 1437
98 Ga0068866_10052177 3300005718 Bacteria 2086
99 Ga0068861_100572039 3300005719 Bacteria 1033
100 Ga0068851_10075389 3300005834 Bacteria 1753
101 Ga0068860_100097736 3300005843 Bacteria 2799
102 Ga0068860_100105639 3300005843 Bacteria 2689
103 Ga0068862_100012901 3300005844 Bacteria 6911
104 Ga0081455_10132185 3300005937 Bacteria 1950
105 Ga0075366_10077823 3300006195 Bacteria 1979
106 Ga0075434_100016515 3300006871 Bacteria 7097
107 Ga0097620_100107684 3300006931 Bacteria 2848
108 Ga0097620_100418080 3300006931 Bacteria 1437
109 Ga0075435_100026633 3300007076 Bacteria 4514
110 Ga0105240_10007819 3300009093 Bacteria 15439
111 Ga0105240_10009451 3300009093 Bacteria 13801
112 Ga0105240_10103339 3300009093 Bacteria 3462
113 Ga0111539_10518133 3300009094 Bacteria 1389
114 Ga0105245_10215208 3300009098 Bacteria 1851
115 Ga0105247_10001072 3300009101 Bacteria 20420
116 Ga0105243_10186949 3300009148 Bacteria 1806
117 Ga0105241_10059458 3300009174 Bacteria 2939
118 Ga0105241_10119003 3300009174 Bacteria 2124
119 Ga0105241_10129926 3300009174 Bacteria 2038
120 Ga0105237_10337884 3300009545 Bacteria 1510
121 Ga0105238_10000131 3300009551 Bacteria 82050
122 Ga0105238_10254080 3300009551 Bacteria 1736
123 Ga0105238_10310634 3300009551 Bacteria 1561
124 Ga0105239_10000023 3300010375 Bacteria 257478
125 Ga0105239_10026540 3300010375 Bacteria 6374
126 Ga0105246_10157009 3300011119 Bacteria 1729
127 Ga0157373_10006081 3300013100 Bacteria 9025
128 Ga0157373_10057143 3300013100 Bacteria 2768
129 Ga0157371_10011947 3300013102 Bacteria 6659
130 Ga0157371_10058745 3300013102 Bacteria 2728
131 Ga0157371_10064205 3300013102 Bacteria 2601
132 Ga0157370_10015411 3300013104 Bacteria 7768
133 Ga0157370_10028755 3300013104 Bacteria 5466
134 Ga0157370_10112207 3300013104 Bacteria 2548
135 Ga0157370_10433451 3300013104 Bacteria 1209
136 Ga0157369_10003442 3300013105 Bacteria 18769
137 Ga0157369_10036017 3300013105 Bacteria 5424
138 Ga0157369_10278688 3300013105 Bacteria 1741
139 Ga0163162_10095092 3300013306 Bacteria 3066
140 Ga0163162_10098108 3300013306 Bacteria 3019
141 Ga0157372_10002979 3300013307 Bacteria 18241
142 Ga0157372_10027202 3300013307 Bacteria 6226
143 Ga0157372_10077002 3300013307 Bacteria 3766
144 Ga0157372_10290878 3300013307 Bacteria 1900
145 Ga0157380_10176236 3300014326 Bacteria 1874
146 Ga0182008_10010199 3300014497 Bacteria 5034
147 Ga0157379_10041041 3300014968 Bacteria 4130
148 Ga0157379_10172101 3300014968 Bacteria 1955
149 Ga0182006_1000030 3300015261 Bacteria 242894
150 Ga0182006_1000062 3300015261 Bacteria 155622
151 Ga0182007_10000803 3300015262 Bacteria 17533
152 Ga0182007_10007098 3300015262 Bacteria 4739
153 Ga0182005_1000021 3300015265 Bacteria 272185
154 Ga0182005_1000035 3300015265 Bacteria 172168
155 Ga0182005_1015987 3300015265 Bacteria 2089
156 Ga0163161_10032533 3300017792 Bacteria 3724
157 Ga0163161_10195764 3300017792 Bacteria 1556
158 Ga0197907_10056721 3300020069 Bacteria 2834
159 Ga0206356_10103483 3300020070 Bacteria 5254
160 Ga0206356_11014676 3300020070 Bacteria 1923
161 Ga0206356_11464199 3300020070 Bacteria 5935
162 Ga0206354_10181591 3300020081 Bacteria 1740
163 Ga0206353_10124593 3300020082 Bacteria 3101
164 Ga0154015_1046164 3300020610 Bacteria 5505
165 Ga0154015_1409760 3300020610 Bacteria 1979
166 Ga0209674_100140 3300025226 Bacteria 109152
167 Ga0209674_100373 3300025226 Bacteria 24523
168 Ga0209674_101464 3300025226 Bacteria 6187
169 Ga0209672_100016 3300025228 Bacteria 522604
170 Ga0209672_101550 3300025228 Bacteria 7904
171 Ga0209437_100270 3300025233 Bacteria 78319
172 Ga0209258_100012 3300025242 Bacteria 825544
173 Ga0209258_100316 3300025242 Bacteria 74911
174 Ga0209258_105374 3300025242 Bacteria 2187
175 Ga0209026_1000117 3300025250 Bacteria 131918
176 Ga0209026_1000139 3300025250 Bacteria 115298
177 Ga0209148_1000005 3300025254 Bacteria 1806504
178 Ga0209148_1000014 3300025254 Bacteria 925277
179 Ga0209148_1000244 3300025254 Bacteria 86833
180 Ga0209129_1001466 3300025258 Bacteria 13159
181 Ga0209233_1025529 3300025261 Bacteria 1460
182 Ga0209455_1000014 3300025272 Bacteria 806601
183 Ga0209455_1003988 3300025272 Bacteria 5004
184 Ga0209758_1016770 3300025297 Bacteria 3699
185 Ga0209050_1050163 3300025298 Bacteria 1063
186 Ga0209256_1028698 3300025299 Bacteria 1565
187 Ga0209257_1005084 3300025304 Bacteria 9552
188 Ga0207682_10045555 3300025893 Bacteria 1800
189 Ga0207710_10041760 3300025900 Bacteria 2035
190 Ga0207680_10000001 3300025903 Bacteria 1091453
191 Ga0207647_10000191 3300025904 Bacteria 49647
192 Ga0207647_10003903 3300025904 Bacteria 11137
193 Ga0207647_10005977 3300025904 Bacteria 8866
194 Ga0207647_10024124 3300025904 Bacteria 4012
195 Ga0207645_10204939 3300025907 Bacteria 1298
196 Ga0207643_10105992 3300025908 Bacteria 1652
197 Ga0207705_10001045 3300025909 Bacteria 22516
198 Ga0207705_10001377 3300025909 Bacteria 19399
199 Ga0207705_10002025 3300025909 Bacteria 15772
200 Ga0207705_10020417 3300025909 Bacteria 4734
201 Ga0207705_10022308 3300025909 Bacteria 4515
202 Ga0207705_10294428 3300025909 Bacteria 1244
203 Ga0207684_10078191 3300025910 Bacteria 2813
204 Ga0207684_10178836 3300025910 Bacteria 1829
205 Ga0207654_10058208 3300025911 Bacteria 2249
206 Ga0207654_10148453 3300025911 Bacteria 1502
207 Ga0207707_10000106 3300025912 Bacteria 83040
208 Ga0207707_10000179 3300025912 Bacteria 66039
209 Ga0207707_10000812 3300025912 Bacteria 30590
210 Ga0207707_10002026 3300025912 Bacteria 18400
211 Ga0207707_10003633 3300025912 Bacteria 13677
212 Ga0207707_10003702 3300025912 Bacteria 13548
213 Ga0207707_10013685 3300025912 Bacteria 7076
214 Ga0207707_10049700 3300025912 Bacteria 3653
215 Ga0207695_10000588 3300025913 Bacteria 73260
216 Ga0207695_10001370 3300025913 Bacteria 41340
217 Ga0207695_10001701 3300025913 Bacteria 35229
218 Ga0207695_10002955 3300025913 Bacteria 24524
219 Ga0207695_10005835 3300025913 Bacteria 16192
220 Ga0207695_10055585 3300025913 Bacteria 4124
221 Ga0207695_10191438 3300025913 Bacteria 1963
222 Ga0207671_10253550 3300025914 Bacteria 1383
223 Ga0207660_10000747 3300025917 Bacteria 21615
224 Ga0207660_10004214 3300025917 Bacteria 9364
225 Ga0207660_10005475 3300025917 Bacteria 8246
226 Ga0207660_10008170 3300025917 Bacteria 6771
227 Ga0207660_10010788 3300025917 Bacteria 5938
228 Ga0207660_10032194 3300025917 Bacteria 3618
229 Ga0207657_10004478 3300025919 Bacteria 14774
230 Ga0207657_10010355 3300025919 Bacteria 9307
231 Ga0207657_10015112 3300025919 Bacteria 7497
232 Ga0207657_10015691 3300025919 Bacteria 7327
233 Ga0207657_10195262 3300025919 Bacteria 1631
234 Ga0207649_10002754 3300025920 Bacteria 9733
235 Ga0207649_10035547 3300025920 Bacteria 2994
236 Ga0207649_10325738 3300025920 Bacteria 1130
237 Ga0207652_10000442 3300025921 Bacteria 42938
238 Ga0207652_10000894 3300025921 Bacteria 28219
239 Ga0207652_10001820 3300025921 Bacteria 18481
240 Ga0207652_10002955 3300025921 Bacteria 14205
241 Ga0207652_10003323 3300025921 Bacteria 13319
242 Ga0207652_10041141 3300025921 Bacteria 3927
243 Ga0207652_10047840 3300025921 Bacteria 3654
244 Ga0207646_10036569 3300025922 Bacteria 4431
245 Ga0207681_10515256 3300025923 Bacteria 981
246 Ga0207694_10000168 3300025924 Bacteria 67647
