F464237
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 565 | 286 | 548 | 266 |
Family's Representative Sequence
| Representative Sequence | 3300005345|Ga0070692_10002997|Ga0070692_100029976 |
| Length | 299 |
| Sequence | MPGAFRDNERRAREGAAGAKHQGRFARDPVEIGMSYGPHRIVCLTEEPTEVLYALGEQDRIVGISGFTVRPPRARKEKPKVSAFTSAKIERILDLKPDMAIGFSDIQADIARELIKAGVEVWISNHRSVAGILAYIRRLGALVGAAEKVEAYARELEAHVERVRASGAALPRHPRVYFEEWDDPPITGIRWVAELIRIAGGEDVFPERAEQSLAKHRILSDPAEVISRQPDMILASWCGKKFQPASVAARPGWGAIPAVRNGELHEIKSPIILQPGPAALTDGLDALHAVIARWVLGGH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 2 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 3 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 4 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 5 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 6 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 7 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 8 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 9 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 10 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 11 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 12 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 13 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 14 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 15 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 16 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 17 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 175 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 176 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 177 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 180 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 190 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 191 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 192 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 265 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 279 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 280 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 282 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 283 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 285 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.58 |
| Metatranscriptomes | 1.42 |
| Isolates | 3.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.14 |
| Nodule | 0 |
| Rhizoplane | 1.95 |
| Rhizosphere | 80.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1003426 | 3300001904 | Bacteria | 2751 |
| 2 | JGI24741J21665_1000681 | 3300001915 | Bacteria | 10248 |
| 3 | JGI24741J21665_1008685 | 3300001915 | Bacteria | 1906 |
| 4 | JGI24740J21852_10002017 | 3300001979 | Bacteria | 9284 |
| 5 | JGI24740J21852_10006374 | 3300001979 | Bacteria | 4892 |
| 6 | Ga0055539_1007878 | 3300003752 | Bacteria | 1340 |
| 7 | Ga0055533_1002033 | 3300003756 | Bacteria | 4908 |
| 8 | Ga0055525_1000178 | 3300003759 | Bacteria | 79260 |
| 9 | Ga0055527_1000090 | 3300003760 | Bacteria | 71093 |
| 10 | Ga0055527_1000100 | 3300003760 | Bacteria | 63720 |
| 11 | Ga0055535_1000201 | 3300003761 | Bacteria | 63716 |
| 12 | Ga0055535_1000742 | 3300003761 | Bacteria | 24432 |
| 13 | Ga0055535_1001175 | 3300003761 | Bacteria | 15158 |
| 14 | Ga0055542_1000187 | 3300003762 | Bacteria | 76099 |
| 15 | Ga0055542_1000191 | 3300003762 | Bacteria | 74866 |
| 16 | Ga0055542_1000212 | 3300003762 | Bacteria | 71081 |
| 17 | Ga0055542_1000236 | 3300003762 | Bacteria | 63720 |
| 18 | Ga0055529_1000256 | 3300003763 | Bacteria | 63720 |
| 19 | Ga0055529_1000259 | 3300003763 | Bacteria | 63245 |
| 20 | Ga0058692_1000015 | 3300003856 | Bacteria | 295729 |
| 21 | Ga0065707_10008645 | 3300005295 | Bacteria | 2864 |
| 22 | Ga0070658_10001497 | 3300005327 | Bacteria | 19822 |
| 23 | Ga0070658_10011621 | 3300005327 | Bacteria | 7063 |
| 24 | Ga0070658_10331290 | 3300005327 | Bacteria | 1301 |
| 25 | Ga0070683_100048770 | 3300005329 | Bacteria | 3915 |
| 26 | Ga0070683_100088218 | 3300005329 | Bacteria | 2910 |
| 27 | Ga0070670_100071853 | 3300005331 | Bacteria | 2971 |
| 28 | Ga0070677_10011734 | 3300005333 | Bacteria | 3028 |
| 29 | Ga0068869_100175413 | 3300005334 | Bacteria | 1677 |
| 30 | Ga0070666_10000013 | 3300005335 | Bacteria | 230442 |
| 31 | Ga0070680_100003199 | 3300005336 | Bacteria | 12174 |
| 32 | Ga0070680_100020813 | 3300005336 | Bacteria | 5206 |
| 33 | Ga0070680_100043710 | 3300005336 | Bacteria | 3639 |
| 34 | Ga0070680_100050715 | 3300005336 | Bacteria | 3385 |
| 35 | Ga0070680_100088523 | 3300005336 | Bacteria | 2561 |
| 36 | Ga0070682_100001531 | 3300005337 | Bacteria | 12957 |
| 37 | Ga0070682_100040815 | 3300005337 | Bacteria | 2857 |
| 38 | Ga0070682_100080903 | 3300005337 | Bacteria | 2102 |
| 39 | Ga0070660_100045685 | 3300005339 | Bacteria | 3354 |
| 40 | Ga0070660_100049161 | 3300005339 | Bacteria | 3241 |
| 41 | Ga0070660_100068709 | 3300005339 | Bacteria | 2762 |
| 42 | Ga0070691_10003728 | 3300005341 | Bacteria | 6881 |
| 43 | Ga0070691_10013583 | 3300005341 | Bacteria | 3731 |
| 44 | Ga0070661_100005231 | 3300005344 | Bacteria | 8936 |
| 45 | Ga0070661_100007885 | 3300005344 | Bacteria | 7353 |
| 46 | Ga0070661_100051308 | 3300005344 | Bacteria | 3019 |
| 47 | Ga0070661_100086661 | 3300005344 | Bacteria | 2315 |
| 48 | Ga0070661_100369011 | 3300005344 | Bacteria | 1129 |
| 49 | Ga0070692_10002997 | 3300005345 | Bacteria | 6723 |
| 50 | Ga0070692_10013814 | 3300005345 | Bacteria | 3774 |
| 51 | Ga0070692_10021053 | 3300005345 | Bacteria | 3170 |
| 52 | Ga0070669_100016333 | 3300005353 | Bacteria | 5295 |
| 53 | Ga0070673_100381814 | 3300005364 | Bacteria | 1256 |
| 54 | Ga0070659_100005909 | 3300005366 | Bacteria | 8819 |
| 55 | Ga0070659_100030751 | 3300005366 | Bacteria | 4155 |
| 56 | Ga0070659_100218530 | 3300005366 | Bacteria | 1572 |
| 57 | Ga0070667_100014067 | 3300005367 | Bacteria | 6612 |
| 58 | Ga0070714_100521861 | 3300005435 | Bacteria | 1135 |
| 59 | Ga0070713_100007977 | 3300005436 | Bacteria | 7483 |
| 60 | Ga0070663_100003461 | 3300005455 | Bacteria | 9097 |
| 61 | Ga0070663_100005923 | 3300005455 | Bacteria | 7317 |
| 62 | Ga0070663_100015446 | 3300005455 | Bacteria | 4930 |
| 63 | Ga0070663_100065322 | 3300005455 | Bacteria | 2633 |
| 64 | Ga0070681_10000721 | 3300005458 | Bacteria | 27370 |
| 65 | Ga0070681_10000934 | 3300005458 | Bacteria | 24585 |
| 66 | Ga0070681_10010860 | 3300005458 | Bacteria | 9001 |
| 67 | Ga0070681_10073268 | 3300005458 | Bacteria | 3386 |
| 68 | Ga0068867_100145442 | 3300005459 | Bacteria | 1857 |
| 69 | Ga0070706_100021362 | 3300005467 | Bacteria | 5962 |
| 70 | Ga0070706_100025560 | 3300005467 | Bacteria | 5436 |
| 71 | Ga0070679_100000417 | 3300005530 | Bacteria | 36272 |
| 72 | Ga0070679_100009935 | 3300005530 | Bacteria | 9008 |
| 73 | Ga0070679_100064877 | 3300005530 | Bacteria | 3640 |
| 74 | Ga0070684_100037216 | 3300005535 | Bacteria | 4172 |
| 75 | Ga0070684_100042703 | 3300005535 | Bacteria | 3915 |
| 76 | Ga0070672_100018953 | 3300005543 | Bacteria | 4985 |
| 77 | Ga0070696_100001686 | 3300005546 | Bacteria | 14471 |
| 78 | Ga0070696_100030549 | 3300005546 | Bacteria | 3689 |
| 79 | Ga0070696_100037647 | 3300005546 | Bacteria | 3337 |
| 80 | Ga0070693_100004068 | 3300005547 | Bacteria | 6885 |
| 81 | Ga0070693_100179185 | 3300005547 | Bacteria | 1363 |
| 82 | Ga0070665_100000333 | 3300005548 | Bacteria | 72698 |
| 83 | Ga0068855_100019050 | 3300005563 | Bacteria | 8251 |
| 84 | Ga0068855_100513013 | 3300005563 | Bacteria | 1301 |
| 85 | Ga0068857_100044998 | 3300005577 | Bacteria | 3915 |
| 86 | Ga0068857_100065959 | 3300005577 | Bacteria | 3220 |
| 87 | Ga0068857_100102397 | 3300005577 | Bacteria | 2570 |
| 88 | Ga0068857_100353015 | 3300005577 | Bacteria | 1362 |
| 89 | Ga0068854_100289958 | 3300005578 | Bacteria | 1320 |
| 90 | Ga0068856_100000797 | 3300005614 | Bacteria | 33958 |
| 91 | Ga0068856_100005119 | 3300005614 | Bacteria | 12956 |
| 92 | Ga0068856_100064205 | 3300005614 | Bacteria | 3628 |
| 93 | Ga0068852_100040728 | 3300005616 | Bacteria | 3921 |
| 94 | Ga0068852_100149769 | 3300005616 | Bacteria | 2169 |
| 95 | Ga0068852_100377819 | 3300005616 | Bacteria | 1389 |
| 96 | Ga0068859_100107681 | 3300005617 | Bacteria | 2848 |
| 97 | Ga0068859_100418112 | 3300005617 | Bacteria | 1437 |
| 98 | Ga0068866_10052177 | 3300005718 | Bacteria | 2086 |
| 99 | Ga0068861_100572039 | 3300005719 | Bacteria | 1033 |
| 100 | Ga0068851_10075389 | 3300005834 | Bacteria | 1753 |
| 101 | Ga0068860_100097736 | 3300005843 | Bacteria | 2799 |
| 102 | Ga0068860_100105639 | 3300005843 | Bacteria | 2689 |
| 103 | Ga0068862_100012901 | 3300005844 | Bacteria | 6911 |
| 104 | Ga0081455_10132185 | 3300005937 | Bacteria | 1950 |
| 105 | Ga0075366_10077823 | 3300006195 | Bacteria | 1979 |
| 106 | Ga0075434_100016515 | 3300006871 | Bacteria | 7097 |
| 107 | Ga0097620_100107684 | 3300006931 | Bacteria | 2848 |
| 108 | Ga0097620_100418080 | 3300006931 | Bacteria | 1437 |
| 109 | Ga0075435_100026633 | 3300007076 | Bacteria | 4514 |