247 Ga0207694_10083941 3300025924 Bacteria 2505
248 Ga0207694_10091345 3300025924 Bacteria 2403
249 Ga0207650_10071522 3300025925 Bacteria 2610
250 Ga0207650_10123708 3300025925 Bacteria 2017
251 Ga0207659_10047537 3300025926 Bacteria 3036
252 Ga0207687_10122655 3300025927 Bacteria 1946
253 Ga0207687_10422199 3300025927 Bacteria 1101
254 Ga0207700_10211276 3300025928 Bacteria 1641
255 Ga0207644_10394141 3300025931 Bacteria 1131
256 Ga0207690_10000869 3300025932 Bacteria 19295
257 Ga0207690_10282058 3300025932 Bacteria 1294
258 Ga0207706_10004745 3300025933 Bacteria 12726
259 Ga0207665_10204550 3300025939 Bacteria 1440
260 Ga0207691_10014135 3300025940 Bacteria 7616
261 Ga0207661_10012370 3300025944 Bacteria 6199
262 Ga0207661_10012402 3300025944 Bacteria 6192
263 Ga0207661_10034544 3300025944 Bacteria 3933
264 Ga0207667_10001475 3300025949 Bacteria 29510
265 Ga0207667_10002217 3300025949 Bacteria 24401
266 Ga0207667_10006386 3300025949 Bacteria 14293
267 Ga0207667_10008576 3300025949 Bacteria 12133
268 Ga0207667_10020975 3300025949 Bacteria 7246
269 Ga0207640_10000480 3300025981 Bacteria 24361
270 Ga0207640_10000593 3300025981 Bacteria 21569
271 Ga0207640_10000958 3300025981 Bacteria 16038
272 Ga0207658_10005424 3300025986 Bacteria 8744
273 Ga0207677_10349409 3300026023 Bacteria 1238
274 Ga0207703_10080246 3300026035 Bacteria 2717
275 Ga0207703_10127815 3300026035 Bacteria 2190
276 Ga0207703_10597678 3300026035 Bacteria 1043
277 Ga0207639_10001978 3300026041 Bacteria 13788
278 Ga0207639_10005834 3300026041 Bacteria 8343
279 Ga0207639_10483319 3300026041 Bacteria 1129
280 Ga0207678_10002935 3300026067 Bacteria 15447
281 Ga0207678_10003548 3300026067 Bacteria 14030
282 Ga0207678_10012596 3300026067 Bacteria 7429
283 Ga0207678_10013161 3300026067 Bacteria 7258
284 Ga0207678_10016189 3300026067 Bacteria 6545
285 Ga0207678_10039903 3300026067 Bacteria 4072
286 Ga0207702_10001248 3300026078 Bacteria 25656
287 Ga0207702_10001348 3300026078 Bacteria 24485
288 Ga0207702_10001815 3300026078 Bacteria 21008
289 Ga0207648_10214032 3300026089 Bacteria 1711
290 Ga0207674_10005152 3300026116 Bacteria 15581
291 Ga0207674_10019922 3300026116 Bacteria 7259
292 Ga0207674_10037630 3300026116 Bacteria 5030
293 Ga0207674_10214714 3300026116 Bacteria 1872
294 Ga0207674_10458873 3300026116 Bacteria 1231
295 Ga0207675_100188811 3300026118 Bacteria 1976
296 Ga0207683_10320868 3300026121 Bacteria 1419
297 Ga0207698_10001252 3300026142 Bacteria 14849
298 Ga0207698_10016340 3300026142 Bacteria 4999
299 Ga0207698_10040295 3300026142 Bacteria 3469
300 Ga0209371_1000011 3300027312 Bacteria 848456
301 Ga0268266_10000001 3300028379 Bacteria 4040580
302 Ga0268266_10000075 3300028379 Bacteria 218045
303 Ga0268264_10079476 3300028381 Bacteria 2798
304 Ga0268264_10413772 3300028381 Bacteria 1299
305 Ga0268256_1000011 3300030500 Bacteria 848625
306 Ga0307513_10055696 3300031456 Bacteria 4229
307 Ga0307414_10020692 3300032004 Bacteria 4107
308 Ga0307415_100512429 3300032126 Bacteria 1051
309 Ga0307510_10002367 3300033180 Bacteria 21348
310 Ga0307510_10043003 3300033180 Bacteria 4915
311 Ga0373959_0038111 3300034820 Bacteria 998
312 Ga0373927_0171026 3300035695 Bacteria 1424
313 Ga0373933_0333883 3300035724 Bacteria 983
314 Ga0373925_0004492 3300037068 Bacteria 10541
315 Ga0395899_0000089 3300037312 Bacteria 156851
316 Ga0395899_0004035 3300037312 Bacteria 11579
317 Ga0395899_0012531 3300037312 Bacteria 6498
318 Ga0395899_0073664 3300037312 Bacteria 2496
319 Ga0395899_0156525 3300037312 Bacteria 1612
320 Ga0395900_0000029 3300037418 Bacteria 281061
321 Ga0395900_0060933 3300037418 Bacteria 3881
322 Ga0395900_0076239 3300037418 Bacteria 3446
323 Ga0395900_0318405 3300037418 Bacteria 1536
324 Ga0395898_0000018 3300037466 Bacteria 418600
325 Ga0395898_0000241 3300037466 Bacteria 138133
326 Ga0395898_0029429 3300037466 Bacteria 5502
327 Ga0395898_0042982 3300037466 Bacteria 4454
328 Ga0395898_0318993 3300037466 Bacteria 1482
329 Ga0395905_0050410 3300037471 Bacteria 3900
330 Ga0395901_0003835 3300038443 Bacteria 15156
331 Ga0395901_0021565 3300038443 Bacteria 6600
332 Ga0395901_0062534 3300038443 Bacteria 3873
333 Ga0395901_0105859 3300038443 Bacteria 2952
334 Ga0395901_0172895 3300038443 Bacteria 2266
335 Ga0395901_0271045 3300038443 Bacteria 1765
336 Ga0395901_0307808 3300038443 Bacteria 1641
337 Ga0439436_0016966 3300041404 Bacteria 2181
338 Ga0439465_0000557 3300041413 Bacteria 11216
339 Ga0439449_0000004 3300042007 Bacteria 82454
340 Ga0451577_0112809 3300042876 Bacteria 2433
341 Ga0466969_0006829 3300044656 Bacteria 6071
342 Ga0466969_0031842 3300044656 Bacteria 2683
343 Ga0466972_0018206 3300044658 Bacteria 3514
344 Ga0466982_0000018 3300044672 Bacteria 113912
345 Ga0466966_0010735 3300044684 Bacteria 6090
346 Ga0466966_0021050 3300044684 Bacteria 4283
347 Ga0466961_0000345 3300044693 Bacteria 30306
348 Ga0466961_0004106 3300044693 Bacteria 9090
349 Ga0466961_0005564 3300044693 Bacteria 7952
350 Ga0466961_0012072 3300044693 Bacteria 5520
351 Ga0466963_0183809 3300044694 Bacteria 1460
352 Ga0466964_0014408 3300044706 Bacteria 3006
353 Ga0466971_0045353 3300044719 Bacteria 1974
354 Ga0466970_0014316 3300044765 Bacteria 4070
355 Ga0466970_0025429 3300044765 Bacteria 3099
356 Ga0466970_0058137 3300044765 Bacteria 2069
357 Ga0466957_0017384 3300044842 Bacteria 4210
358 Ga0466957_0049457 3300044842 Bacteria 2556
359 Ga0466959_0000148 3300045049 Bacteria 45981
360 Ga0466959_0002116 3300045049 Bacteria 12562
361 Ga0466959_0042263 3300045049 Bacteria 3361
362 Ga0451576_0012042 3300045051 Bacteria 9764
363 Ga0466958_0006082 3300045836 Bacteria 6543
364 Ga0466958_0008710 3300045836 Bacteria 5632
365 Ga0466958_0051309 3300045836 Bacteria 2497
366 Ga0466958_0079594 3300045836 Bacteria 2015
367 Ga0466967_0588574 3300045976 Bacteria 1097
368 Ga0495617_000035 3300046452 Bacteria 145195
369 Ga0495638_0000059 3300046460 Bacteria 191461
370 Ga0495638_0000100 3300046460 Bacteria 139296
371 Ga0495638_0073912 3300046460 Bacteria 2079
372 Ga0495650_0000350 3300046471 Bacteria 81541
373 Ga0495650_0000496 3300046471 Bacteria 59706
374 Ga0495650_0011152 3300046471 Bacteria 4951
375 Ga0495605_0059099 3300046474 Bacteria 1842
376 Ga0495639_0007327 3300046475 Bacteria 4734
377 Ga0495662_0008401 3300046476 Bacteria 5078
378 Ga0495584_0011251 3300046491 Bacteria 4583
379 Ga0495585_0003949 3300046492 Bacteria 9802
380 Ga0495607_0000012 3300046501 Bacteria 195369
381 Ga0495607_0000121 3300046501 Bacteria 82194
382 Ga0495607_0017066 3300046501 Bacteria 4671
383 Ga0495583_0005586 3300046506 Bacteria 8482
384 Ga0495606_0000490 3300046507 Bacteria 64820
385 Ga0495606_0000928 3300046507 Bacteria 43190
386 Ga0495606_0008792 3300046507 Bacteria 8672
387 Ga0495606_0009149 3300046507 Bacteria 8430
388 Ga0495606_0019290 3300046507 Bacteria 5079
389 Ga0495606_0084407 3300046507 Bacteria 1967
390 Ga0495606_0098211 3300046507 Bacteria 1787
391 Ga0495610_0017809 3300046512 Bacteria 4038
392 Ga0495616_0000027 3300046513 Bacteria 136712
393 Ga0495620_0001953 3300046515 Bacteria 12076
394 Ga0495620_0002406 3300046515 Bacteria 10839
395 Ga0495630_0000001 3300046517 Bacteria 1687293
396 Ga0495631_0000249 3300046518 Bacteria 37329