| 110 | Ga0105240_10007819 | 3300009093 | Bacteria | 15439 |
| 111 | Ga0105240_10009451 | 3300009093 | Bacteria | 13801 |
| 112 | Ga0105240_10103339 | 3300009093 | Bacteria | 3462 |
| 113 | Ga0111539_10518133 | 3300009094 | Bacteria | 1389 |
| 114 | Ga0105245_10215208 | 3300009098 | Bacteria | 1851 |
| 115 | Ga0105247_10001072 | 3300009101 | Bacteria | 20420 |
| 116 | Ga0105243_10186949 | 3300009148 | Bacteria | 1806 |
| 117 | Ga0105241_10059458 | 3300009174 | Bacteria | 2939 |
| 118 | Ga0105241_10119003 | 3300009174 | Bacteria | 2124 |
| 119 | Ga0105241_10129926 | 3300009174 | Bacteria | 2038 |
| 120 | Ga0105237_10337884 | 3300009545 | Bacteria | 1510 |
| 121 | Ga0105238_10000131 | 3300009551 | Bacteria | 82050 |
| 122 | Ga0105238_10254080 | 3300009551 | Bacteria | 1736 |
| 123 | Ga0105238_10310634 | 3300009551 | Bacteria | 1561 |
| 124 | Ga0105239_10000023 | 3300010375 | Bacteria | 257478 |
| 125 | Ga0105239_10026540 | 3300010375 | Bacteria | 6374 |
| 126 | Ga0105246_10157009 | 3300011119 | Bacteria | 1729 |
| 127 | Ga0157373_10006081 | 3300013100 | Bacteria | 9025 |
| 128 | Ga0157373_10057143 | 3300013100 | Bacteria | 2768 |
| 129 | Ga0157371_10011947 | 3300013102 | Bacteria | 6659 |
| 130 | Ga0157371_10058745 | 3300013102 | Bacteria | 2728 |
| 131 | Ga0157371_10064205 | 3300013102 | Bacteria | 2601 |
| 132 | Ga0157370_10015411 | 3300013104 | Bacteria | 7768 |
| 133 | Ga0157370_10028755 | 3300013104 | Bacteria | 5466 |
| 134 | Ga0157370_10112207 | 3300013104 | Bacteria | 2548 |
| 135 | Ga0157370_10433451 | 3300013104 | Bacteria | 1209 |
| 136 | Ga0157369_10003442 | 3300013105 | Bacteria | 18769 |
| 137 | Ga0157369_10036017 | 3300013105 | Bacteria | 5424 |
| 138 | Ga0157369_10278688 | 3300013105 | Bacteria | 1741 |
| 139 | Ga0163162_10095092 | 3300013306 | Bacteria | 3066 |
| 140 | Ga0163162_10098108 | 3300013306 | Bacteria | 3019 |
| 141 | Ga0157372_10002979 | 3300013307 | Bacteria | 18241 |
| 142 | Ga0157372_10027202 | 3300013307 | Bacteria | 6226 |
| 143 | Ga0157372_10077002 | 3300013307 | Bacteria | 3766 |
| 144 | Ga0157372_10290878 | 3300013307 | Bacteria | 1900 |
| 145 | Ga0157380_10176236 | 3300014326 | Bacteria | 1874 |
| 146 | Ga0182008_10010199 | 3300014497 | Bacteria | 5034 |
| 147 | Ga0157379_10041041 | 3300014968 | Bacteria | 4130 |
| 148 | Ga0157379_10172101 | 3300014968 | Bacteria | 1955 |
| 149 | Ga0182006_1000030 | 3300015261 | Bacteria | 242894 |
| 150 | Ga0182006_1000062 | 3300015261 | Bacteria | 155622 |
| 151 | Ga0182007_10000803 | 3300015262 | Bacteria | 17533 |
| 152 | Ga0182007_10007098 | 3300015262 | Bacteria | 4739 |
| 153 | Ga0182005_1000021 | 3300015265 | Bacteria | 272185 |
| 154 | Ga0182005_1000035 | 3300015265 | Bacteria | 172168 |
| 155 | Ga0182005_1015987 | 3300015265 | Bacteria | 2089 |
| 156 | Ga0163161_10032533 | 3300017792 | Bacteria | 3724 |
| 157 | Ga0163161_10195764 | 3300017792 | Bacteria | 1556 |
| 158 | Ga0197907_10056721 | 3300020069 | Bacteria | 2834 |
| 159 | Ga0206356_10103483 | 3300020070 | Bacteria | 5254 |
| 160 | Ga0206356_11014676 | 3300020070 | Bacteria | 1923 |
| 161 | Ga0206356_11464199 | 3300020070 | Bacteria | 5935 |
| 162 | Ga0206354_10181591 | 3300020081 | Bacteria | 1740 |
| 163 | Ga0206353_10124593 | 3300020082 | Bacteria | 3101 |
| 164 | Ga0154015_1046164 | 3300020610 | Bacteria | 5505 |
| 165 | Ga0154015_1409760 | 3300020610 | Bacteria | 1979 |
| 166 | Ga0209674_100140 | 3300025226 | Bacteria | 109152 |
| 167 | Ga0209674_100373 | 3300025226 | Bacteria | 24523 |
| 168 | Ga0209674_101464 | 3300025226 | Bacteria | 6187 |
| 169 | Ga0209672_100016 | 3300025228 | Bacteria | 522604 |
| 170 | Ga0209672_101550 | 3300025228 | Bacteria | 7904 |
| 171 | Ga0209437_100270 | 3300025233 | Bacteria | 78319 |
| 172 | Ga0209258_100012 | 3300025242 | Bacteria | 825544 |
| 173 | Ga0209258_100316 | 3300025242 | Bacteria | 74911 |
| 174 | Ga0209258_105374 | 3300025242 | Bacteria | 2187 |
| 175 | Ga0209026_1000117 | 3300025250 | Bacteria | 131918 |
| 176 | Ga0209026_1000139 | 3300025250 | Bacteria | 115298 |
| 177 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 178 | Ga0209148_1000014 | 3300025254 | Bacteria | 925277 |
| 179 | Ga0209148_1000244 | 3300025254 | Bacteria | 86833 |
| 180 | Ga0209129_1001466 | 3300025258 | Bacteria | 13159 |
| 181 | Ga0209233_1025529 | 3300025261 | Bacteria | 1460 |
| 182 | Ga0209455_1000014 | 3300025272 | Bacteria | 806601 |
| 183 | Ga0209455_1003988 | 3300025272 | Bacteria | 5004 |
| 184 | Ga0209758_1016770 | 3300025297 | Bacteria | 3699 |
| 185 | Ga0209050_1050163 | 3300025298 | Bacteria | 1063 |
| 186 | Ga0209256_1028698 | 3300025299 | Bacteria | 1565 |
| 187 | Ga0209257_1005084 | 3300025304 | Bacteria | 9552 |
| 188 | Ga0207682_10045555 | 3300025893 | Bacteria | 1800 |
| 189 | Ga0207710_10041760 | 3300025900 | Bacteria | 2035 |
| 190 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 191 | Ga0207647_10000191 | 3300025904 | Bacteria | 49647 |
| 192 | Ga0207647_10003903 | 3300025904 | Bacteria | 11137 |
| 193 | Ga0207647_10005977 | 3300025904 | Bacteria | 8866 |
| 194 | Ga0207647_10024124 | 3300025904 | Bacteria | 4012 |
| 195 | Ga0207645_10204939 | 3300025907 | Bacteria | 1298 |
| 196 | Ga0207643_10105992 | 3300025908 | Bacteria | 1652 |
| 197 | Ga0207705_10001045 | 3300025909 | Bacteria | 22516 |
| 198 | Ga0207705_10001377 | 3300025909 | Bacteria | 19399 |
| 199 | Ga0207705_10002025 | 3300025909 | Bacteria | 15772 |
| 200 | Ga0207705_10020417 | 3300025909 | Bacteria | 4734 |
| 201 | Ga0207705_10022308 | 3300025909 | Bacteria | 4515 |
| 202 | Ga0207705_10294428 | 3300025909 | Bacteria | 1244 |
| 203 | Ga0207684_10078191 | 3300025910 | Bacteria | 2813 |
| 204 | Ga0207684_10178836 | 3300025910 | Bacteria | 1829 |
| 205 | Ga0207654_10058208 | 3300025911 | Bacteria | 2249 |
| 206 | Ga0207654_10148453 | 3300025911 | Bacteria | 1502 |
| 207 | Ga0207707_10000106 | 3300025912 | Bacteria | 83040 |
| 208 | Ga0207707_10000179 | 3300025912 | Bacteria | 66039 |
| 209 | Ga0207707_10000812 | 3300025912 | Bacteria | 30590 |
| 210 | Ga0207707_10002026 | 3300025912 | Bacteria | 18400 |
| 211 | Ga0207707_10003633 | 3300025912 | Bacteria | 13677 |
| 212 | Ga0207707_10003702 | 3300025912 | Bacteria | 13548 |
| 213 | Ga0207707_10013685 | 3300025912 | Bacteria | 7076 |
| 214 | Ga0207707_10049700 | 3300025912 | Bacteria | 3653 |
| 215 | Ga0207695_10000588 | 3300025913 | Bacteria | 73260 |
| 216 | Ga0207695_10001370 | 3300025913 | Bacteria | 41340 |
| 217 | Ga0207695_10001701 | 3300025913 | Bacteria | 35229 |
| 218 | Ga0207695_10002955 | 3300025913 | Bacteria | 24524 |
| 219 | Ga0207695_10005835 | 3300025913 | Bacteria | 16192 |
| 220 | Ga0207695_10055585 | 3300025913 | Bacteria | 4124 |
| 221 | Ga0207695_10191438 | 3300025913 | Bacteria | 1963 |
| 222 | Ga0207671_10253550 | 3300025914 | Bacteria | 1383 |
| 223 | Ga0207660_10000747 | 3300025917 | Bacteria | 21615 |
| 224 | Ga0207660_10004214 | 3300025917 | Bacteria | 9364 |
| 225 | Ga0207660_10005475 | 3300025917 | Bacteria | 8246 |
| 226 | Ga0207660_10008170 | 3300025917 | Bacteria | 6771 |
| 227 | Ga0207660_10010788 | 3300025917 | Bacteria | 5938 |
| 228 | Ga0207660_10032194 | 3300025917 | Bacteria | 3618 |
| 229 | Ga0207657_10004478 | 3300025919 | Bacteria | 14774 |
| 230 | Ga0207657_10010355 | 3300025919 | Bacteria | 9307 |
| 231 | Ga0207657_10015112 | 3300025919 | Bacteria | 7497 |
| 232 | Ga0207657_10015691 | 3300025919 | Bacteria | 7327 |
| 233 | Ga0207657_10195262 | 3300025919 | Bacteria | 1631 |
| 234 | Ga0207649_10002754 | 3300025920 | Bacteria | 9733 |
| 235 | Ga0207649_10035547 | 3300025920 | Bacteria | 2994 |
| 236 | Ga0207649_10325738 | 3300025920 | Bacteria | 1130 |
| 237 | Ga0207652_10000442 | 3300025921 | Bacteria | 42938 |
| 238 | Ga0207652_10000894 | 3300025921 | Bacteria | 28219 |
| 239 | Ga0207652_10001820 | 3300025921 | Bacteria | 18481 |
| 240 | Ga0207652_10002955 | 3300025921 | Bacteria | 14205 |
| 241 | Ga0207652_10003323 | 3300025921 | Bacteria | 13319 |
| 242 | Ga0207652_10041141 | 3300025921 | Bacteria | 3927 |
| 243 | Ga0207652_10047840 | 3300025921 | Bacteria | 3654 |
| 244 | Ga0207646_10036569 | 3300025922 | Bacteria | 4431 |
| 245 | Ga0207681_10515256 | 3300025923 | Bacteria | 981 |
| 246 | Ga0207694_10000168 | 3300025924 | Bacteria | 67647 |
| 247 | Ga0207694_10083941 | 3300025924 | Bacteria | 2505 |
| 248 | Ga0207694_10091345 | 3300025924 | Bacteria | 2403 |
| 249 | Ga0207650_10071522 | 3300025925 | Bacteria | 2610 |
| 250 | Ga0207650_10123708 | 3300025925 | Bacteria | 2017 |
| 251 | Ga0207659_10047537 | 3300025926 | Bacteria | 3036 |
| 252 | Ga0207687_10122655 | 3300025927 | Bacteria | 1946 |
| 253 | Ga0207687_10422199 | 3300025927 | Bacteria | 1101 |
| 254 | Ga0207700_10211276 | 3300025928 | Bacteria | 1641 |
| 255 | Ga0207644_10394141 | 3300025931 | Bacteria | 1131 |
| 256 | Ga0207690_10000869 | 3300025932 | Bacteria | 19295 |
| 257 | Ga0207690_10282058 | 3300025932 | Bacteria | 1294 |
| 258 | Ga0207706_10004745 | 3300025933 | Bacteria | 12726 |
| 259 | Ga0207665_10204550 | 3300025939 | Bacteria | 1440 |
| 260 | Ga0207691_10014135 | 3300025940 | Bacteria | 7616 |
| 261 | Ga0207661_10012370 | 3300025944 | Bacteria | 6199 |
| 262 | Ga0207661_10012402 | 3300025944 | Bacteria | 6192 |
| 263 | Ga0207661_10034544 | 3300025944 | Bacteria | 3933 |
| 264 | Ga0207667_10001475 | 3300025949 | Bacteria | 29510 |
| 265 | Ga0207667_10002217 | 3300025949 | Bacteria | 24401 |
| 266 | Ga0207667_10006386 | 3300025949 | Bacteria | 14293 |
| 267 | Ga0207667_10008576 | 3300025949 | Bacteria | 12133 |
| 268 | Ga0207667_10020975 | 3300025949 | Bacteria | 7246 |
| 269 | Ga0207640_10000480 | 3300025981 | Bacteria | 24361 |
| 270 | Ga0207640_10000593 | 3300025981 | Bacteria | 21569 |
| 271 | Ga0207640_10000958 | 3300025981 | Bacteria | 16038 |
| 272 | Ga0207658_10005424 | 3300025986 | Bacteria | 8744 |
| 273 | Ga0207677_10349409 | 3300026023 | Bacteria | 1238 |
| 274 | Ga0207703_10080246 | 3300026035 | Bacteria | 2717 |
| 275 | Ga0207703_10127815 | 3300026035 | Bacteria | 2190 |
| 276 | Ga0207703_10597678 | 3300026035 | Bacteria | 1043 |
| 277 | Ga0207639_10001978 | 3300026041 | Bacteria | 13788 |
| 278 | Ga0207639_10005834 | 3300026041 | Bacteria | 8343 |
| 279 | Ga0207639_10483319 | 3300026041 | Bacteria | 1129 |
| 280 | Ga0207678_10002935 | 3300026067 | Bacteria | 15447 |
| 281 | Ga0207678_10003548 | 3300026067 | Bacteria | 14030 |
| 282 | Ga0207678_10012596 | 3300026067 | Bacteria | 7429 |
| 283 | Ga0207678_10013161 | 3300026067 | Bacteria | 7258 |
| 284 | Ga0207678_10016189 | 3300026067 | Bacteria | 6545 |
| 285 | Ga0207678_10039903 | 3300026067 | Bacteria | 4072 |
| 286 | Ga0207702_10001248 | 3300026078 | Bacteria | 25656 |
| 287 | Ga0207702_10001348 | 3300026078 | Bacteria | 24485 |
| 288 | Ga0207702_10001815 | 3300026078 | Bacteria | 21008 |
| 289 | Ga0207648_10214032 | 3300026089 | Bacteria | 1711 |
| 290 | Ga0207674_10005152 | 3300026116 | Bacteria | 15581 |
| 291 | Ga0207674_10019922 | 3300026116 | Bacteria | 7259 |
| 292 | Ga0207674_10037630 | 3300026116 | Bacteria | 5030 |
| 293 | Ga0207674_10214714 | 3300026116 | Bacteria | 1872 |
| 294 | Ga0207674_10458873 | 3300026116 | Bacteria | 1231 |
| 295 | Ga0207675_100188811 | 3300026118 | Bacteria | 1976 |
| 296 | Ga0207683_10320868 | 3300026121 | Bacteria | 1419 |
| 297 | Ga0207698_10001252 | 3300026142 | Bacteria | 14849 |
| 298 | Ga0207698_10016340 | 3300026142 | Bacteria | 4999 |
| 299 | Ga0207698_10040295 | 3300026142 | Bacteria | 3469 |
| 300 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 301 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 302 | Ga0268266_10000075 | 3300028379 | Bacteria | 218045 |
| 303 | Ga0268264_10079476 | 3300028381 | Bacteria | 2798 |
| 304 | Ga0268264_10413772 | 3300028381 | Bacteria | 1299 |
| 305 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 306 | Ga0307513_10055696 | 3300031456 | Bacteria | 4229 |
| 307 | Ga0307414_10020692 | 3300032004 | Bacteria | 4107 |
| 308 | Ga0307415_100512429 | 3300032126 | Bacteria | 1051 |
| 309 | Ga0307510_10002367 | 3300033180 | Bacteria | 21348 |
| 310 | Ga0307510_10043003 | 3300033180 | Bacteria | 4915 |
| 311 | Ga0373959_0038111 | 3300034820 | Bacteria | 998 |
| 312 | Ga0373927_0171026 | 3300035695 | Bacteria | 1424 |
| 313 | Ga0373933_0333883 | 3300035724 | Bacteria | 983 |
| 314 | Ga0373925_0004492 | 3300037068 | Bacteria | 10541 |
| 315 | Ga0395899_0000089 | 3300037312 | Bacteria | 156851 |
| 316 | Ga0395899_0004035 | 3300037312 | Bacteria | 11579 |
| 317 | Ga0395899_0012531 | 3300037312 | Bacteria | 6498 |
| 318 | Ga0395899_0073664 | 3300037312 | Bacteria | 2496 |
| 319 | Ga0395899_0156525 | 3300037312 | Bacteria | 1612 |
| 320 | Ga0395900_0000029 | 3300037418 | Bacteria | 281061 |
| 321 | Ga0395900_0060933 | 3300037418 | Bacteria | 3881 |
| 322 | Ga0395900_0076239 | 3300037418 | Bacteria | 3446 |
| 323 | Ga0395900_0318405 | 3300037418 | Bacteria | 1536 |
| 324 | Ga0395898_0000018 | 3300037466 | Bacteria | 418600 |
| 325 | Ga0395898_0000241 | 3300037466 | Bacteria | 138133 |
| 326 | Ga0395898_0029429 | 3300037466 | Bacteria | 5502 |
| 327 | Ga0395898_0042982 | 3300037466 | Bacteria | 4454 |
| 328 | Ga0395898_0318993 | 3300037466 | Bacteria | 1482 |
| 329 | Ga0395905_0050410 | 3300037471 | Bacteria | 3900 |
| 330 | Ga0395901_0003835 | 3300038443 | Bacteria | 15156 |
| 331 | Ga0395901_0021565 | 3300038443 | Bacteria | 6600 |
| 332 | Ga0395901_0062534 | 3300038443 | Bacteria | 3873 |
| 333 | Ga0395901_0105859 | 3300038443 | Bacteria | 2952 |
| 334 | Ga0395901_0172895 | 3300038443 | Bacteria | 2266 |
| 335 | Ga0395901_0271045 | 3300038443 | Bacteria | 1765 |
| 336 | Ga0395901_0307808 | 3300038443 | Bacteria | 1641 |
| 337 | Ga0439436_0016966 | 3300041404 | Bacteria | 2181 |
| 338 | Ga0439465_0000557 | 3300041413 | Bacteria | 11216 |
| 339 | Ga0439449_0000004 | 3300042007 | Bacteria | 82454 |
| 340 | Ga0451577_0112809 | 3300042876 | Bacteria | 2433 |
| 341 | Ga0466969_0006829 | 3300044656 | Bacteria | 6071 |
| 342 | Ga0466969_0031842 | 3300044656 | Bacteria | 2683 |
| 343 | Ga0466972_0018206 | 3300044658 | Bacteria | 3514 |
| 344 | Ga0466982_0000018 | 3300044672 | Bacteria | 113912 |
| 345 | Ga0466966_0010735 | 3300044684 | Bacteria | 6090 |
| 346 | Ga0466966_0021050 | 3300044684 | Bacteria | 4283 |
| 347 | Ga0466961_0000345 | 3300044693 | Bacteria | 30306 |
| 348 | Ga0466961_0004106 | 3300044693 | Bacteria | 9090 |
| 349 | Ga0466961_0005564 | 3300044693 | Bacteria | 7952 |
| 350 | Ga0466961_0012072 | 3300044693 | Bacteria | 5520 |
| 351 | Ga0466963_0183809 | 3300044694 | Bacteria | 1460 |
| 352 | Ga0466964_0014408 | 3300044706 | Bacteria | 3006 |
| 353 | Ga0466971_0045353 | 3300044719 | Bacteria | 1974 |
| 354 | Ga0466970_0014316 | 3300044765 | Bacteria | 4070 |
| 355 | Ga0466970_0025429 | 3300044765 | Bacteria | 3099 |
| 356 | Ga0466970_0058137 | 3300044765 | Bacteria | 2069 |
| 357 | Ga0466957_0017384 | 3300044842 | Bacteria | 4210 |
| 358 | Ga0466957_0049457 | 3300044842 | Bacteria | 2556 |
| 359 | Ga0466959_0000148 | 3300045049 | Bacteria | 45981 |
| 360 | Ga0466959_0002116 | 3300045049 | Bacteria | 12562 |
| 361 | Ga0466959_0042263 | 3300045049 | Bacteria | 3361 |
| 362 | Ga0451576_0012042 | 3300045051 | Bacteria | 9764 |
| 363 | Ga0466958_0006082 | 3300045836 | Bacteria | 6543 |
| 364 | Ga0466958_0008710 | 3300045836 | Bacteria | 5632 |
| 365 | Ga0466958_0051309 | 3300045836 | Bacteria | 2497 |
| 366 | Ga0466958_0079594 | 3300045836 | Bacteria | 2015 |
| 367 | Ga0466967_0588574 | 3300045976 | Bacteria | 1097 |
| 368 | Ga0495617_000035 | 3300046452 | Bacteria | 145195 |
| 369 | Ga0495638_0000059 | 3300046460 | Bacteria | 191461 |
| 370 | Ga0495638_0000100 | 3300046460 | Bacteria | 139296 |
| 371 | Ga0495638_0073912 | 3300046460 | Bacteria | 2079 |
| 372 | Ga0495650_0000350 | 3300046471 | Bacteria | 81541 |
| 373 | Ga0495650_0000496 | 3300046471 | Bacteria | 59706 |
| 374 | Ga0495650_0011152 | 3300046471 | Bacteria | 4951 |
| 375 | Ga0495605_0059099 | 3300046474 | Bacteria | 1842 |
| 376 | Ga0495639_0007327 | 3300046475 | Bacteria | 4734 |
| 377 | Ga0495662_0008401 | 3300046476 | Bacteria | 5078 |
| 378 | Ga0495584_0011251 | 3300046491 | Bacteria | 4583 |
| 379 | Ga0495585_0003949 | 3300046492 | Bacteria | 9802 |
| 380 | Ga0495607_0000012 | 3300046501 | Bacteria | 195369 |
| 381 | Ga0495607_0000121 | 3300046501 | Bacteria | 82194 |
| 382 | Ga0495607_0017066 | 3300046501 | Bacteria | 4671 |
| 383 | Ga0495583_0005586 | 3300046506 | Bacteria | 8482 |
| 384 | Ga0495606_0000490 | 3300046507 | Bacteria | 64820 |
| 385 | Ga0495606_0000928 | 3300046507 | Bacteria | 43190 |
| 386 | Ga0495606_0008792 | 3300046507 | Bacteria | 8672 |
| 387 | Ga0495606_0009149 | 3300046507 | Bacteria | 8430 |
| 388 | Ga0495606_0019290 | 3300046507 | Bacteria | 5079 |
| 389 | Ga0495606_0084407 | 3300046507 | Bacteria | 1967 |
| 390 | Ga0495606_0098211 | 3300046507 | Bacteria | 1787 |
| 391 | Ga0495610_0017809 | 3300046512 | Bacteria | 4038 |
| 392 | Ga0495616_0000027 | 3300046513 | Bacteria | 136712 |
| 393 | Ga0495620_0001953 | 3300046515 | Bacteria | 12076 |
| 394 | Ga0495620_0002406 | 3300046515 | Bacteria | 10839 |
| 395 | Ga0495630_0000001 | 3300046517 | Bacteria | 1687293 |
| 396 | Ga0495631_0000249 | 3300046518 | Bacteria | 37329 |
| 397 | Ga0495631_0000916 | 3300046518 | Bacteria | 18359 |
| 398 | Ga0495632_0000019 | 3300046519 | Bacteria | 215713 |
| 399 | Ga0495632_0030754 | 3300046519 | Bacteria | 2783 |
| 400 | Ga0495637_0005961 | 3300046520 | Bacteria | 6164 |
| 401 | Ga0495648_0005506 | 3300046524 | Bacteria | 10504 |
| 402 | Ga0495648_0006579 | 3300046524 | Bacteria | 9449 |
| 403 | Ga0495586_0203576 | 3300046535 | Bacteria | 1122 |
| 404 | Ga0495609_0006069 | 3300046538 | Bacteria | 6220 |
| 405 | Ga0495621_0010415 | 3300046539 | Bacteria | 2843 |
| 406 | Ga0495668_0024046 | 3300046616 | Bacteria | 3467 |
| 407 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 408 | Ga0495611_0000027 | 3300046648 | Bacteria | 116663 |