397 Ga0495631_0000916 3300046518 Bacteria 18359
398 Ga0495632_0000019 3300046519 Bacteria 215713
399 Ga0495632_0030754 3300046519 Bacteria 2783
400 Ga0495637_0005961 3300046520 Bacteria 6164
401 Ga0495648_0005506 3300046524 Bacteria 10504
402 Ga0495648_0006579 3300046524 Bacteria 9449
403 Ga0495586_0203576 3300046535 Bacteria 1122
404 Ga0495609_0006069 3300046538 Bacteria 6220
405 Ga0495621_0010415 3300046539 Bacteria 2843
406 Ga0495668_0024046 3300046616 Bacteria 3467
407 Ga0495611_0000001 3300046648 Bacteria 2628469
408 Ga0495611_0000027 3300046648 Bacteria 116663
409 Ga0495625_0000037 3300046660 Bacteria 219383
410 Ga0495625_0072075 3300046660 Bacteria 2423
411 Ga0495625_0126762 3300046660 Bacteria 1732
412 Ga0495661_0001009 3300046665 Bacteria 25232
413 Ga0495588_0204212 3300046674 Bacteria 1044
414 Ga0495670_0001266 3300046691 Bacteria 12354
415 Ga0495670_0017154 3300046691 Bacteria 3562
416 Ga0495589_0001848 3300046794 Bacteria 12006
417 Ga0495660_0000869 3300046810 Bacteria 22335
418 Ga0495660_0000936 3300046810 Bacteria 21389
419 Ga0495683_0001081 3300047323 Bacteria 18850
420 Ga0495679_000001 3300047446 Bacteria 1607568
421 Ga0495673_0000010 3300047469 Bacteria 709599
422 Ga0495673_0000072 3300047469 Bacteria 213166
423 Ga0495673_0000497 3300047469 Bacteria 42003
424 Ga0495681_0035180 3300047470 Bacteria 2489
425 Ga0495686_0000410 3300047472 Bacteria 67863
426 Ga0495686_0015787 3300047472 Bacteria 5140
427 Ga0495686_0164192 3300047472 Bacteria 1295
428 Ga0496100_0008035 3300048903 Bacteria 5863
429 Ga0496100_0069002 3300048903 Bacteria 2353
430 Ga0496101_0013541 3300048904 Bacteria 5468
431 Ga0496102_0504999 3300048905 Bacteria 1131
432 Ga0496104_0091669 3300048907 Bacteria 2905
433 Ga0496105_0049796 3300048908 Bacteria 3460
434 Ga0496106_0005129 3300048909 Bacteria 9707
435 Ga0496106_0185210 3300048909 Bacteria 1654
436 Ga0496109_0592727 3300048912 Bacteria 1044
437 Ga0496111_0012685 3300048914 Bacteria 5712
438 Ga0496116_0041704 3300048919 Bacteria 3146
439 Ga0496116_0049201 3300048919 Bacteria 2822
440 Ga0496117_0000056 3300048920 Bacteria 271417
441 Ga0496117_0008972 3300048920 Bacteria 9411
442 Ga0496117_0038404 3300048920 Bacteria 3550
443 Ga0496118_0000047 3300048921 Bacteria 271417
444 Ga0496118_0008700 3300048921 Bacteria 10430
445 Ga0496118_0014826 3300048921 Bacteria 7268
446 Ga0496118_0097839 3300048921 Bacteria 1995
447 Ga0496119_0000182 3300048922 Bacteria 87907
448 Ga0496120_0000661 3300048923 Bacteria 50628
449 Ga0496121_0000419 3300048924 Bacteria 84137
450 Ga0496121_0001210 3300048924 Bacteria 45020
451 Ga0496121_0002943 3300048924 Bacteria 24885
452 Ga0496121_0005984 3300048924 Bacteria 15367
453 Ga0496121_0023487 3300048924 Bacteria 5936
454 Ga0496121_0039863 3300048924 Bacteria 4131
455 Ga0496121_0045798 3300048924 Bacteria 3753
456 Ga0496122_0005330 3300048925 Bacteria 15377
457 Ga0496122_0013398 3300048925 Bacteria 8029
458 Ga0496122_0024832 3300048925 Bacteria 5233
459 Ga0496122_0030266 3300048925 Bacteria 4541
460 Ga0496123_0001547 3300048926 Bacteria 31705
461 Ga0496123_0014233 3300048926 Bacteria 6612
462 Ga0496123_0020466 3300048926 Bacteria 5174
463 Ga0496124_0000006 3300048927 Bacteria 904259
464 Ga0496124_0001002 3300048927 Bacteria 44773
465 Ga0496124_0002574 3300048927 Bacteria 23511
466 Ga0496125_0017071 3300048928 Bacteria 6935
467 Ga0496126_0004479 3300048929 Bacteria 16675
468 Ga0496126_0005938 3300048929 Bacteria 13757
469 Ga0496126_0202223 3300048929 Bacteria 1677
470 Ga0496126_0211577 3300048929 Bacteria 1632
471 Ga0496126_0254915 3300048929 Bacteria 1461
472 Ga0495678_000028 3300049459 Bacteria 220080
473 Ga0495682_0001690 3300049460 Bacteria 11247
474 Ga0495682_0001819 3300049460 Bacteria 10718
475 Ga0501290_001765 3300049513 Bacteria 2885
476 Ga0501032_0033291 3300049569 Bacteria 3531
477 Ga0501032_0051863 3300049569 Bacteria 2765
478 Ga0501033_0000430 3300049570 Bacteria 40189
479 Ga0501033_0011789 3300049570 Bacteria 6681
480 Ga0501033_0090119 3300049570 Bacteria 2243
481 Ga0501034_0000305 3300049571 Bacteria 87329
482 Ga0501034_0023429 3300049571 Bacteria 6291
483 Ga0501034_0046470 3300049571 Bacteria 4386
484 Ga0501034_0550362 3300049571 Bacteria 1063
485 Ga0501036_0093793 3300049572 Bacteria 2536
486 Ga0501038_0244153 3300049574 Bacteria 1425
487 Ga0501043_0045728 3300049579 Bacteria 3442
488 Ga0501043_0058971 3300049579 Bacteria 3012
489 Ga0501043_0158767 3300049579 Bacteria 1767
490 Ga0501046_0111214 3300049580 Bacteria 2092
491 Ga0501046_0136361 3300049580 Bacteria 1859
492 Ga0501047_0041830 3300049581 Bacteria 4427
493 Ga0501047_0110824 3300049581 Bacteria 2627
494 Ga0501047_0195408 3300049581 Bacteria 1885
495 Ga0501047_0231459 3300049581 Bacteria 1701
496 Ga0501048_0045725 3300049582 Bacteria 3126
497 Ga0501069_0000311 3300049585 Bacteria 22175
498 Ga0501069_0033228 3300049585 Bacteria 2841
499 Ga0501070_0000265 3300049586 Bacteria 49246
500 Ga0501070_0008054 3300049586 Bacteria 8919
501 Ga0501070_0013742 3300049586 Bacteria 6819
502 Ga0501070_0028719 3300049586 Bacteria 4663
503 Ga0501070_0052824 3300049586 Bacteria 3372
504 Ga0501070_0202134 3300049586 Bacteria 1631
505 Ga0501070_0223592 3300049586 Bacteria 1543
506 Ga0501071_0279886 3300049587 Bacteria 1262
507 Ga0501073_0028016 3300049589 Bacteria 4024
508 Ga0501073_0041674 3300049589 Bacteria 3244
509 Ga0501073_0142861 3300049589 Bacteria 1658
510 Ga0501074_0026881 3300049590 Bacteria 4170
511 Ga0501074_0029623 3300049590 Bacteria 3965
512 Ga0501074_0138312 3300049590 Bacteria 1742
513 Ga0501077_0003192 3300049593 Bacteria 9878
514 Ga0501225_0004969 3300049705 Bacteria 3928
515 Ga0501079_0208299 3300049741 Bacteria 1527
516 Ga0501080_0042006 3300049742 Bacteria 4259
517 Ga0501080_0129633 3300049742 Bacteria 2334
518 Ga0501080_0220634 3300049742 Bacteria 1735
519 Ga0501080_0236532 3300049742 Bacteria 1668
520 Ga0501081_0044032 3300049743 Bacteria 3063
521 Ga0501275_000109 3300049772 Bacteria 8688
522 Ga0501035_0001879 3300049822 Bacteria 21138
523 Ga0501035_0025434 3300049822 Bacteria 5427
524 Ga0501035_0047260 3300049822 Bacteria 3864
525 Ga0501035_0052939 3300049822 Bacteria 3631
526 Ga0501035_0167333 3300049822 Bacteria 1900
527 Ga0501044_0030494 3300049823 Bacteria 5683
528 Ga0501044_0038254 3300049823 Bacteria 5010
529 Ga0501044_0137743 3300049823 Bacteria 2431
530 Ga0501044_0221312 3300049823 Bacteria 1843
531 Ga0501044_0226598 3300049823 Bacteria 1818
532 Ga0501045_0387828 3300049824 Bacteria 1040
533 nmdc:mga0k408_19504_c1 3300050493 Bacteria 3791
534 nmdc:mga05p37_222849_c1 3300050507 Bacteria 2275
535 nmdc:mga0n895_168574_c1 3300050512 Bacteria 2222
536 nmdc:mga0rr50_94228_c1 3300050513 Bacteria 2338
537 nmdc:mga0a205_7961_c1 3300050515 Bacteria 9626
538 nmdc:mga0sz30_80021_c1 3300050516 Bacteria 1413
539 Ga0500643_000053 3300053087 Bacteria 142202
540 Ga0500651_0093638 3300053093 Bacteria 1847
541 Ga0500555_000155 3300053103 Bacteria 32599
542 Ga0500607_034153 3300053121 Bacteria 2786
543 Ga0500633_0001639 3300053160 Bacteria 4325
544 Ga0500636_0000139 3300053177 Bacteria 37961
545 Ga0500625_027477 3300053729 Bacteria 2699
546 Ga0500625_151705 3300053729 Bacteria 870
547 Ga0500645_001021 3300053730 Bacteria 15687