| 409 | Ga0495625_0000037 | 3300046660 | Bacteria | 219383 |
| 410 | Ga0495625_0072075 | 3300046660 | Bacteria | 2423 |
| 411 | Ga0495625_0126762 | 3300046660 | Bacteria | 1732 |
| 412 | Ga0495661_0001009 | 3300046665 | Bacteria | 25232 |
| 413 | Ga0495588_0204212 | 3300046674 | Bacteria | 1044 |
| 414 | Ga0495670_0001266 | 3300046691 | Bacteria | 12354 |
| 415 | Ga0495670_0017154 | 3300046691 | Bacteria | 3562 |
| 416 | Ga0495589_0001848 | 3300046794 | Bacteria | 12006 |
| 417 | Ga0495660_0000869 | 3300046810 | Bacteria | 22335 |
| 418 | Ga0495660_0000936 | 3300046810 | Bacteria | 21389 |
| 419 | Ga0495683_0001081 | 3300047323 | Bacteria | 18850 |
| 420 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 421 | Ga0495673_0000010 | 3300047469 | Bacteria | 709599 |
| 422 | Ga0495673_0000072 | 3300047469 | Bacteria | 213166 |
| 423 | Ga0495673_0000497 | 3300047469 | Bacteria | 42003 |
| 424 | Ga0495681_0035180 | 3300047470 | Bacteria | 2489 |
| 425 | Ga0495686_0000410 | 3300047472 | Bacteria | 67863 |
| 426 | Ga0495686_0015787 | 3300047472 | Bacteria | 5140 |
| 427 | Ga0495686_0164192 | 3300047472 | Bacteria | 1295 |
| 428 | Ga0496100_0008035 | 3300048903 | Bacteria | 5863 |
| 429 | Ga0496100_0069002 | 3300048903 | Bacteria | 2353 |
| 430 | Ga0496101_0013541 | 3300048904 | Bacteria | 5468 |
| 431 | Ga0496102_0504999 | 3300048905 | Bacteria | 1131 |
| 432 | Ga0496104_0091669 | 3300048907 | Bacteria | 2905 |
| 433 | Ga0496105_0049796 | 3300048908 | Bacteria | 3460 |
| 434 | Ga0496106_0005129 | 3300048909 | Bacteria | 9707 |
| 435 | Ga0496106_0185210 | 3300048909 | Bacteria | 1654 |
| 436 | Ga0496109_0592727 | 3300048912 | Bacteria | 1044 |
| 437 | Ga0496111_0012685 | 3300048914 | Bacteria | 5712 |
| 438 | Ga0496116_0041704 | 3300048919 | Bacteria | 3146 |
| 439 | Ga0496116_0049201 | 3300048919 | Bacteria | 2822 |
| 440 | Ga0496117_0000056 | 3300048920 | Bacteria | 271417 |
| 441 | Ga0496117_0008972 | 3300048920 | Bacteria | 9411 |
| 442 | Ga0496117_0038404 | 3300048920 | Bacteria | 3550 |
| 443 | Ga0496118_0000047 | 3300048921 | Bacteria | 271417 |
| 444 | Ga0496118_0008700 | 3300048921 | Bacteria | 10430 |
| 445 | Ga0496118_0014826 | 3300048921 | Bacteria | 7268 |
| 446 | Ga0496118_0097839 | 3300048921 | Bacteria | 1995 |
| 447 | Ga0496119_0000182 | 3300048922 | Bacteria | 87907 |
| 448 | Ga0496120_0000661 | 3300048923 | Bacteria | 50628 |
| 449 | Ga0496121_0000419 | 3300048924 | Bacteria | 84137 |
| 450 | Ga0496121_0001210 | 3300048924 | Bacteria | 45020 |
| 451 | Ga0496121_0002943 | 3300048924 | Bacteria | 24885 |
| 452 | Ga0496121_0005984 | 3300048924 | Bacteria | 15367 |
| 453 | Ga0496121_0023487 | 3300048924 | Bacteria | 5936 |
| 454 | Ga0496121_0039863 | 3300048924 | Bacteria | 4131 |
| 455 | Ga0496121_0045798 | 3300048924 | Bacteria | 3753 |
| 456 | Ga0496122_0005330 | 3300048925 | Bacteria | 15377 |
| 457 | Ga0496122_0013398 | 3300048925 | Bacteria | 8029 |
| 458 | Ga0496122_0024832 | 3300048925 | Bacteria | 5233 |
| 459 | Ga0496122_0030266 | 3300048925 | Bacteria | 4541 |
| 460 | Ga0496123_0001547 | 3300048926 | Bacteria | 31705 |
| 461 | Ga0496123_0014233 | 3300048926 | Bacteria | 6612 |
| 462 | Ga0496123_0020466 | 3300048926 | Bacteria | 5174 |
| 463 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 464 | Ga0496124_0001002 | 3300048927 | Bacteria | 44773 |
| 465 | Ga0496124_0002574 | 3300048927 | Bacteria | 23511 |
| 466 | Ga0496125_0017071 | 3300048928 | Bacteria | 6935 |
| 467 | Ga0496126_0004479 | 3300048929 | Bacteria | 16675 |
| 468 | Ga0496126_0005938 | 3300048929 | Bacteria | 13757 |
| 469 | Ga0496126_0202223 | 3300048929 | Bacteria | 1677 |
| 470 | Ga0496126_0211577 | 3300048929 | Bacteria | 1632 |
| 471 | Ga0496126_0254915 | 3300048929 | Bacteria | 1461 |
| 472 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 473 | Ga0495682_0001690 | 3300049460 | Bacteria | 11247 |
| 474 | Ga0495682_0001819 | 3300049460 | Bacteria | 10718 |
| 475 | Ga0501290_001765 | 3300049513 | Bacteria | 2885 |
| 476 | Ga0501032_0033291 | 3300049569 | Bacteria | 3531 |
| 477 | Ga0501032_0051863 | 3300049569 | Bacteria | 2765 |
| 478 | Ga0501033_0000430 | 3300049570 | Bacteria | 40189 |
| 479 | Ga0501033_0011789 | 3300049570 | Bacteria | 6681 |
| 480 | Ga0501033_0090119 | 3300049570 | Bacteria | 2243 |
| 481 | Ga0501034_0000305 | 3300049571 | Bacteria | 87329 |
| 482 | Ga0501034_0023429 | 3300049571 | Bacteria | 6291 |
| 483 | Ga0501034_0046470 | 3300049571 | Bacteria | 4386 |
| 484 | Ga0501034_0550362 | 3300049571 | Bacteria | 1063 |
| 485 | Ga0501036_0093793 | 3300049572 | Bacteria | 2536 |
| 486 | Ga0501038_0244153 | 3300049574 | Bacteria | 1425 |
| 487 | Ga0501043_0045728 | 3300049579 | Bacteria | 3442 |
| 488 | Ga0501043_0058971 | 3300049579 | Bacteria | 3012 |
| 489 | Ga0501043_0158767 | 3300049579 | Bacteria | 1767 |
| 490 | Ga0501046_0111214 | 3300049580 | Bacteria | 2092 |
| 491 | Ga0501046_0136361 | 3300049580 | Bacteria | 1859 |
| 492 | Ga0501047_0041830 | 3300049581 | Bacteria | 4427 |
| 493 | Ga0501047_0110824 | 3300049581 | Bacteria | 2627 |
| 494 | Ga0501047_0195408 | 3300049581 | Bacteria | 1885 |
| 495 | Ga0501047_0231459 | 3300049581 | Bacteria | 1701 |
| 496 | Ga0501048_0045725 | 3300049582 | Bacteria | 3126 |
| 497 | Ga0501069_0000311 | 3300049585 | Bacteria | 22175 |
| 498 | Ga0501069_0033228 | 3300049585 | Bacteria | 2841 |
| 499 | Ga0501070_0000265 | 3300049586 | Bacteria | 49246 |
| 500 | Ga0501070_0008054 | 3300049586 | Bacteria | 8919 |
| 501 | Ga0501070_0013742 | 3300049586 | Bacteria | 6819 |
| 502 | Ga0501070_0028719 | 3300049586 | Bacteria | 4663 |
| 503 | Ga0501070_0052824 | 3300049586 | Bacteria | 3372 |
| 504 | Ga0501070_0202134 | 3300049586 | Bacteria | 1631 |
| 505 | Ga0501070_0223592 | 3300049586 | Bacteria | 1543 |
| 506 | Ga0501071_0279886 | 3300049587 | Bacteria | 1262 |
| 507 | Ga0501073_0028016 | 3300049589 | Bacteria | 4024 |
| 508 | Ga0501073_0041674 | 3300049589 | Bacteria | 3244 |
| 509 | Ga0501073_0142861 | 3300049589 | Bacteria | 1658 |
| 510 | Ga0501074_0026881 | 3300049590 | Bacteria | 4170 |
| 511 | Ga0501074_0029623 | 3300049590 | Bacteria | 3965 |
| 512 | Ga0501074_0138312 | 3300049590 | Bacteria | 1742 |
| 513 | Ga0501077_0003192 | 3300049593 | Bacteria | 9878 |
| 514 | Ga0501225_0004969 | 3300049705 | Bacteria | 3928 |
| 515 | Ga0501079_0208299 | 3300049741 | Bacteria | 1527 |
| 516 | Ga0501080_0042006 | 3300049742 | Bacteria | 4259 |
| 517 | Ga0501080_0129633 | 3300049742 | Bacteria | 2334 |
| 518 | Ga0501080_0220634 | 3300049742 | Bacteria | 1735 |
| 519 | Ga0501080_0236532 | 3300049742 | Bacteria | 1668 |
| 520 | Ga0501081_0044032 | 3300049743 | Bacteria | 3063 |
| 521 | Ga0501275_000109 | 3300049772 | Bacteria | 8688 |
| 522 | Ga0501035_0001879 | 3300049822 | Bacteria | 21138 |
| 523 | Ga0501035_0025434 | 3300049822 | Bacteria | 5427 |
| 524 | Ga0501035_0047260 | 3300049822 | Bacteria | 3864 |
| 525 | Ga0501035_0052939 | 3300049822 | Bacteria | 3631 |
| 526 | Ga0501035_0167333 | 3300049822 | Bacteria | 1900 |
| 527 | Ga0501044_0030494 | 3300049823 | Bacteria | 5683 |
| 528 | Ga0501044_0038254 | 3300049823 | Bacteria | 5010 |
| 529 | Ga0501044_0137743 | 3300049823 | Bacteria | 2431 |
| 530 | Ga0501044_0221312 | 3300049823 | Bacteria | 1843 |
| 531 | Ga0501044_0226598 | 3300049823 | Bacteria | 1818 |
| 532 | Ga0501045_0387828 | 3300049824 | Bacteria | 1040 |
| 533 | nmdc:mga0k408_19504_c1 | 3300050493 | Bacteria | 3791 |
| 534 | nmdc:mga05p37_222849_c1 | 3300050507 | Bacteria | 2275 |
| 535 | nmdc:mga0n895_168574_c1 | 3300050512 | Bacteria | 2222 |
| 536 | nmdc:mga0rr50_94228_c1 | 3300050513 | Bacteria | 2338 |
| 537 | nmdc:mga0a205_7961_c1 | 3300050515 | Bacteria | 9626 |
| 538 | nmdc:mga0sz30_80021_c1 | 3300050516 | Bacteria | 1413 |
| 539 | Ga0500643_000053 | 3300053087 | Bacteria | 142202 |
| 540 | Ga0500651_0093638 | 3300053093 | Bacteria | 1847 |
| 541 | Ga0500555_000155 | 3300053103 | Bacteria | 32599 |
| 542 | Ga0500607_034153 | 3300053121 | Bacteria | 2786 |
| 543 | Ga0500633_0001639 | 3300053160 | Bacteria | 4325 |
| 544 | Ga0500636_0000139 | 3300053177 | Bacteria | 37961 |
| 545 | Ga0500625_027477 | 3300053729 | Bacteria | 2699 |
| 546 | Ga0500625_151705 | 3300053729 | Bacteria | 870 |
| 547 | Ga0500645_001021 | 3300053730 | Bacteria | 15687 |
| 548 | Ga0501084_0547379 | 3300054114 | Bacteria | 978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10019922 | Ga0207674_100199228 | 228 |
| 2 | 3300026041 | Ga0207639_10005834 | Ga0207639_100058344 | 231 |
| 3 | 3300049569 | Ga0501032_0033291 | Ga0501032_0033291_425_1222 | 240 |
| 4 | 3300049574 | Ga0501038_0244153 | Ga0501038_0244153_574_1371 | 240 |
| 5 | 3300049590 | Ga0501074_0138312 | Ga0501074_0138312_356_1096 | 241 |
| 6 | 3300003856 | Ga0058692_1000015 | Ga0058692_1000015145 | 243 |
| 7 | 3300025913 | Ga0207695_10005835 | Ga0207695_1000583516 | 243 |
| 8 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011629 | 243 |
| 9 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011629 | 243 |
| 10 | 3300005366 | Ga0070659_100005909 | Ga0070659_1000059094 | 244 |
| 11 | 3300005616 | Ga0068852_100149769 | Ga0068852_1001497691 | 244 |
| 12 | 3300025912 | Ga0207707_10000106 | Ga0207707_1000010616 | 244 |
| 13 | 3300025912 | Ga0207707_10003702 | Ga0207707_100037024 | 244 |
| 14 | 3300025919 | Ga0207657_10015691 | Ga0207657_100156914 | 244 |
| 15 | 3300025927 | Ga0207687_10122655 | Ga0207687_101226552 | 244 |
| 16 | 3300026067 | Ga0207678_10013161 | Ga0207678_100131618 | 244 |
| 17 | 3300049581 | Ga0501047_0110824 | Ga0501047_0110824_84_884 | 244 |
| 18 | 3300049586 | Ga0501070_0008054 | Ga0501070_0008054_7968_8768 | 244 |
| 19 | 3300049742 | Ga0501080_0042006 | Ga0501080_0042006_106_906 | 244 |
| 20 | 3300025932 | Ga0207690_10000869 | Ga0207690_1000086913 | 246 |
| 21 | 3300005339 | Ga0070660_100049161 | Ga0070660_1000491613 | 247 |
| 22 | 3300001915 | JGI24741J21665_1000681 | JGI24741J21665_10006814 | 250 |
| 23 | 3300005345 | Ga0070692_10013814 | Ga0070692_100138143 | 250 |
| 24 | 3300005577 | Ga0068857_100065959 | Ga0068857_1000659592 | 250 |
| 25 | 3300013102 | Ga0157371_10064205 | Ga0157371_100642054 | 250 |
| 26 | 3300049822 | Ga0501035_0001879 | Ga0501035_0001879_20204_21004 | 250 |
| 27 | 3300041413 | Ga0439465_0000557 | Ga0439465_0000557_7543_8313 | 251 |
| 28 | 3300042007 | Ga0439449_0000004 | Ga0439449_0000004_27199_27969 | 251 |
| 29 | iso_pu_bacteria | 2718218334 | 2721028460 | 253 |
| 30 | iso_pu_bacteria | 2734482264 | 2735835949 | 253 |
| 31 | iso_pu_bacteria | 2738543009 | 2739229146 | 253 |
| 32 | iso_pu_bacteria | 2987605356 | 2987608367 | 254 |
| 33 | 3300005344 | Ga0070661_100007885 | Ga0070661_1000078855 | 255 |
| 34 | 3300005535 | Ga0070684_100042703 | Ga0070684_1000427034 | 255 |
| 35 | 3300013100 | Ga0157373_10006081 | Ga0157373_100060813 | 255 |
| 36 | 3300013307 | Ga0157372_10027202 | Ga0157372_100272028 | 255 |
| 37 | 3300020070 | Ga0206356_11464199 | Ga0206356_114641993 | 255 |
| 38 | 3300025920 | Ga0207649_10002754 | Ga0207649_100027546 | 255 |
| 39 | 3300025981 | Ga0207640_10000480 | Ga0207640_1000048025 | 255 |
| 40 | 3300026067 | Ga0207678_10012596 | Ga0207678_100125968 | 255 |
| 41 | 3300049571 | Ga0501034_0000305 | Ga0501034_0000305_57491_58279 | 255 |
| 42 | iso_pu_bacteria | 2842780639 | 2842782168 | 255 |
| 43 | iso_pu_bacteria | 2842914999 | 2842915135 | 255 |
| 44 | iso_pu_bacteria | 2919085039 | 2919088846 | 255 |
| 45 | iso_pu_bacteria | 2600255292 | 2601672119 | 256 |
| 46 | iso_pu_bacteria | 2857547612 | 2857552475 | 256 |
| 47 | iso_pu_bacteria | 2885080285 | 2885085884 | 256 |
| 48 | iso_pu_bacteria | 2919404418 | 2919404565 | 256 |
| 49 | iso_pu_bacteria | 2932410948 | 2932415299 | 256 |
| 50 | iso_pu_bacteria | 2932416698 | 2932421053 | 256 |
| 51 | 3300009101 | Ga0105247_10001072 | Ga0105247_1000107224 | 257 |
| 52 | 3300015261 | Ga0182006_1000062 | Ga0182006_100006232 | 257 |
| 53 | 3300017792 | Ga0163161_10195764 | Ga0163161_101957641 | 257 |
| 54 | 3300025900 | Ga0207710_10041760 | Ga0207710_100417602 | 257 |
| 55 | 3300035724 | Ga0373933_0333883 | Ga0373933_0333883_70_864 | 257 |
| 56 | 3300046452 | Ga0495617_000035 | Ga0495617_000035_126271_127059 | 257 |
| 57 | 3300046460 | Ga0495638_0000059 | Ga0495638_0000059_85204_85992 | 257 |
| 58 | 3300046460 | Ga0495638_0073912 | Ga0495638_0073912_542_1330 | 257 |
| 59 | 3300046471 | Ga0495650_0000496 | Ga0495650_0000496_9608_10396 | 257 |
| 60 | 3300046501 | Ga0495607_0000121 | Ga0495607_0000121_43808_44596 | 257 |
| 61 | 3300046506 | Ga0495583_0005586 | Ga0495583_0005586_482_1270 | 257 |
| 62 | 3300046507 | Ga0495606_0000928 | Ga0495606_0000928_26301_27089 | 257 |
| 63 | 3300046507 | Ga0495606_0009149 | Ga0495606_0009149_13_801 | 257 |
| 64 | 3300046507 | Ga0495606_0084407 | Ga0495606_0084407_552_1340 | 257 |
| 65 | 3300046512 | Ga0495610_0017809 | Ga0495610_0017809_122_910 | 257 |
| 66 | 3300046515 | Ga0495620_0001953 | Ga0495620_0001953_6706_7494 | 257 |
| 67 | 3300046515 | Ga0495620_0002406 | Ga0495620_0002406_2788_3576 | 257 |
| 68 | 3300046518 | Ga0495631_0000916 | Ga0495631_0000916_638_1426 | 257 |
| 69 | 3300046520 | Ga0495637_0005961 | Ga0495637_0005961_3902_4690 | 257 |
| 70 | 3300046524 | Ga0495648_0005506 | Ga0495648_0005506_8184_8972 | 257 |
| 71 | 3300046524 | Ga0495648_0006579 | Ga0495648_0006579_2918_3706 | 257 |
| 72 | 3300046538 | Ga0495609_0006069 | Ga0495609_0006069_4218_5006 | 257 |
| 73 | 3300046616 | Ga0495668_0024046 | Ga0495668_0024046_2459_3247 | 257 |
| 74 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_161846_162634 | 257 |
| 75 | 3300046648 | Ga0495611_0000027 | Ga0495611_0000027_51856_52644 | 257 |
| 76 | 3300046660 | Ga0495625_0000037 | Ga0495625_0000037_129338_130126 | 257 |
| 77 | 3300046660 | Ga0495625_0072075 | Ga0495625_0072075_1352_2140 | 257 |
| 78 | 3300046665 | Ga0495661_0001009 | Ga0495661_0001009_9664_10452 | 257 |
| 79 | 3300046691 | Ga0495670_0001266 | Ga0495670_0001266_10357_11145 | 257 |
| 80 | 3300046794 | Ga0495589_0001848 | Ga0495589_0001848_8292_9080 | 257 |
| 81 | 3300046810 | Ga0495660_0000869 | Ga0495660_0000869_18315_19103 | 257 |
| 82 | 3300046810 | Ga0495660_0000936 | Ga0495660_0000936_5729_6517 | 257 |
| 83 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1428166_1428954 | 257 |
| 84 | 3300047469 | Ga0495673_0000010 | Ga0495673_0000010_610698_611486 | 257 |
| 85 | 3300047469 | Ga0495673_0000072 | Ga0495673_0000072_47219_48007 | 257 |
| 86 | 3300047469 | Ga0495673_0000497 | Ga0495673_0000497_37695_38483 | 257 |
| 87 | 3300047472 | Ga0495686_0000410 | Ga0495686_0000410_18696_19484 | 257 |
| 88 | 3300047472 | Ga0495686_0015787 | Ga0495686_0015787_186_974 | 257 |
| 89 | 3300048909 | Ga0496106_0005129 | Ga0496106_0005129_8795_9583 | 257 |
| 90 | 3300048924 | Ga0496121_0001210 | Ga0496121_0001210_4389_5177 | 257 |
| 91 | 3300048929 | Ga0496126_0254915 | Ga0496126_0254915_653_1441 | 257 |
| 92 | 3300049459 | Ga0495678_000028 | Ga0495678_000028_157568_158356 | 257 |
| 93 | 3300053087 | Ga0500643_000053 | Ga0500643_000053_61751_62539 | 257 |
| 94 | 3300053103 | Ga0500555_000155 | Ga0500555_000155_13394_14182 | 257 |
| 95 | 3300053160 | Ga0500633_0001639 | Ga0500633_0001639_1336_2124 | 257 |
| 96 | 3300053730 | Ga0500645_001021 | Ga0500645_001021_6795_7583 | 257 |
| 97 | iso_pu_bacteria | 2593339239 | 2595451484 | 257 |
| 98 | 3300001915 | JGI24741J21665_1008685 | JGI24741J21665_10086852 | 258 |
| 99 | 3300001979 | JGI24740J21852_10006374 | JGI24740J21852_100063746 | 258 |
| 100 | 3300003761 | Ga0055535_1001175 | Ga0055535_10011759 | 258 |
| 101 | 3300003762 | Ga0055542_1000191 | Ga0055542_10001918 | 258 |
| 102 | 3300005327 | Ga0070658_10011621 | Ga0070658_100116214 | 258 |
| 103 | 3300005336 | Ga0070680_100003199 | Ga0070680_10000319911 | 258 |
| 104 | 3300005337 | Ga0070682_100001531 | Ga0070682_1000015315 | 258 |
| 105 | 3300005339 | Ga0070660_100045685 | Ga0070660_1000456852 | 258 |
| 106 | 3300005339 | Ga0070660_100068709 | Ga0070660_1000687092 | 258 |
| 107 | 3300005341 | Ga0070691_10003728 | Ga0070691_100037286 | 258 |
| 108 | 3300005344 | Ga0070661_100086661 | Ga0070661_1000866613 | 258 |
| 109 | 3300005366 | Ga0070659_100030751 | Ga0070659_1000307512 | 258 |
| 110 | 3300005435 | Ga0070714_100521861 | Ga0070714_1005218612 | 258 |
| 111 | 3300005436 | Ga0070713_100007977 | Ga0070713_10000797711 | 258 |
| 112 | 3300005455 | Ga0070663_100015446 | Ga0070663_1000154463 | 258 |
| 113 | 3300005455 | Ga0070663_100065322 | Ga0070663_1000653222 | 258 |
| 114 | 3300005458 | Ga0070681_10000721 | Ga0070681_1000072122 | 258 |
| 115 | 3300005458 | Ga0070681_10010860 | Ga0070681_100108604 | 258 |
| 116 | 3300005530 | Ga0070679_100000417 | Ga0070679_10000041722 | 258 |
| 117 | 3300005546 | Ga0070696_100001686 | Ga0070696_1000016867 | 258 |
| 118 | 3300005546 | Ga0070696_100037647 | Ga0070696_1000376474 | 258 |
| 119 | 3300005547 | Ga0070693_100179185 | Ga0070693_1001791852 | 258 |
| 120 | 3300005563 | Ga0068855_100019050 | Ga0068855_1000190504 | 258 |
| 121 | 3300005563 | Ga0068855_100513013 | Ga0068855_1005130132 | 258 |
| 122 | 3300005577 | Ga0068857_100353015 | Ga0068857_1003530152 | 258 |
| 123 | 3300005578 | Ga0068854_100289958 | Ga0068854_1002899581 | 258 |
| 124 | 3300005614 | Ga0068856_100000797 | Ga0068856_1000007973 | 258 |
| 125 | 3300005614 | Ga0068856_100064205 | Ga0068856_1000642053 | 258 |
| 126 | 3300005616 | Ga0068852_100377819 | Ga0068852_1003778192 | 258 |
| 127 | 3300005834 | Ga0068851_10075389 | Ga0068851_100753892 | 258 |
| 128 | 3300006871 | Ga0075434_100016515 | Ga0075434_1000165155 | 258 |
| 129 | 3300007076 | Ga0075435_100026633 | Ga0075435_1000266334 | 258 |
| 130 | 3300009093 | Ga0105240_10009451 | Ga0105240_1000945113 | 258 |
| 131 | 3300009093 | Ga0105240_10103339 | Ga0105240_101033394 | 258 |
| 132 | 3300009098 | Ga0105245_10215208 | Ga0105245_102152083 | 258 |
| 133 | 3300009174 | Ga0105241_10059458 | Ga0105241_100594583 | 258 |