548 Ga0501084_0547379 3300054114 Bacteria 978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10019922 Ga0207674_100199228 228
2 3300026041 Ga0207639_10005834 Ga0207639_100058344 231
3 3300049569 Ga0501032_0033291 Ga0501032_0033291_425_1222 240
4 3300049574 Ga0501038_0244153 Ga0501038_0244153_574_1371 240
5 3300049590 Ga0501074_0138312 Ga0501074_0138312_356_1096 241
6 3300003856 Ga0058692_1000015 Ga0058692_1000015145 243
7 3300025913 Ga0207695_10005835 Ga0207695_1000583516 243
8 3300027312 Ga0209371_1000011 Ga0209371_1000011629 243
9 3300030500 Ga0268256_1000011 Ga0268256_1000011629 243
10 3300005366 Ga0070659_100005909 Ga0070659_1000059094 244
11 3300005616 Ga0068852_100149769 Ga0068852_1001497691 244
12 3300025912 Ga0207707_10000106 Ga0207707_1000010616 244
13 3300025912 Ga0207707_10003702 Ga0207707_100037024 244
14 3300025919 Ga0207657_10015691 Ga0207657_100156914 244
15 3300025927 Ga0207687_10122655 Ga0207687_101226552 244
16 3300026067 Ga0207678_10013161 Ga0207678_100131618 244
17 3300049581 Ga0501047_0110824 Ga0501047_0110824_84_884 244
18 3300049586 Ga0501070_0008054 Ga0501070_0008054_7968_8768 244
19 3300049742 Ga0501080_0042006 Ga0501080_0042006_106_906 244
20 3300025932 Ga0207690_10000869 Ga0207690_1000086913 246
21 3300005339 Ga0070660_100049161 Ga0070660_1000491613 247
22 3300001915 JGI24741J21665_1000681 JGI24741J21665_10006814 250
23 3300005345 Ga0070692_10013814 Ga0070692_100138143 250
24 3300005577 Ga0068857_100065959 Ga0068857_1000659592 250
25 3300013102 Ga0157371_10064205 Ga0157371_100642054 250
26 3300049822 Ga0501035_0001879 Ga0501035_0001879_20204_21004 250
27 3300041413 Ga0439465_0000557 Ga0439465_0000557_7543_8313 251
28 3300042007 Ga0439449_0000004 Ga0439449_0000004_27199_27969 251
29 iso_pu_bacteria 2718218334 2721028460 253
30 iso_pu_bacteria 2734482264 2735835949 253
31 iso_pu_bacteria 2738543009 2739229146 253
32 iso_pu_bacteria 2987605356 2987608367 254
33 3300005344 Ga0070661_100007885 Ga0070661_1000078855 255
34 3300005535 Ga0070684_100042703 Ga0070684_1000427034 255
35 3300013100 Ga0157373_10006081 Ga0157373_100060813 255
36 3300013307 Ga0157372_10027202 Ga0157372_100272028 255
37 3300020070 Ga0206356_11464199 Ga0206356_114641993 255
38 3300025920 Ga0207649_10002754 Ga0207649_100027546 255
39 3300025981 Ga0207640_10000480 Ga0207640_1000048025 255
40 3300026067 Ga0207678_10012596 Ga0207678_100125968 255
41 3300049571 Ga0501034_0000305 Ga0501034_0000305_57491_58279 255
42 iso_pu_bacteria 2842780639 2842782168 255
43 iso_pu_bacteria 2842914999 2842915135 255
44 iso_pu_bacteria 2919085039 2919088846 255
45 iso_pu_bacteria 2600255292 2601672119 256
46 iso_pu_bacteria 2857547612 2857552475 256
47 iso_pu_bacteria 2885080285 2885085884 256
48 iso_pu_bacteria 2919404418 2919404565 256
49 iso_pu_bacteria 2932410948 2932415299 256
50 iso_pu_bacteria 2932416698 2932421053 256
51 3300009101 Ga0105247_10001072 Ga0105247_1000107224 257
52 3300015261 Ga0182006_1000062 Ga0182006_100006232 257
53 3300017792 Ga0163161_10195764 Ga0163161_101957641 257
54 3300025900 Ga0207710_10041760 Ga0207710_100417602 257
55 3300035724 Ga0373933_0333883 Ga0373933_0333883_70_864 257
56 3300046452 Ga0495617_000035 Ga0495617_000035_126271_127059 257
57 3300046460 Ga0495638_0000059 Ga0495638_0000059_85204_85992 257
58 3300046460 Ga0495638_0073912 Ga0495638_0073912_542_1330 257
59 3300046471 Ga0495650_0000496 Ga0495650_0000496_9608_10396 257
60 3300046501 Ga0495607_0000121 Ga0495607_0000121_43808_44596 257
61 3300046506 Ga0495583_0005586 Ga0495583_0005586_482_1270 257
62 3300046507 Ga0495606_0000928 Ga0495606_0000928_26301_27089 257
63 3300046507 Ga0495606_0009149 Ga0495606_0009149_13_801 257
64 3300046507 Ga0495606_0084407 Ga0495606_0084407_552_1340 257
65 3300046512 Ga0495610_0017809 Ga0495610_0017809_122_910 257
66 3300046515 Ga0495620_0001953 Ga0495620_0001953_6706_7494 257
67 3300046515 Ga0495620_0002406 Ga0495620_0002406_2788_3576 257
68 3300046518 Ga0495631_0000916 Ga0495631_0000916_638_1426 257
69 3300046520 Ga0495637_0005961 Ga0495637_0005961_3902_4690 257
70 3300046524 Ga0495648_0005506 Ga0495648_0005506_8184_8972 257
71 3300046524 Ga0495648_0006579 Ga0495648_0006579_2918_3706 257
72 3300046538 Ga0495609_0006069 Ga0495609_0006069_4218_5006 257
73 3300046616 Ga0495668_0024046 Ga0495668_0024046_2459_3247 257
74 3300046648 Ga0495611_0000001 Ga0495611_0000001_161846_162634 257
75 3300046648 Ga0495611_0000027 Ga0495611_0000027_51856_52644 257
76 3300046660 Ga0495625_0000037 Ga0495625_0000037_129338_130126 257
77 3300046660 Ga0495625_0072075 Ga0495625_0072075_1352_2140 257
78 3300046665 Ga0495661_0001009 Ga0495661_0001009_9664_10452 257
79 3300046691 Ga0495670_0001266 Ga0495670_0001266_10357_11145 257
80 3300046794 Ga0495589_0001848 Ga0495589_0001848_8292_9080 257
81 3300046810 Ga0495660_0000869 Ga0495660_0000869_18315_19103 257
82 3300046810 Ga0495660_0000936 Ga0495660_0000936_5729_6517 257
83 3300047446 Ga0495679_000001 Ga0495679_000001_1428166_1428954 257
84 3300047469 Ga0495673_0000010 Ga0495673_0000010_610698_611486 257
85 3300047469 Ga0495673_0000072 Ga0495673_0000072_47219_48007 257
86 3300047469 Ga0495673_0000497 Ga0495673_0000497_37695_38483 257
87 3300047472 Ga0495686_0000410 Ga0495686_0000410_18696_19484 257
88 3300047472 Ga0495686_0015787 Ga0495686_0015787_186_974 257
89 3300048909 Ga0496106_0005129 Ga0496106_0005129_8795_9583 257
90 3300048924 Ga0496121_0001210 Ga0496121_0001210_4389_5177 257
91 3300048929 Ga0496126_0254915 Ga0496126_0254915_653_1441 257
92 3300049459 Ga0495678_000028 Ga0495678_000028_157568_158356 257
93 3300053087 Ga0500643_000053 Ga0500643_000053_61751_62539 257
94 3300053103 Ga0500555_000155 Ga0500555_000155_13394_14182 257
95 3300053160 Ga0500633_0001639 Ga0500633_0001639_1336_2124 257
96 3300053730 Ga0500645_001021 Ga0500645_001021_6795_7583 257
97 iso_pu_bacteria 2593339239 2595451484 257
98 3300001915 JGI24741J21665_1008685 JGI24741J21665_10086852 258
99 3300001979 JGI24740J21852_10006374 JGI24740J21852_100063746 258
100 3300003761 Ga0055535_1001175 Ga0055535_10011759 258
101 3300003762 Ga0055542_1000191 Ga0055542_10001918 258
102 3300005327 Ga0070658_10011621 Ga0070658_100116214 258
103 3300005336 Ga0070680_100003199 Ga0070680_10000319911 258
104 3300005337 Ga0070682_100001531 Ga0070682_1000015315 258
105 3300005339 Ga0070660_100045685 Ga0070660_1000456852 258
106 3300005339 Ga0070660_100068709 Ga0070660_1000687092 258
107 3300005341 Ga0070691_10003728 Ga0070691_100037286 258
108 3300005344 Ga0070661_100086661 Ga0070661_1000866613 258
109 3300005366 Ga0070659_100030751 Ga0070659_1000307512 258
110 3300005435 Ga0070714_100521861 Ga0070714_1005218612 258
111 3300005436 Ga0070713_100007977 Ga0070713_10000797711 258
112 3300005455 Ga0070663_100015446 Ga0070663_1000154463 258
113 3300005455 Ga0070663_100065322 Ga0070663_1000653222 258
114 3300005458 Ga0070681_10000721 Ga0070681_1000072122 258
115 3300005458 Ga0070681_10010860 Ga0070681_100108604 258
116 3300005530 Ga0070679_100000417 Ga0070679_10000041722 258
117 3300005546 Ga0070696_100001686 Ga0070696_1000016867 258
118 3300005546 Ga0070696_100037647 Ga0070696_1000376474 258
119 3300005547 Ga0070693_100179185 Ga0070693_1001791852 258
120 3300005563 Ga0068855_100019050 Ga0068855_1000190504 258
121 3300005563 Ga0068855_100513013 Ga0068855_1005130132 258
122 3300005577 Ga0068857_100353015 Ga0068857_1003530152 258
123 3300005578 Ga0068854_100289958 Ga0068854_1002899581 258
124 3300005614 Ga0068856_100000797 Ga0068856_1000007973 258
125 3300005614 Ga0068856_100064205 Ga0068856_1000642053 258
126 3300005616 Ga0068852_100377819 Ga0068852_1003778192 258
127 3300005834 Ga0068851_10075389 Ga0068851_100753892 258
128 3300006871 Ga0075434_100016515 Ga0075434_1000165155 258
129 3300007076 Ga0075435_100026633 Ga0075435_1000266334 258
130 3300009093 Ga0105240_10009451 Ga0105240_1000945113 258
131 3300009093 Ga0105240_10103339 Ga0105240_101033394 258
132 3300009098 Ga0105245_10215208 Ga0105245_102152083 258
133 3300009174 Ga0105241_10059458 Ga0105241_100594583 258
134 3300009174 Ga0105241_10129926 Ga0105241_101299262 258
135 3300009551 Ga0105238_10310634 Ga0105238_103106342 258
136 3300010375 Ga0105239_10000023 Ga0105239_1000002320 258
137 3300011119 Ga0105246_10157009 Ga0105246_101570091 258
138 3300013100 Ga0157373_10057143 Ga0157373_100571433 258
139 3300013102 Ga0157371_10058745 Ga0157371_100587452 258
140 3300013104 Ga0157370_10015411 Ga0157370_100154114 258
141 3300013104 Ga0157370_10433451 Ga0157370_104334512 258
142 3300013105 Ga0157369_10036017 Ga0157369_100360174 258
143 3300013105 Ga0157369_10278688 Ga0157369_102786881 258
144 3300013306 Ga0163162_10095092 Ga0163162_100950922 258
145 3300013307 Ga0157372_10002979 Ga0157372_100029794 258
146 3300013307 Ga0157372_10077002 Ga0157372_100770023 258
147 3300013307 Ga0157372_10290878 Ga0157372_102908782 258
148 3300015262 Ga0182007_10007098 Ga0182007_100070987 258
149 3300020069 Ga0197907_10056721 Ga0197907_100567214 258
150 3300020070 Ga0206356_10103483 Ga0206356_101034831 258
151 3300020610 Ga0154015_1409760 Ga0154015_14097602 258
152 3300025226 Ga0209674_101464 Ga0209674_1014641 258
153 3300025228 Ga0209672_101550 Ga0209672_1015502 258
154 3300025242 Ga0209258_100316 Ga0209258_1003168 258
155 3300025242 Ga0209258_105374 Ga0209258_1053742 258
156 3300025250 Ga0209026_1000139 Ga0209026_100013914 258
157 3300025254 Ga0209148_1000244 Ga0209148_10002448 258
158 3300025272 Ga0209455_1003988 Ga0209455_10039884 258
159 3300025904 Ga0207647_10003903 Ga0207647_1000390311 258
160 3300025904 Ga0207647_10024124 Ga0207647_100241244 258
161 3300025907 Ga0207645_10204939 Ga0207645_102049391 258
162 3300025909 Ga0207705_10002025 Ga0207705_100020257 258
163 3300025911 Ga0207654_10058208 Ga0207654_100582081 258
164 3300025912 Ga0207707_10000179 Ga0207707_1000017915 258
165 3300025912 Ga0207707_10002026 Ga0207707_100020268 258
166 3300025912 Ga0207707_10013685 Ga0207707_100136852 258
167 3300025913 Ga0207695_10001370 Ga0207695_1000137018 258
168 3300025913 Ga0207695_10055585 Ga0207695_100555853 258
169 3300025913 Ga0207695_10191438 Ga0207695_101914382 258
170 3300025917 Ga0207660_10004214 Ga0207660_100042144 258
171 3300025917 Ga0207660_10005475 Ga0207660_100054754 258
172 3300025919 Ga0207657_10010355 Ga0207657_100103554 258
173 3300025919 Ga0207657_10195262 Ga0207657_101952622 258
174 3300025920 Ga0207649_10325738 Ga0207649_103257382 258
175 3300025921 Ga0207652_10000894 Ga0207652_1000089410 258
176 3300025921 Ga0207652_10001820 Ga0207652_100018208 258
177 3300025921 Ga0207652_10003323 Ga0207652_100033235 258
178 3300025921 Ga0207652_10041141 Ga0207652_100411414 258
179 3300025923 Ga0207681_10515256 Ga0207681_105152561 258
180 3300025924 Ga0207694_10083941 Ga0207694_100839411 258
181 3300025927 Ga0207687_10422199 Ga0207687_104221991 258
182 3300025928 Ga0207700_10211276 Ga0207700_102112761 258
183 3300025933 Ga0207706_10004745 Ga0207706_1000474512 258
184 3300025939 Ga0207665_10204550 Ga0207665_102045502 258
185 3300025944 Ga0207661_10034544 Ga0207661_100345441 258
186 3300025949 Ga0207667_10002217 Ga0207667_100022177 258
187 3300025949 Ga0207667_10008576 Ga0207667_100085765 258
188 3300025949 Ga0207667_10020975 Ga0207667_100209753 258
189 3300026023 Ga0207677_10349409 Ga0207677_103494092 258
190 3300026035 Ga0207703_10127815 Ga0207703_101278152 258
191 3300026041 Ga0207639_10483319 Ga0207639_104833192 258
192 3300026067 Ga0207678_10002935 Ga0207678_100029357 258
193 3300026067 Ga0207678_10039903 Ga0207678_100399034 258
194 3300026078 Ga0207702_10001248 Ga0207702_1000124829 258
195 3300026116 Ga0207674_10005152 Ga0207674_100051526 258
196 3300026116 Ga0207674_10214714 Ga0207674_102147142 258
197 3300026142 Ga0207698_10040295 Ga0207698_100402952 258
198 3300032126 Ga0307415_100512429 Ga0307415_1005124291 258
199 3300034820 Ga0373959_0038111 Ga0373959_0038111_159_950 258
200 3300037312 Ga0395899_0073664 Ga0395899_0073664_1676_2470 258
201 3300037312 Ga0395899_0156525 Ga0395899_0156525_127_945 258
202 3300037418 Ga0395900_0060933 Ga0395900_0060933_1697_2521 258
203 3300037418 Ga0395900_0318405 Ga0395900_0318405_445_1263 258
204 3300037466 Ga0395898_0318993 Ga0395898_0318993_303_1121 258
205 3300038443 Ga0395901_0271045 Ga0395901_0271045_185_1009 258
206 3300038443 Ga0395901_0307808 Ga0395901_0307808_415_1233 258
207 3300046475 Ga0495639_0007327 Ga0495639_0007327_1427_2227 258
208 3300046476 Ga0495662_0008401 Ga0495662_0008401_1073_1873 258
209 3300046507 Ga0495606_0008792 Ga0495606_0008792_2898_3689 258
210 3300046517 Ga0495630_0000001 Ga0495630_0000001_518831_519631 258
211 3300046518 Ga0495631_0000249 Ga0495631_0000249_26509_27327 258
212 3300046674 Ga0495588_0204212 Ga0495588_0204212_75_893 258
213 3300048903 Ga0496100_0008035 Ga0496100_0008035_1768_2559 258
214 3300048903 Ga0496100_0069002 Ga0496100_0069002_1000_1797 258
215 3300048904 Ga0496101_0013541 Ga0496101_0013541_4577_5368 258
216 3300048905 Ga0496102_0504999 Ga0496102_0504999_259_1056 258
217 3300048907 Ga0496104_0091669 Ga0496104_0091669_82_879 258
218 3300048908 Ga0496105_0049796 Ga0496105_0049796_2582_3379 258
219 3300048920 Ga0496117_0008972 Ga0496117_0008972_811_1608 258
220 3300048920 Ga0496117_0038404 Ga0496117_0038404_2536_3333 258
221 3300048921 Ga0496118_0008700 Ga0496118_0008700_2681_3478 258
222 3300048921 Ga0496118_0014826 Ga0496118_0014826_975_1772 258
223 3300048922 Ga0496119_0000182 Ga0496119_0000182_49773_50570 258
224 3300048923 Ga0496120_0000661 Ga0496120_0000661_43_840 258
225 3300048924 Ga0496121_0000419 Ga0496121_0000419_18957_19754 258
226 3300048924 Ga0496121_0045798 Ga0496121_0045798_2155_2952 258
227 3300048925 Ga0496122_0024832 Ga0496122_0024832_129_920 258
228 3300048926 Ga0496123_0014233 Ga0496123_0014233_5685_6476 258
229 3300048929 Ga0496126_0004479 Ga0496126_0004479_13306_14103 258
230 3300049460 Ga0495682_0001819 Ga0495682_0001819_5716_6534 258
231 3300049570 Ga0501033_0000430 Ga0501033_0000430_6485_7288 258
232 3300049579 Ga0501043_0045728 Ga0501043_0045728_791_1588 258
233 3300049586 Ga0501070_0000265 Ga0501070_0000265_4423_5217 258
234 3300049586 Ga0501070_0223592 Ga0501070_0223592_491_1309 258
235 3300049593 Ga0501077_0003192 Ga0501077_0003192_8884_9702 258
236 3300049743 Ga0501081_0044032 Ga0501081_0044032_714_1511 258
237 3300049822 Ga0501035_0052939 Ga0501035_0052939_692_1486 258
238 3300049823 Ga0501044_0137743 Ga0501044_0137743_868_1662 258
239 3300049823 Ga0501044_0221312 Ga0501044_0221312_250_1047 258
240 3300049824 Ga0501045_0387828 Ga0501045_0387828_176_973 258