| 134 | 3300009174 | Ga0105241_10129926 | Ga0105241_101299262 | 258 |
| 135 | 3300009551 | Ga0105238_10310634 | Ga0105238_103106342 | 258 |
| 136 | 3300010375 | Ga0105239_10000023 | Ga0105239_1000002320 | 258 |
| 137 | 3300011119 | Ga0105246_10157009 | Ga0105246_101570091 | 258 |
| 138 | 3300013100 | Ga0157373_10057143 | Ga0157373_100571433 | 258 |
| 139 | 3300013102 | Ga0157371_10058745 | Ga0157371_100587452 | 258 |
| 140 | 3300013104 | Ga0157370_10015411 | Ga0157370_100154114 | 258 |
| 141 | 3300013104 | Ga0157370_10433451 | Ga0157370_104334512 | 258 |
| 142 | 3300013105 | Ga0157369_10036017 | Ga0157369_100360174 | 258 |
| 143 | 3300013105 | Ga0157369_10278688 | Ga0157369_102786881 | 258 |
| 144 | 3300013306 | Ga0163162_10095092 | Ga0163162_100950922 | 258 |
| 145 | 3300013307 | Ga0157372_10002979 | Ga0157372_100029794 | 258 |
| 146 | 3300013307 | Ga0157372_10077002 | Ga0157372_100770023 | 258 |
| 147 | 3300013307 | Ga0157372_10290878 | Ga0157372_102908782 | 258 |
| 148 | 3300015262 | Ga0182007_10007098 | Ga0182007_100070987 | 258 |
| 149 | 3300020069 | Ga0197907_10056721 | Ga0197907_100567214 | 258 |
| 150 | 3300020070 | Ga0206356_10103483 | Ga0206356_101034831 | 258 |
| 151 | 3300020610 | Ga0154015_1409760 | Ga0154015_14097602 | 258 |
| 152 | 3300025226 | Ga0209674_101464 | Ga0209674_1014641 | 258 |
| 153 | 3300025228 | Ga0209672_101550 | Ga0209672_1015502 | 258 |
| 154 | 3300025242 | Ga0209258_100316 | Ga0209258_1003168 | 258 |
| 155 | 3300025242 | Ga0209258_105374 | Ga0209258_1053742 | 258 |
| 156 | 3300025250 | Ga0209026_1000139 | Ga0209026_100013914 | 258 |
| 157 | 3300025254 | Ga0209148_1000244 | Ga0209148_10002448 | 258 |
| 158 | 3300025272 | Ga0209455_1003988 | Ga0209455_10039884 | 258 |
| 159 | 3300025904 | Ga0207647_10003903 | Ga0207647_1000390311 | 258 |
| 160 | 3300025904 | Ga0207647_10024124 | Ga0207647_100241244 | 258 |
| 161 | 3300025907 | Ga0207645_10204939 | Ga0207645_102049391 | 258 |
| 162 | 3300025909 | Ga0207705_10002025 | Ga0207705_100020257 | 258 |
| 163 | 3300025911 | Ga0207654_10058208 | Ga0207654_100582081 | 258 |
| 164 | 3300025912 | Ga0207707_10000179 | Ga0207707_1000017915 | 258 |
| 165 | 3300025912 | Ga0207707_10002026 | Ga0207707_100020268 | 258 |
| 166 | 3300025912 | Ga0207707_10013685 | Ga0207707_100136852 | 258 |
| 167 | 3300025913 | Ga0207695_10001370 | Ga0207695_1000137018 | 258 |
| 168 | 3300025913 | Ga0207695_10055585 | Ga0207695_100555853 | 258 |
| 169 | 3300025913 | Ga0207695_10191438 | Ga0207695_101914382 | 258 |
| 170 | 3300025917 | Ga0207660_10004214 | Ga0207660_100042144 | 258 |
| 171 | 3300025917 | Ga0207660_10005475 | Ga0207660_100054754 | 258 |
| 172 | 3300025919 | Ga0207657_10010355 | Ga0207657_100103554 | 258 |
| 173 | 3300025919 | Ga0207657_10195262 | Ga0207657_101952622 | 258 |
| 174 | 3300025920 | Ga0207649_10325738 | Ga0207649_103257382 | 258 |
| 175 | 3300025921 | Ga0207652_10000894 | Ga0207652_1000089410 | 258 |
| 176 | 3300025921 | Ga0207652_10001820 | Ga0207652_100018208 | 258 |
| 177 | 3300025921 | Ga0207652_10003323 | Ga0207652_100033235 | 258 |
| 178 | 3300025921 | Ga0207652_10041141 | Ga0207652_100411414 | 258 |
| 179 | 3300025923 | Ga0207681_10515256 | Ga0207681_105152561 | 258 |
| 180 | 3300025924 | Ga0207694_10083941 | Ga0207694_100839411 | 258 |
| 181 | 3300025927 | Ga0207687_10422199 | Ga0207687_104221991 | 258 |
| 182 | 3300025928 | Ga0207700_10211276 | Ga0207700_102112761 | 258 |
| 183 | 3300025933 | Ga0207706_10004745 | Ga0207706_1000474512 | 258 |
| 184 | 3300025939 | Ga0207665_10204550 | Ga0207665_102045502 | 258 |
| 185 | 3300025944 | Ga0207661_10034544 | Ga0207661_100345441 | 258 |
| 186 | 3300025949 | Ga0207667_10002217 | Ga0207667_100022177 | 258 |
| 187 | 3300025949 | Ga0207667_10008576 | Ga0207667_100085765 | 258 |
| 188 | 3300025949 | Ga0207667_10020975 | Ga0207667_100209753 | 258 |
| 189 | 3300026023 | Ga0207677_10349409 | Ga0207677_103494092 | 258 |
| 190 | 3300026035 | Ga0207703_10127815 | Ga0207703_101278152 | 258 |
| 191 | 3300026041 | Ga0207639_10483319 | Ga0207639_104833192 | 258 |
| 192 | 3300026067 | Ga0207678_10002935 | Ga0207678_100029357 | 258 |
| 193 | 3300026067 | Ga0207678_10039903 | Ga0207678_100399034 | 258 |
| 194 | 3300026078 | Ga0207702_10001248 | Ga0207702_1000124829 | 258 |
| 195 | 3300026116 | Ga0207674_10005152 | Ga0207674_100051526 | 258 |
| 196 | 3300026116 | Ga0207674_10214714 | Ga0207674_102147142 | 258 |
| 197 | 3300026142 | Ga0207698_10040295 | Ga0207698_100402952 | 258 |
| 198 | 3300032126 | Ga0307415_100512429 | Ga0307415_1005124291 | 258 |
| 199 | 3300034820 | Ga0373959_0038111 | Ga0373959_0038111_159_950 | 258 |
| 200 | 3300037312 | Ga0395899_0073664 | Ga0395899_0073664_1676_2470 | 258 |
| 201 | 3300037312 | Ga0395899_0156525 | Ga0395899_0156525_127_945 | 258 |
| 202 | 3300037418 | Ga0395900_0060933 | Ga0395900_0060933_1697_2521 | 258 |
| 203 | 3300037418 | Ga0395900_0318405 | Ga0395900_0318405_445_1263 | 258 |
| 204 | 3300037466 | Ga0395898_0318993 | Ga0395898_0318993_303_1121 | 258 |
| 205 | 3300038443 | Ga0395901_0271045 | Ga0395901_0271045_185_1009 | 258 |
| 206 | 3300038443 | Ga0395901_0307808 | Ga0395901_0307808_415_1233 | 258 |
| 207 | 3300046475 | Ga0495639_0007327 | Ga0495639_0007327_1427_2227 | 258 |
| 208 | 3300046476 | Ga0495662_0008401 | Ga0495662_0008401_1073_1873 | 258 |
| 209 | 3300046507 | Ga0495606_0008792 | Ga0495606_0008792_2898_3689 | 258 |
| 210 | 3300046517 | Ga0495630_0000001 | Ga0495630_0000001_518831_519631 | 258 |
| 211 | 3300046518 | Ga0495631_0000249 | Ga0495631_0000249_26509_27327 | 258 |
| 212 | 3300046674 | Ga0495588_0204212 | Ga0495588_0204212_75_893 | 258 |
| 213 | 3300048903 | Ga0496100_0008035 | Ga0496100_0008035_1768_2559 | 258 |
| 214 | 3300048903 | Ga0496100_0069002 | Ga0496100_0069002_1000_1797 | 258 |
| 215 | 3300048904 | Ga0496101_0013541 | Ga0496101_0013541_4577_5368 | 258 |
| 216 | 3300048905 | Ga0496102_0504999 | Ga0496102_0504999_259_1056 | 258 |
| 217 | 3300048907 | Ga0496104_0091669 | Ga0496104_0091669_82_879 | 258 |
| 218 | 3300048908 | Ga0496105_0049796 | Ga0496105_0049796_2582_3379 | 258 |
| 219 | 3300048920 | Ga0496117_0008972 | Ga0496117_0008972_811_1608 | 258 |
| 220 | 3300048920 | Ga0496117_0038404 | Ga0496117_0038404_2536_3333 | 258 |
| 221 | 3300048921 | Ga0496118_0008700 | Ga0496118_0008700_2681_3478 | 258 |
| 222 | 3300048921 | Ga0496118_0014826 | Ga0496118_0014826_975_1772 | 258 |
| 223 | 3300048922 | Ga0496119_0000182 | Ga0496119_0000182_49773_50570 | 258 |
| 224 | 3300048923 | Ga0496120_0000661 | Ga0496120_0000661_43_840 | 258 |
| 225 | 3300048924 | Ga0496121_0000419 | Ga0496121_0000419_18957_19754 | 258 |
| 226 | 3300048924 | Ga0496121_0045798 | Ga0496121_0045798_2155_2952 | 258 |
| 227 | 3300048925 | Ga0496122_0024832 | Ga0496122_0024832_129_920 | 258 |
| 228 | 3300048926 | Ga0496123_0014233 | Ga0496123_0014233_5685_6476 | 258 |
| 229 | 3300048929 | Ga0496126_0004479 | Ga0496126_0004479_13306_14103 | 258 |
| 230 | 3300049460 | Ga0495682_0001819 | Ga0495682_0001819_5716_6534 | 258 |
| 231 | 3300049570 | Ga0501033_0000430 | Ga0501033_0000430_6485_7288 | 258 |
| 232 | 3300049579 | Ga0501043_0045728 | Ga0501043_0045728_791_1588 | 258 |
| 233 | 3300049586 | Ga0501070_0000265 | Ga0501070_0000265_4423_5217 | 258 |
| 234 | 3300049586 | Ga0501070_0223592 | Ga0501070_0223592_491_1309 | 258 |
| 235 | 3300049593 | Ga0501077_0003192 | Ga0501077_0003192_8884_9702 | 258 |
| 236 | 3300049743 | Ga0501081_0044032 | Ga0501081_0044032_714_1511 | 258 |
| 237 | 3300049822 | Ga0501035_0052939 | Ga0501035_0052939_692_1486 | 258 |
| 238 | 3300049823 | Ga0501044_0137743 | Ga0501044_0137743_868_1662 | 258 |
| 239 | 3300049823 | Ga0501044_0221312 | Ga0501044_0221312_250_1047 | 258 |
| 240 | 3300049824 | Ga0501045_0387828 | Ga0501045_0387828_176_973 | 258 |
| 241 | 3300050512 | nmdc:mga0n895_168574_c1 | nmdc:mga0n895_168574_c1_574_1371 | 258 |
| 242 | 3300050513 | nmdc:mga0rr50_94228_c1 | nmdc:mga0rr50_94228_c1_695_1492 | 258 |
| 243 | 3300050515 | nmdc:mga0a205_7961_c1 | nmdc:mga0a205_7961_c1_7170_7967 | 258 |
| 244 | 3300053093 | Ga0500651_0093638 | Ga0500651_0093638_299_1090 | 258 |
| 245 | iso_pu_bacteria | 2687453130 | 2687581997 | 258 |
| 246 | 3300005331 | Ga0070670_100071853 | Ga0070670_1000718532 | 259 |
| 247 | 3300005334 | Ga0068869_100175413 | Ga0068869_1001754132 | 259 |
| 248 | 3300005336 | Ga0070680_100020813 | Ga0070680_1000208136 | 259 |
| 249 | 3300005344 | Ga0070661_100369011 | Ga0070661_1003690112 | 259 |
| 250 | 3300005366 | Ga0070659_100218530 | Ga0070659_1002185302 | 259 |
| 251 | 3300005458 | Ga0070681_10000934 | Ga0070681_1000093418 | 259 |
| 252 | 3300005467 | Ga0070706_100021362 | Ga0070706_1000213625 | 259 |
| 253 | 3300005467 | Ga0070706_100025560 | Ga0070706_1000255605 | 259 |
| 254 | 3300005530 | Ga0070679_100009935 | Ga0070679_10000993511 | 259 |
| 255 | 3300005535 | Ga0070684_100037216 | Ga0070684_1000372164 | 259 |
| 256 | 3300005546 | Ga0070696_100030549 | Ga0070696_1000305494 | 259 |