241 3300050512 nmdc:mga0n895_168574_c1 nmdc:mga0n895_168574_c1_574_1371 258
242 3300050513 nmdc:mga0rr50_94228_c1 nmdc:mga0rr50_94228_c1_695_1492 258
243 3300050515 nmdc:mga0a205_7961_c1 nmdc:mga0a205_7961_c1_7170_7967 258
244 3300053093 Ga0500651_0093638 Ga0500651_0093638_299_1090 258
245 iso_pu_bacteria 2687453130 2687581997 258
246 3300005331 Ga0070670_100071853 Ga0070670_1000718532 259
247 3300005334 Ga0068869_100175413 Ga0068869_1001754132 259
248 3300005336 Ga0070680_100020813 Ga0070680_1000208136 259
249 3300005344 Ga0070661_100369011 Ga0070661_1003690112 259
250 3300005366 Ga0070659_100218530 Ga0070659_1002185302 259
251 3300005458 Ga0070681_10000934 Ga0070681_1000093418 259
252 3300005467 Ga0070706_100021362 Ga0070706_1000213625 259
253 3300005467 Ga0070706_100025560 Ga0070706_1000255605 259
254 3300005530 Ga0070679_100009935 Ga0070679_10000993511 259
255 3300005535 Ga0070684_100037216 Ga0070684_1000372164 259
256 3300005546 Ga0070696_100030549 Ga0070696_1000305494 259
257 3300005617 Ga0068859_100418112 Ga0068859_1004181121 259
258 3300006931 Ga0097620_100418080 Ga0097620_1004180802 259
259 3300009148 Ga0105243_10186949 Ga0105243_101869492 259
260 3300009545 Ga0105237_10337884 Ga0105237_103378842 259
261 3300009551 Ga0105238_10254080 Ga0105238_102540802 259
262 3300010375 Ga0105239_10026540 Ga0105239_100265404 259
263 3300013104 Ga0157370_10028755 Ga0157370_100287555 259
264 3300015265 Ga0182005_1000035 Ga0182005_100003569 259
265 3300015265 Ga0182005_1015987 Ga0182005_10159872 259
266 3300025258 Ga0209129_1001466 Ga0209129_100146611 259
267 3300025297 Ga0209758_1016770 Ga0209758_10167702 259
268 3300025299 Ga0209256_1028698 Ga0209256_10286982 259
269 3300025904 Ga0207647_10000191 Ga0207647_1000019110 259
270 3300025910 Ga0207684_10078191 Ga0207684_100781915 259
271 3300025910 Ga0207684_10178836 Ga0207684_101788362 259
272 3300025912 Ga0207707_10000812 Ga0207707_1000081218 259
273 3300025914 Ga0207671_10253550 Ga0207671_102535502 259
274 3300025917 Ga0207660_10000747 Ga0207660_1000074717 259
275 3300025921 Ga0207652_10000442 Ga0207652_1000044229 259
276 3300025922 Ga0207646_10036569 Ga0207646_100365695 259
277 3300025924 Ga0207694_10091345 Ga0207694_100913452 259
278 3300025925 Ga0207650_10071522 Ga0207650_100715223 259
279 3300025931 Ga0207644_10394141 Ga0207644_103941412 259
280 3300025932 Ga0207690_10282058 Ga0207690_102820581 259
281 3300026116 Ga0207674_10458873 Ga0207674_104588732 259
282 3300031456 Ga0307513_10055696 Ga0307513_100556964 259
283 3300037312 Ga0395899_0012531 Ga0395899_0012531_1110_1907 259
284 3300037418 Ga0395900_0076239 Ga0395900_0076239_783_1580 259
285 3300037466 Ga0395898_0042982 Ga0395898_0042982_2376_3173 259
286 3300037471 Ga0395905_0050410 Ga0395905_0050410_2142_2939 259
287 3300038443 Ga0395901_0003835 Ga0395901_0003835_10274_11071 259
288 3300038443 Ga0395901_0062534 Ga0395901_0062534_783_1580 259
289 3300041404 Ga0439436_0016966 Ga0439436_0016966_1019_1813 259
290 3300044656 Ga0466969_0031842 Ga0466969_0031842_1461_2264 259
291 3300044658 Ga0466972_0018206 Ga0466972_0018206_2668_3471 259
292 3300044672 Ga0466982_0000018 Ga0466982_0000018_105028_105831 259
293 3300044684 Ga0466966_0010735 Ga0466966_0010735_1414_2217 259
294 3300046471 Ga0495650_0011152 Ga0495650_0011152_270_1064 259
295 3300046474 Ga0495605_0059099 Ga0495605_0059099_367_1161 259
296 3300046491 Ga0495584_0011251 Ga0495584_0011251_1094_1888 259
297 3300046492 Ga0495585_0003949 Ga0495585_0003949_3953_4747 259
298 3300046501 Ga0495607_0000012 Ga0495607_0000012_43646_44440 259
299 3300046501 Ga0495607_0017066 Ga0495607_0017066_1047_1841 259
300 3300046507 Ga0495606_0000490 Ga0495606_0000490_58833_59627 259
301 3300046513 Ga0495616_0000027 Ga0495616_0000027_43803_44597 259
302 3300046519 Ga0495632_0000019 Ga0495632_0000019_126291_127085 259
303 3300046519 Ga0495632_0030754 Ga0495632_0030754_1207_2001 259
304 3300046691 Ga0495670_0017154 Ga0495670_0017154_1330_2124 259
305 3300047323 Ga0495683_0001081 Ga0495683_0001081_14091_14885 259
306 3300047470 Ga0495681_0035180 Ga0495681_0035180_412_1206 259
307 3300047472 Ga0495686_0164192 Ga0495686_0164192_480_1274 259
308 3300048909 Ga0496106_0185210 Ga0496106_0185210_29_844 259
309 3300048912 Ga0496109_0592727 Ga0496109_0592727_51_851 259
310 3300048919 Ga0496116_0049201 Ga0496116_0049201_614_1408 259
311 3300048924 Ga0496121_0002943 Ga0496121_0002943_6949_7743 259
312 3300048925 Ga0496122_0013398 Ga0496122_0013398_2974_3768 259
313 3300048925 Ga0496122_0030266 Ga0496122_0030266_2021_2815 259
314 3300048926 Ga0496123_0020466 Ga0496123_0020466_2418_3212 259
315 3300048927 Ga0496124_0000006 Ga0496124_0000006_829531_830325 259
316 3300048927 Ga0496124_0001002 Ga0496124_0001002_8195_8989 259
317 3300048927 Ga0496124_0002574 Ga0496124_0002574_14514_15308 259
318 3300048928 Ga0496125_0017071 Ga0496125_0017071_3273_4067 259
319 3300049513 Ga0501290_001765 Ga0501290_001765_686_1480 259
320 3300049569 Ga0501032_0051863 Ga0501032_0051863_1710_2507 259
321 3300049570 Ga0501033_0090119 Ga0501033_0090119_771_1568 259
322 3300049571 Ga0501034_0023429 Ga0501034_0023429_5114_5914 259
323 3300049571 Ga0501034_0550362 Ga0501034_0550362_171_971 259
324 3300049579 Ga0501043_0058971 Ga0501043_0058971_490_1284 259
325 3300049580 Ga0501046_0136361 Ga0501046_0136361_291_1091 259
326 3300049581 Ga0501047_0041830 Ga0501047_0041830_2442_3242 259
327 3300049581 Ga0501047_0231459 Ga0501047_0231459_20_814 259
328 3300049586 Ga0501070_0028719 Ga0501070_0028719_2734_3528 259
329 3300049589 Ga0501073_0028016 Ga0501073_0028016_3140_3934 259
330 3300049590 Ga0501074_0029623 Ga0501074_0029623_424_1218 259
331 3300049705 Ga0501225_0004969 Ga0501225_0004969_2985_3779 259
332 3300049772 Ga0501275_000109 Ga0501275_000109_926_1720 259
333 3300049822 Ga0501035_0025434 Ga0501035_0025434_1008_1802 259
334 3300049822 Ga0501035_0047260 Ga0501035_0047260_2251_3120 259
335 3300049823 Ga0501044_0030494 Ga0501044_0030494_3106_3975 259
336 3300049823 Ga0501044_0038254 Ga0501044_0038254_849_1643 259
337 3300050516 nmdc:mga0sz30_80021_c1 nmdc:mga0sz30_80021_c1_454_1248 259
338 iso_pu_bacteria 2643221660 2644340497 259
339 3300001904 JGI24736J21556_1003426 JGI24736J21556_10034264 260
340 3300001979 JGI24740J21852_10002017 JGI24740J21852_100020172 260
341 3300003752 Ga0055539_1007878 Ga0055539_10078782 260
342 3300003756 Ga0055533_1002033 Ga0055533_10020335 260
343 3300003759 Ga0055525_1000178 Ga0055525_100017869 260
344 3300003760 Ga0055527_1000090 Ga0055527_100009018 260
345 3300003760 Ga0055527_1000100 Ga0055527_100010015 260
346 3300003761 Ga0055535_1000201 Ga0055535_100020133 260
347 3300003761 Ga0055535_1000742 Ga0055535_10007425 260
348 3300003762 Ga0055542_1000187 Ga0055542_100018744 260
349 3300003762 Ga0055542_1000212 Ga0055542_100021232 260
350 3300003762 Ga0055542_1000236 Ga0055542_100023633 260
351 3300003763 Ga0055529_1000256 Ga0055529_100025633 260
352 3300003763 Ga0055529_1000259 Ga0055529_100025928 260
353 3300005295 Ga0065707_10008645 Ga0065707_100086452 260
354 3300005327 Ga0070658_10001497 Ga0070658_1000149718 260
355 3300005327 Ga0070658_10331290 Ga0070658_103312902 260
356 3300005329 Ga0070683_100048770 Ga0070683_1000487703 260
357 3300005329 Ga0070683_100088218 Ga0070683_1000882183 260
358 3300005333 Ga0070677_10011734 Ga0070677_100117342 260
359 3300005335 Ga0070666_10000013 Ga0070666_10000013180 260
360 3300005336 Ga0070680_100043710 Ga0070680_1000437103 260
361 3300005336 Ga0070680_100050715 Ga0070680_1000507152 260
362 3300005336 Ga0070680_100088523 Ga0070680_1000885232 260
363 3300005337 Ga0070682_100040815 Ga0070682_1000408151 260
364 3300005337 Ga0070682_100080903 Ga0070682_1000809032 260
365 3300005341 Ga0070691_10013583 Ga0070691_100135834 260
366 3300005344 Ga0070661_100005231 Ga0070661_10000523110 260
367 3300005344 Ga0070661_100051308 Ga0070661_1000513083 260
368 3300005345 Ga0070692_10002997 Ga0070692_100029976 260
369 3300005345 Ga0070692_10021053 Ga0070692_100210534 260
370 3300005353 Ga0070669_100016333 Ga0070669_1000163336 260
371 3300005364 Ga0070673_100381814 Ga0070673_1003818141 260
372 3300005367 Ga0070667_100014067 Ga0070667_1000140673 260
373 3300005455 Ga0070663_100003461 Ga0070663_1000034615 260
374 3300005455 Ga0070663_100005923 Ga0070663_1000059239 260
375 3300005458 Ga0070681_10073268 Ga0070681_100732682 260
376 3300005459 Ga0068867_100145442 Ga0068867_1001454423 260
377 3300005530 Ga0070679_100064877 Ga0070679_1000648774 260
378 3300005543 Ga0070672_100018953 Ga0070672_1000189534 260
379 3300005547 Ga0070693_100004068 Ga0070693_1000040685 260
380 3300005548 Ga0070665_100000333 Ga0070665_10000033345 260
381 3300005577 Ga0068857_100044998 Ga0068857_1000449984 260
382 3300005577 Ga0068857_100102397 Ga0068857_1001023974 260
383 3300005614 Ga0068856_100005119 Ga0068856_10000511914 260
384 3300005616 Ga0068852_100040728 Ga0068852_1000407285 260
385 3300005617 Ga0068859_100107681 Ga0068859_1001076812 260
386 3300005718 Ga0068866_10052177 Ga0068866_100521773 260
387 3300005719 Ga0068861_100572039 Ga0068861_1005720391 260
388 3300005843 Ga0068860_100097736 Ga0068860_1000977362 260
389 3300005843 Ga0068860_100105639 Ga0068860_1001056393 260
390 3300005844 Ga0068862_100012901 Ga0068862_1000129012 260
391 3300005937 Ga0081455_10132185 Ga0081455_101321852 260
392 3300006195 Ga0075366_10077823 Ga0075366_100778232 260
393 3300006931 Ga0097620_100107684 Ga0097620_1001076842 260
394 3300009093 Ga0105240_10007819 Ga0105240_1000781914 260
395 3300009094 Ga0111539_10518133 Ga0111539_105181332 260
396 3300009174 Ga0105241_10119003 Ga0105241_101190033 260
397 3300009551 Ga0105238_10000131 Ga0105238_1000013121 260
398 3300013102 Ga0157371_10011947 Ga0157371_100119474 260
399 3300013104 Ga0157370_10112207 Ga0157370_101122073 260
400 3300013105 Ga0157369_10003442 Ga0157369_1000344211 260
401 3300013306 Ga0163162_10098108 Ga0163162_100981082 260
402 3300014326 Ga0157380_10176236 Ga0157380_101762361 260
403 3300014497 Ga0182008_10010199 Ga0182008_100101994 260
404 3300014968 Ga0157379_10041041 Ga0157379_100410415 260
405 3300014968 Ga0157379_10172101 Ga0157379_101721012 260
406 3300015261 Ga0182006_1000030 Ga0182006_1000030220 260
407 3300015262 Ga0182007_10000803 Ga0182007_100008035 260
408 3300015265 Ga0182005_1000021 Ga0182005_100002112 260
409 3300017792 Ga0163161_10032533 Ga0163161_100325334 260
410 3300020070 Ga0206356_11014676 Ga0206356_110146763 260
411 3300020081 Ga0206354_10181591 Ga0206354_101815913 260
412 3300020082 Ga0206353_10124593 Ga0206353_101245934 260
413 3300020610 Ga0154015_1046164 Ga0154015_10461643 260
414 3300025226 Ga0209674_100140 Ga0209674_10014074 260
415 3300025226 Ga0209674_100373 Ga0209674_10037316 260
416 3300025228 Ga0209672_100016 Ga0209672_100016110 260
417 3300025233 Ga0209437_100270 Ga0209437_10027046 260
418 3300025242 Ga0209258_100012 Ga0209258_100012251 260
419 3300025250 Ga0209026_1000117 Ga0209026_100011734 260
420 3300025254 Ga0209148_1000005 Ga0209148_10000051271 260
421 3300025254 Ga0209148_1000014 Ga0209148_1000014404 260
422 3300025261 Ga0209233_1025529 Ga0209233_10255291 260
423 3300025272 Ga0209455_1000014 Ga0209455_1000014292 260
424 3300025298 Ga0209050_1050163 Ga0209050_10501631 260
425 3300025304 Ga0209257_1005084 Ga0209257_100508410 260
426 3300025893 Ga0207682_10045555 Ga0207682_100455551 260
427 3300025903 Ga0207680_10000001 Ga0207680_10000001263 260
428 3300025904 Ga0207647_10005977 Ga0207647_100059778 260
429 3300025908 Ga0207643_10105992 Ga0207643_101059922 260
430 3300025909 Ga0207705_10001045 Ga0207705_1000104517 260
431 3300025909 Ga0207705_10001377 Ga0207705_100013777 260
432 3300025909 Ga0207705_10020417 Ga0207705_100204176 260
433 3300025909 Ga0207705_10022308 Ga0207705_100223082 260
434 3300025909 Ga0207705_10294428 Ga0207705_102944282 260
435 3300025911 Ga0207654_10148453 Ga0207654_101484532 260
436 3300025912 Ga0207707_10003633 Ga0207707_100036335 260
437 3300025912 Ga0207707_10049700 Ga0207707_100497004 260
438 3300025913 Ga0207695_10000588 Ga0207695_1000058856 260
439 3300025913 Ga0207695_10001701 Ga0207695_1000170128 260
440 3300025913 Ga0207695_10002955 Ga0207695_1000295512 260
441 3300025917 Ga0207660_10008170 Ga0207660_100081703 260
442 3300025917 Ga0207660_10010788 Ga0207660_100107886 260
443 3300025917 Ga0207660_10032194 Ga0207660_100321944 260
444 3300025919 Ga0207657_10004478 Ga0207657_1000447812 260
445 3300025919 Ga0207657_10015112 Ga0207657_100151124 260
446 3300025920 Ga0207649_10035547 Ga0207649_100355472 260
447 3300025921 Ga0207652_10002955 Ga0207652_100029553 260
448 3300025921 Ga0207652_10047840 Ga0207652_100478404 260
449 3300025924 Ga0207694_10000168 Ga0207694_1000016820 260
450 3300025925 Ga0207650_10123708 Ga0207650_101237082 260
451 3300025926 Ga0207659_10047537 Ga0207659_100475373 260
452 3300025940 Ga0207691_10014135 Ga0207691_100141355 260
453 3300025944 Ga0207661_10012370 Ga0207661_100123705 260
454 3300025944 Ga0207661_10012402 Ga0207661_100124024 260
455 3300025949 Ga0207667_10001475 Ga0207667_1000147515 260
456 3300025949 Ga0207667_10006386 Ga0207667_100063863 260
457 3300025981 Ga0207640_10000593 Ga0207640_1000059310 260
458 3300025981 Ga0207640_10000958 Ga0207640_100009582 260
459 3300025986 Ga0207658_10005424 Ga0207658_100054248 260
460 3300026035 Ga0207703_10080246 Ga0207703_100802462 260
461 3300026035 Ga0207703_10597678 Ga0207703_105976782 260
462 3300026041 Ga0207639_10001978 Ga0207639_100019784 260
463 3300026067 Ga0207678_10003548 Ga0207678_1000354811 260
464 3300026067 Ga0207678_10016189 Ga0207678_100161893 260
465 3300026078 Ga0207702_10001348 Ga0207702_100013485 260
466 3300026078 Ga0207702_10001815 Ga0207702_100018157 260
467 3300026089 Ga0207648_10214032 Ga0207648_102140322 260
468 3300026116 Ga0207674_10037630 Ga0207674_100376304 260
469 3300026118 Ga0207675_100188811 Ga0207675_1001888114 260
470 3300026121 Ga0207683_10320868 Ga0207683_103208682 260
471 3300026142 Ga0207698_10001252 Ga0207698_100012529 260
472 3300026142 Ga0207698_10016340 Ga0207698_100163405 260
473 3300028379 Ga0268266_10000001 Ga0268266_10000001932 260
474 3300028379 Ga0268266_10000075 Ga0268266_100000756 260
475 3300028381 Ga0268264_10079476 Ga0268264_100794763 260
476 3300028381 Ga0268264_10413772 Ga0268264_104137722 260
477 3300032004 Ga0307414_10020692 Ga0307414_100206924 260
478 3300033180 Ga0307510_10002367 Ga0307510_1000236712 260
479 3300033180 Ga0307510_10043003 Ga0307510_100430037 260