| 257 | 3300005617 | Ga0068859_100418112 | Ga0068859_1004181121 | 259 |
| 258 | 3300006931 | Ga0097620_100418080 | Ga0097620_1004180802 | 259 |
| 259 | 3300009148 | Ga0105243_10186949 | Ga0105243_101869492 | 259 |
| 260 | 3300009545 | Ga0105237_10337884 | Ga0105237_103378842 | 259 |
| 261 | 3300009551 | Ga0105238_10254080 | Ga0105238_102540802 | 259 |
| 262 | 3300010375 | Ga0105239_10026540 | Ga0105239_100265404 | 259 |
| 263 | 3300013104 | Ga0157370_10028755 | Ga0157370_100287555 | 259 |
| 264 | 3300015265 | Ga0182005_1000035 | Ga0182005_100003569 | 259 |
| 265 | 3300015265 | Ga0182005_1015987 | Ga0182005_10159872 | 259 |
| 266 | 3300025258 | Ga0209129_1001466 | Ga0209129_100146611 | 259 |
| 267 | 3300025297 | Ga0209758_1016770 | Ga0209758_10167702 | 259 |
| 268 | 3300025299 | Ga0209256_1028698 | Ga0209256_10286982 | 259 |
| 269 | 3300025904 | Ga0207647_10000191 | Ga0207647_1000019110 | 259 |
| 270 | 3300025910 | Ga0207684_10078191 | Ga0207684_100781915 | 259 |
| 271 | 3300025910 | Ga0207684_10178836 | Ga0207684_101788362 | 259 |
| 272 | 3300025912 | Ga0207707_10000812 | Ga0207707_1000081218 | 259 |
| 273 | 3300025914 | Ga0207671_10253550 | Ga0207671_102535502 | 259 |
| 274 | 3300025917 | Ga0207660_10000747 | Ga0207660_1000074717 | 259 |
| 275 | 3300025921 | Ga0207652_10000442 | Ga0207652_1000044229 | 259 |
| 276 | 3300025922 | Ga0207646_10036569 | Ga0207646_100365695 | 259 |
| 277 | 3300025924 | Ga0207694_10091345 | Ga0207694_100913452 | 259 |
| 278 | 3300025925 | Ga0207650_10071522 | Ga0207650_100715223 | 259 |
| 279 | 3300025931 | Ga0207644_10394141 | Ga0207644_103941412 | 259 |
| 280 | 3300025932 | Ga0207690_10282058 | Ga0207690_102820581 | 259 |
| 281 | 3300026116 | Ga0207674_10458873 | Ga0207674_104588732 | 259 |
| 282 | 3300031456 | Ga0307513_10055696 | Ga0307513_100556964 | 259 |
| 283 | 3300037312 | Ga0395899_0012531 | Ga0395899_0012531_1110_1907 | 259 |
| 284 | 3300037418 | Ga0395900_0076239 | Ga0395900_0076239_783_1580 | 259 |
| 285 | 3300037466 | Ga0395898_0042982 | Ga0395898_0042982_2376_3173 | 259 |
| 286 | 3300037471 | Ga0395905_0050410 | Ga0395905_0050410_2142_2939 | 259 |
| 287 | 3300038443 | Ga0395901_0003835 | Ga0395901_0003835_10274_11071 | 259 |
| 288 | 3300038443 | Ga0395901_0062534 | Ga0395901_0062534_783_1580 | 259 |
| 289 | 3300041404 | Ga0439436_0016966 | Ga0439436_0016966_1019_1813 | 259 |
| 290 | 3300044656 | Ga0466969_0031842 | Ga0466969_0031842_1461_2264 | 259 |
| 291 | 3300044658 | Ga0466972_0018206 | Ga0466972_0018206_2668_3471 | 259 |
| 292 | 3300044672 | Ga0466982_0000018 | Ga0466982_0000018_105028_105831 | 259 |
| 293 | 3300044684 | Ga0466966_0010735 | Ga0466966_0010735_1414_2217 | 259 |
| 294 | 3300046471 | Ga0495650_0011152 | Ga0495650_0011152_270_1064 | 259 |
| 295 | 3300046474 | Ga0495605_0059099 | Ga0495605_0059099_367_1161 | 259 |
| 296 | 3300046491 | Ga0495584_0011251 | Ga0495584_0011251_1094_1888 | 259 |
| 297 | 3300046492 | Ga0495585_0003949 | Ga0495585_0003949_3953_4747 | 259 |
| 298 | 3300046501 | Ga0495607_0000012 | Ga0495607_0000012_43646_44440 | 259 |
| 299 | 3300046501 | Ga0495607_0017066 | Ga0495607_0017066_1047_1841 | 259 |
| 300 | 3300046507 | Ga0495606_0000490 | Ga0495606_0000490_58833_59627 | 259 |
| 301 | 3300046513 | Ga0495616_0000027 | Ga0495616_0000027_43803_44597 | 259 |
| 302 | 3300046519 | Ga0495632_0000019 | Ga0495632_0000019_126291_127085 | 259 |
| 303 | 3300046519 | Ga0495632_0030754 | Ga0495632_0030754_1207_2001 | 259 |
| 304 | 3300046691 | Ga0495670_0017154 | Ga0495670_0017154_1330_2124 | 259 |
| 305 | 3300047323 | Ga0495683_0001081 | Ga0495683_0001081_14091_14885 | 259 |
| 306 | 3300047470 | Ga0495681_0035180 | Ga0495681_0035180_412_1206 | 259 |
| 307 | 3300047472 | Ga0495686_0164192 | Ga0495686_0164192_480_1274 | 259 |
| 308 | 3300048909 | Ga0496106_0185210 | Ga0496106_0185210_29_844 | 259 |
| 309 | 3300048912 | Ga0496109_0592727 | Ga0496109_0592727_51_851 | 259 |
| 310 | 3300048919 | Ga0496116_0049201 | Ga0496116_0049201_614_1408 | 259 |
| 311 | 3300048924 | Ga0496121_0002943 | Ga0496121_0002943_6949_7743 | 259 |
| 312 | 3300048925 | Ga0496122_0013398 | Ga0496122_0013398_2974_3768 | 259 |
| 313 | 3300048925 | Ga0496122_0030266 | Ga0496122_0030266_2021_2815 | 259 |
| 314 | 3300048926 | Ga0496123_0020466 | Ga0496123_0020466_2418_3212 | 259 |
| 315 | 3300048927 | Ga0496124_0000006 | Ga0496124_0000006_829531_830325 | 259 |
| 316 | 3300048927 | Ga0496124_0001002 | Ga0496124_0001002_8195_8989 | 259 |
| 317 | 3300048927 | Ga0496124_0002574 | Ga0496124_0002574_14514_15308 | 259 |
| 318 | 3300048928 | Ga0496125_0017071 | Ga0496125_0017071_3273_4067 | 259 |
| 319 | 3300049513 | Ga0501290_001765 | Ga0501290_001765_686_1480 | 259 |
| 320 | 3300049569 | Ga0501032_0051863 | Ga0501032_0051863_1710_2507 | 259 |
| 321 | 3300049570 | Ga0501033_0090119 | Ga0501033_0090119_771_1568 | 259 |
| 322 | 3300049571 | Ga0501034_0023429 | Ga0501034_0023429_5114_5914 | 259 |
| 323 | 3300049571 | Ga0501034_0550362 | Ga0501034_0550362_171_971 | 259 |
| 324 | 3300049579 | Ga0501043_0058971 | Ga0501043_0058971_490_1284 | 259 |
| 325 | 3300049580 | Ga0501046_0136361 | Ga0501046_0136361_291_1091 | 259 |
| 326 | 3300049581 | Ga0501047_0041830 | Ga0501047_0041830_2442_3242 | 259 |
| 327 | 3300049581 | Ga0501047_0231459 | Ga0501047_0231459_20_814 | 259 |
| 328 | 3300049586 | Ga0501070_0028719 | Ga0501070_0028719_2734_3528 | 259 |
| 329 | 3300049589 | Ga0501073_0028016 | Ga0501073_0028016_3140_3934 | 259 |
| 330 | 3300049590 | Ga0501074_0029623 | Ga0501074_0029623_424_1218 | 259 |
| 331 | 3300049705 | Ga0501225_0004969 | Ga0501225_0004969_2985_3779 | 259 |
| 332 | 3300049772 | Ga0501275_000109 | Ga0501275_000109_926_1720 | 259 |
| 333 | 3300049822 | Ga0501035_0025434 | Ga0501035_0025434_1008_1802 | 259 |
| 334 | 3300049822 | Ga0501035_0047260 | Ga0501035_0047260_2251_3120 | 259 |
| 335 | 3300049823 | Ga0501044_0030494 | Ga0501044_0030494_3106_3975 | 259 |
| 336 | 3300049823 | Ga0501044_0038254 | Ga0501044_0038254_849_1643 | 259 |
| 337 | 3300050516 | nmdc:mga0sz30_80021_c1 | nmdc:mga0sz30_80021_c1_454_1248 | 259 |
| 338 | iso_pu_bacteria | 2643221660 | 2644340497 | 259 |
| 339 | 3300001904 | JGI24736J21556_1003426 | JGI24736J21556_10034264 | 260 |
| 340 | 3300001979 | JGI24740J21852_10002017 | JGI24740J21852_100020172 | 260 |
| 341 | 3300003752 | Ga0055539_1007878 | Ga0055539_10078782 | 260 |
| 342 | 3300003756 | Ga0055533_1002033 | Ga0055533_10020335 | 260 |
| 343 | 3300003759 | Ga0055525_1000178 | Ga0055525_100017869 | 260 |
| 344 | 3300003760 | Ga0055527_1000090 | Ga0055527_100009018 | 260 |
| 345 | 3300003760 | Ga0055527_1000100 | Ga0055527_100010015 | 260 |
| 346 | 3300003761 | Ga0055535_1000201 | Ga0055535_100020133 | 260 |
| 347 | 3300003761 | Ga0055535_1000742 | Ga0055535_10007425 | 260 |
| 348 | 3300003762 | Ga0055542_1000187 | Ga0055542_100018744 | 260 |
| 349 | 3300003762 | Ga0055542_1000212 | Ga0055542_100021232 | 260 |
| 350 | 3300003762 | Ga0055542_1000236 | Ga0055542_100023633 | 260 |
| 351 | 3300003763 | Ga0055529_1000256 | Ga0055529_100025633 | 260 |
| 352 | 3300003763 | Ga0055529_1000259 | Ga0055529_100025928 | 260 |
| 353 | 3300005295 | Ga0065707_10008645 | Ga0065707_100086452 | 260 |
| 354 | 3300005327 | Ga0070658_10001497 | Ga0070658_1000149718 | 260 |
| 355 | 3300005327 | Ga0070658_10331290 | Ga0070658_103312902 | 260 |
| 356 | 3300005329 | Ga0070683_100048770 | Ga0070683_1000487703 | 260 |
| 357 | 3300005329 | Ga0070683_100088218 | Ga0070683_1000882183 | 260 |
| 358 | 3300005333 | Ga0070677_10011734 | Ga0070677_100117342 | 260 |
| 359 | 3300005335 | Ga0070666_10000013 | Ga0070666_10000013180 | 260 |
| 360 | 3300005336 | Ga0070680_100043710 | Ga0070680_1000437103 | 260 |
| 361 | 3300005336 | Ga0070680_100050715 | Ga0070680_1000507152 | 260 |
| 362 | 3300005336 | Ga0070680_100088523 | Ga0070680_1000885232 | 260 |
| 363 | 3300005337 | Ga0070682_100040815 | Ga0070682_1000408151 | 260 |
| 364 | 3300005337 | Ga0070682_100080903 | Ga0070682_1000809032 | 260 |
| 365 | 3300005341 | Ga0070691_10013583 | Ga0070691_100135834 | 260 |
| 366 | 3300005344 | Ga0070661_100005231 | Ga0070661_10000523110 | 260 |
| 367 | 3300005344 | Ga0070661_100051308 | Ga0070661_1000513083 | 260 |
| 368 | 3300005345 | Ga0070692_10002997 | Ga0070692_100029976 | 260 |
| 369 | 3300005345 | Ga0070692_10021053 | Ga0070692_100210534 | 260 |
| 370 | 3300005353 | Ga0070669_100016333 | Ga0070669_1000163336 | 260 |
| 371 | 3300005364 | Ga0070673_100381814 | Ga0070673_1003818141 | 260 |
| 372 | 3300005367 | Ga0070667_100014067 | Ga0070667_1000140673 | 260 |
| 373 | 3300005455 | Ga0070663_100003461 | Ga0070663_1000034615 | 260 |
| 374 | 3300005455 | Ga0070663_100005923 | Ga0070663_1000059239 | 260 |
| 375 | 3300005458 | Ga0070681_10073268 | Ga0070681_100732682 | 260 |
| 376 | 3300005459 | Ga0068867_100145442 | Ga0068867_1001454423 | 260 |
| 377 | 3300005530 | Ga0070679_100064877 | Ga0070679_1000648774 | 260 |
| 378 | 3300005543 | Ga0070672_100018953 | Ga0070672_1000189534 | 260 |