480 3300035695 Ga0373927_0171026 Ga0373927_0171026_86_901 260
481 3300037068 Ga0373925_0004492 Ga0373925_0004492_2006_2812 260
482 3300037312 Ga0395899_0000089 Ga0395899_0000089_120824_121633 260
483 3300037312 Ga0395899_0004035 Ga0395899_0004035_584_1393 260
484 3300037418 Ga0395900_0000029 Ga0395900_0000029_206249_207058 260
485 3300037466 Ga0395898_0000018 Ga0395898_0000018_89744_90553 260
486 3300037466 Ga0395898_0000241 Ga0395898_0000241_111644_112453 260
487 3300037466 Ga0395898_0029429 Ga0395898_0029429_2900_3706 260
488 3300038443 Ga0395901_0021565 Ga0395901_0021565_3141_3947 260
489 3300038443 Ga0395901_0105859 Ga0395901_0105859_1242_2051 260
490 3300038443 Ga0395901_0172895 Ga0395901_0172895_216_1025 260
491 3300042876 Ga0451577_0112809 Ga0451577_0112809_951_1754 260
492 3300044656 Ga0466969_0006829 Ga0466969_0006829_4218_5030 260
493 3300044684 Ga0466966_0021050 Ga0466966_0021050_2435_3247 260
494 3300044693 Ga0466961_0000345 Ga0466961_0000345_3512_4342 260
495 3300044693 Ga0466961_0004106 Ga0466961_0004106_5735_6556 260
496 3300044693 Ga0466961_0005564 Ga0466961_0005564_3463_4272 260
497 3300044693 Ga0466961_0012072 Ga0466961_0012072_1193_2005 260
498 3300044694 Ga0466963_0183809 Ga0466963_0183809_209_1006 260
499 3300044706 Ga0466964_0014408 Ga0466964_0014408_617_1426 260
500 3300044719 Ga0466971_0045353 Ga0466971_0045353_526_1347 260
501 3300044765 Ga0466970_0014316 Ga0466970_0014316_2068_2877 260
502 3300044765 Ga0466970_0025429 Ga0466970_0025429_1418_2230 260
503 3300044765 Ga0466970_0058137 Ga0466970_0058137_856_1668 260
504 3300044842 Ga0466957_0017384 Ga0466957_0017384_1329_2138 260
505 3300044842 Ga0466957_0049457 Ga0466957_0049457_147_968 260
506 3300045049 Ga0466959_0000148 Ga0466959_0000148_39976_40788 260
507 3300045049 Ga0466959_0002116 Ga0466959_0002116_8933_9745 260
508 3300045049 Ga0466959_0042263 Ga0466959_0042263_2017_2826 260
509 3300045051 Ga0451576_0012042 Ga0451576_0012042_6715_7521 260
510 3300045836 Ga0466958_0006082 Ga0466958_0006082_2446_3276 260
511 3300045836 Ga0466958_0008710 Ga0466958_0008710_3483_4304 260
512 3300045836 Ga0466958_0051309 Ga0466958_0051309_59_871 260
513 3300045836 Ga0466958_0079594 Ga0466958_0079594_1133_1945 260
514 3300045976 Ga0466967_0588574 Ga0466967_0588574_166_984 260
515 3300046460 Ga0495638_0000100 Ga0495638_0000100_131698_132501 260
516 3300046471 Ga0495650_0000350 Ga0495650_0000350_2988_3800 260
517 3300046507 Ga0495606_0019290 Ga0495606_0019290_1297_2094 260
518 3300046507 Ga0495606_0098211 Ga0495606_0098211_439_1251 260
519 3300046535 Ga0495586_0203576 Ga0495586_0203576_66_875 260
520 3300046539 Ga0495621_0010415 Ga0495621_0010415_1518_2339 260
521 3300046660 Ga0495625_0126762 Ga0495625_0126762_506_1315 260
522 3300048914 Ga0496111_0012685 Ga0496111_0012685_1219_2025 260
523 3300048919 Ga0496116_0041704 Ga0496116_0041704_1545_2351 260
524 3300048920 Ga0496117_0000056 Ga0496117_0000056_11145_11942 260
525 3300048921 Ga0496118_0000047 Ga0496118_0000047_259476_260273 260
526 3300048921 Ga0496118_0097839 Ga0496118_0097839_929_1738 260
527 3300048924 Ga0496121_0005984 Ga0496121_0005984_3654_4463 260
528 3300048924 Ga0496121_0023487 Ga0496121_0023487_2147_2953 260
529 3300048924 Ga0496121_0039863 Ga0496121_0039863_780_1589 260
530 3300048925 Ga0496122_0005330 Ga0496122_0005330_7624_8430 260
531 3300048926 Ga0496123_0001547 Ga0496123_0001547_19772_20578 260
532 3300048929 Ga0496126_0005938 Ga0496126_0005938_5434_6243 260
533 3300048929 Ga0496126_0202223 Ga0496126_0202223_857_1660 260
534 3300048929 Ga0496126_0211577 Ga0496126_0211577_160_963 260
535 3300049460 Ga0495682_0001690 Ga0495682_0001690_770_1567 260
536 3300049570 Ga0501033_0011789 Ga0501033_0011789_2580_3383 260
537 3300049571 Ga0501034_0046470 Ga0501034_0046470_2834_3631 260
538 3300049572 Ga0501036_0093793 Ga0501036_0093793_582_1385 260
539 3300049579 Ga0501043_0158767 Ga0501043_0158767_209_1012 260
540 3300049580 Ga0501046_0111214 Ga0501046_0111214_450_1253 260
541 3300049581 Ga0501047_0195408 Ga0501047_0195408_818_1621 260
542 3300049582 Ga0501048_0045725 Ga0501048_0045725_1276_2079 260
543 3300049585 Ga0501069_0000311 Ga0501069_0000311_402_1202 260
544 3300049585 Ga0501069_0033228 Ga0501069_0033228_1399_2196 260
545 3300049586 Ga0501070_0013742 Ga0501070_0013742_1390_2196 260
546 3300049586 Ga0501070_0052824 Ga0501070_0052824_1613_2416 260
547 3300049586 Ga0501070_0202134 Ga0501070_0202134_577_1392 260
548 3300049587 Ga0501071_0279886 Ga0501071_0279886_136_1038 260
549 3300049589 Ga0501073_0041674 Ga0501073_0041674_299_1102 260
550 3300049589 Ga0501073_0142861 Ga0501073_0142861_54_857 260
551 3300049590 Ga0501074_0026881 Ga0501074_0026881_136_1038 260
552 3300049741 Ga0501079_0208299 Ga0501079_0208299_84_893 260
553 3300049742 Ga0501080_0129633 Ga0501080_0129633_458_1261 260
554 3300049742 Ga0501080_0220634 Ga0501080_0220634_448_1251 260
555 3300049742 Ga0501080_0236532 Ga0501080_0236532_241_1056 260
556 3300049822 Ga0501035_0167333 Ga0501035_0167333_621_1424 260
557 3300049823 Ga0501044_0226598 Ga0501044_0226598_797_1699 260
558 3300050493 nmdc:mga0k408_19504_c1 nmdc:mga0k408_19504_c1_2775_3575 260
559 3300050507 nmdc:mga05p37_222849_c1 nmdc:mga05p37_222849_c1_701_1543 260
560 3300053121 Ga0500607_034153 Ga0500607_034153_1240_2043 260
561 3300053177 Ga0500636_0000139 Ga0500636_0000139_5584_6387 260
562 3300053729 Ga0500625_027477 Ga0500625_027477_1770_2576 260
563 3300053729 Ga0500625_151705 Ga0500625_151705_16_822 260
564 3300054114 Ga0501084_0547379 Ga0501084_0547379_87_887 260
565 iso_pu_bacteria 2928963466 2928965832 260

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

41

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m7o-assembly1.cif.gz_A the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. 0.851 3 252
5ad1-assembly1.cif.gz_A a complex of the synthetic siderophore analogue fe(iii)-8-licam with the ceue periplasmic protein from campylobacter jejuni 0.8385 4 252
5khl-assembly1.cif.gz_B crystal structure of periplasmic heme binding protein hutb of vibrio cholerae 0.8284 5 251
8bnw-assembly1.cif.gz_A x-ray structure of the ceue homologue from parageobacillus thermoglucosidasius - apo form 0.8276 3 252
5lwh-assembly1.cif.gz_A ceue (y288f variant) a periplasmic protein from campylobacter jejuni. 0.8273 4 252
ID Description Score Start End Superfamily
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9025 5 121 3.40.50.1980
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8831 4 121 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8826 5 121 3.40.50.1980
5y8bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8731 3 121 3.40.50.1980
5khlB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8689 5 121 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A850T0U8-F1-model_v4 ABC transporter substrate-binding protein 0.987 135 252
AF-A0A2M8E364-F1-model_v4 Cobalamin-binding protein 0.9864 135 255
AF-A0A4Q6GJA2-F1-model_v4 Cobalamin-binding protein 0.9859 135 259
AF-A0A257CXH8-F1-model_v4 Cobalamin-binding protein 0.9814 150 255
AF-A0A1G0HXH0-F1-model_v4 Cobalamin-binding protein 0.979 3 259 GO:0071281

Feature Viewer

pLDDT pTM Quality
91.35 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map