| 379 | 3300005547 | Ga0070693_100004068 | Ga0070693_1000040685 | 260 |
| 380 | 3300005548 | Ga0070665_100000333 | Ga0070665_10000033345 | 260 |
| 381 | 3300005577 | Ga0068857_100044998 | Ga0068857_1000449984 | 260 |
| 382 | 3300005577 | Ga0068857_100102397 | Ga0068857_1001023974 | 260 |
| 383 | 3300005614 | Ga0068856_100005119 | Ga0068856_10000511914 | 260 |
| 384 | 3300005616 | Ga0068852_100040728 | Ga0068852_1000407285 | 260 |
| 385 | 3300005617 | Ga0068859_100107681 | Ga0068859_1001076812 | 260 |
| 386 | 3300005718 | Ga0068866_10052177 | Ga0068866_100521773 | 260 |
| 387 | 3300005719 | Ga0068861_100572039 | Ga0068861_1005720391 | 260 |
| 388 | 3300005843 | Ga0068860_100097736 | Ga0068860_1000977362 | 260 |
| 389 | 3300005843 | Ga0068860_100105639 | Ga0068860_1001056393 | 260 |
| 390 | 3300005844 | Ga0068862_100012901 | Ga0068862_1000129012 | 260 |
| 391 | 3300005937 | Ga0081455_10132185 | Ga0081455_101321852 | 260 |
| 392 | 3300006195 | Ga0075366_10077823 | Ga0075366_100778232 | 260 |
| 393 | 3300006931 | Ga0097620_100107684 | Ga0097620_1001076842 | 260 |
| 394 | 3300009093 | Ga0105240_10007819 | Ga0105240_1000781914 | 260 |
| 395 | 3300009094 | Ga0111539_10518133 | Ga0111539_105181332 | 260 |
| 396 | 3300009174 | Ga0105241_10119003 | Ga0105241_101190033 | 260 |
| 397 | 3300009551 | Ga0105238_10000131 | Ga0105238_1000013121 | 260 |
| 398 | 3300013102 | Ga0157371_10011947 | Ga0157371_100119474 | 260 |
| 399 | 3300013104 | Ga0157370_10112207 | Ga0157370_101122073 | 260 |
| 400 | 3300013105 | Ga0157369_10003442 | Ga0157369_1000344211 | 260 |
| 401 | 3300013306 | Ga0163162_10098108 | Ga0163162_100981082 | 260 |
| 402 | 3300014326 | Ga0157380_10176236 | Ga0157380_101762361 | 260 |
| 403 | 3300014497 | Ga0182008_10010199 | Ga0182008_100101994 | 260 |
| 404 | 3300014968 | Ga0157379_10041041 | Ga0157379_100410415 | 260 |
| 405 | 3300014968 | Ga0157379_10172101 | Ga0157379_101721012 | 260 |
| 406 | 3300015261 | Ga0182006_1000030 | Ga0182006_1000030220 | 260 |
| 407 | 3300015262 | Ga0182007_10000803 | Ga0182007_100008035 | 260 |
| 408 | 3300015265 | Ga0182005_1000021 | Ga0182005_100002112 | 260 |
| 409 | 3300017792 | Ga0163161_10032533 | Ga0163161_100325334 | 260 |
| 410 | 3300020070 | Ga0206356_11014676 | Ga0206356_110146763 | 260 |
| 411 | 3300020081 | Ga0206354_10181591 | Ga0206354_101815913 | 260 |
| 412 | 3300020082 | Ga0206353_10124593 | Ga0206353_101245934 | 260 |
| 413 | 3300020610 | Ga0154015_1046164 | Ga0154015_10461643 | 260 |
| 414 | 3300025226 | Ga0209674_100140 | Ga0209674_10014074 | 260 |
| 415 | 3300025226 | Ga0209674_100373 | Ga0209674_10037316 | 260 |
| 416 | 3300025228 | Ga0209672_100016 | Ga0209672_100016110 | 260 |
| 417 | 3300025233 | Ga0209437_100270 | Ga0209437_10027046 | 260 |
| 418 | 3300025242 | Ga0209258_100012 | Ga0209258_100012251 | 260 |
| 419 | 3300025250 | Ga0209026_1000117 | Ga0209026_100011734 | 260 |
| 420 | 3300025254 | Ga0209148_1000005 | Ga0209148_10000051271 | 260 |
| 421 | 3300025254 | Ga0209148_1000014 | Ga0209148_1000014404 | 260 |
| 422 | 3300025261 | Ga0209233_1025529 | Ga0209233_10255291 | 260 |
| 423 | 3300025272 | Ga0209455_1000014 | Ga0209455_1000014292 | 260 |
| 424 | 3300025298 | Ga0209050_1050163 | Ga0209050_10501631 | 260 |
| 425 | 3300025304 | Ga0209257_1005084 | Ga0209257_100508410 | 260 |
| 426 | 3300025893 | Ga0207682_10045555 | Ga0207682_100455551 | 260 |
| 427 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001263 | 260 |
| 428 | 3300025904 | Ga0207647_10005977 | Ga0207647_100059778 | 260 |
| 429 | 3300025908 | Ga0207643_10105992 | Ga0207643_101059922 | 260 |
| 430 | 3300025909 | Ga0207705_10001045 | Ga0207705_1000104517 | 260 |
| 431 | 3300025909 | Ga0207705_10001377 | Ga0207705_100013777 | 260 |
| 432 | 3300025909 | Ga0207705_10020417 | Ga0207705_100204176 | 260 |
| 433 | 3300025909 | Ga0207705_10022308 | Ga0207705_100223082 | 260 |
| 434 | 3300025909 | Ga0207705_10294428 | Ga0207705_102944282 | 260 |
| 435 | 3300025911 | Ga0207654_10148453 | Ga0207654_101484532 | 260 |
| 436 | 3300025912 | Ga0207707_10003633 | Ga0207707_100036335 | 260 |
| 437 | 3300025912 | Ga0207707_10049700 | Ga0207707_100497004 | 260 |
| 438 | 3300025913 | Ga0207695_10000588 | Ga0207695_1000058856 | 260 |
| 439 | 3300025913 | Ga0207695_10001701 | Ga0207695_1000170128 | 260 |
| 440 | 3300025913 | Ga0207695_10002955 | Ga0207695_1000295512 | 260 |
| 441 | 3300025917 | Ga0207660_10008170 | Ga0207660_100081703 | 260 |
| 442 | 3300025917 | Ga0207660_10010788 | Ga0207660_100107886 | 260 |
| 443 | 3300025917 | Ga0207660_10032194 | Ga0207660_100321944 | 260 |
| 444 | 3300025919 | Ga0207657_10004478 | Ga0207657_1000447812 | 260 |
| 445 | 3300025919 | Ga0207657_10015112 | Ga0207657_100151124 | 260 |
| 446 | 3300025920 | Ga0207649_10035547 | Ga0207649_100355472 | 260 |
| 447 | 3300025921 | Ga0207652_10002955 | Ga0207652_100029553 | 260 |
| 448 | 3300025921 | Ga0207652_10047840 | Ga0207652_100478404 | 260 |
| 449 | 3300025924 | Ga0207694_10000168 | Ga0207694_1000016820 | 260 |
| 450 | 3300025925 | Ga0207650_10123708 | Ga0207650_101237082 | 260 |
| 451 | 3300025926 | Ga0207659_10047537 | Ga0207659_100475373 | 260 |
| 452 | 3300025940 | Ga0207691_10014135 | Ga0207691_100141355 | 260 |
| 453 | 3300025944 | Ga0207661_10012370 | Ga0207661_100123705 | 260 |
| 454 | 3300025944 | Ga0207661_10012402 | Ga0207661_100124024 | 260 |
| 455 | 3300025949 | Ga0207667_10001475 | Ga0207667_1000147515 | 260 |
| 456 | 3300025949 | Ga0207667_10006386 | Ga0207667_100063863 | 260 |
| 457 | 3300025981 | Ga0207640_10000593 | Ga0207640_1000059310 | 260 |
| 458 | 3300025981 | Ga0207640_10000958 | Ga0207640_100009582 | 260 |
| 459 | 3300025986 | Ga0207658_10005424 | Ga0207658_100054248 | 260 |
| 460 | 3300026035 | Ga0207703_10080246 | Ga0207703_100802462 | 260 |
| 461 | 3300026035 | Ga0207703_10597678 | Ga0207703_105976782 | 260 |
| 462 | 3300026041 | Ga0207639_10001978 | Ga0207639_100019784 | 260 |
| 463 | 3300026067 | Ga0207678_10003548 | Ga0207678_1000354811 | 260 |
| 464 | 3300026067 | Ga0207678_10016189 | Ga0207678_100161893 | 260 |
| 465 | 3300026078 | Ga0207702_10001348 | Ga0207702_100013485 | 260 |
| 466 | 3300026078 | Ga0207702_10001815 | Ga0207702_100018157 | 260 |
| 467 | 3300026089 | Ga0207648_10214032 | Ga0207648_102140322 | 260 |
| 468 | 3300026116 | Ga0207674_10037630 | Ga0207674_100376304 | 260 |
| 469 | 3300026118 | Ga0207675_100188811 | Ga0207675_1001888114 | 260 |
| 470 | 3300026121 | Ga0207683_10320868 | Ga0207683_103208682 | 260 |
| 471 | 3300026142 | Ga0207698_10001252 | Ga0207698_100012529 | 260 |
| 472 | 3300026142 | Ga0207698_10016340 | Ga0207698_100163405 | 260 |
| 473 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001932 | 260 |
| 474 | 3300028379 | Ga0268266_10000075 | Ga0268266_100000756 | 260 |
| 475 | 3300028381 | Ga0268264_10079476 | Ga0268264_100794763 | 260 |
| 476 | 3300028381 | Ga0268264_10413772 | Ga0268264_104137722 | 260 |
| 477 | 3300032004 | Ga0307414_10020692 | Ga0307414_100206924 | 260 |
| 478 | 3300033180 | Ga0307510_10002367 | Ga0307510_1000236712 | 260 |
| 479 | 3300033180 | Ga0307510_10043003 | Ga0307510_100430037 | 260 |
| 480 | 3300035695 | Ga0373927_0171026 | Ga0373927_0171026_86_901 | 260 |
| 481 | 3300037068 | Ga0373925_0004492 | Ga0373925_0004492_2006_2812 | 260 |
| 482 | 3300037312 | Ga0395899_0000089 | Ga0395899_0000089_120824_121633 | 260 |
| 483 | 3300037312 | Ga0395899_0004035 | Ga0395899_0004035_584_1393 | 260 |
| 484 | 3300037418 | Ga0395900_0000029 | Ga0395900_0000029_206249_207058 | 260 |
| 485 | 3300037466 | Ga0395898_0000018 | Ga0395898_0000018_89744_90553 | 260 |
| 486 | 3300037466 | Ga0395898_0000241 | Ga0395898_0000241_111644_112453 | 260 |
| 487 | 3300037466 | Ga0395898_0029429 | Ga0395898_0029429_2900_3706 | 260 |
| 488 | 3300038443 | Ga0395901_0021565 | Ga0395901_0021565_3141_3947 | 260 |
| 489 | 3300038443 | Ga0395901_0105859 | Ga0395901_0105859_1242_2051 | 260 |
| 490 | 3300038443 | Ga0395901_0172895 | Ga0395901_0172895_216_1025 | 260 |
| 491 | 3300042876 | Ga0451577_0112809 | Ga0451577_0112809_951_1754 | 260 |
| 492 | 3300044656 | Ga0466969_0006829 | Ga0466969_0006829_4218_5030 | 260 |
| 493 | 3300044684 | Ga0466966_0021050 | Ga0466966_0021050_2435_3247 | 260 |
| 494 | 3300044693 | Ga0466961_0000345 | Ga0466961_0000345_3512_4342 | 260 |
| 495 | 3300044693 | Ga0466961_0004106 | Ga0466961_0004106_5735_6556 | 260 |
| 496 | 3300044693 | Ga0466961_0005564 | Ga0466961_0005564_3463_4272 | 260 |
| 497 | 3300044693 | Ga0466961_0012072 | Ga0466961_0012072_1193_2005 | 260 |
| 498 | 3300044694 | Ga0466963_0183809 | Ga0466963_0183809_209_1006 | 260 |
| 499 | 3300044706 | Ga0466964_0014408 | Ga0466964_0014408_617_1426 | 260 |
| 500 | 3300044719 | Ga0466971_0045353 | Ga0466971_0045353_526_1347 | 260 |
| 501 | 3300044765 | Ga0466970_0014316 | Ga0466970_0014316_2068_2877 | 260 |
| 502 | 3300044765 | Ga0466970_0025429 | Ga0466970_0025429_1418_2230 | 260 |
| 503 | 3300044765 | Ga0466970_0058137 | Ga0466970_0058137_856_1668 | 260 |
| 504 | 3300044842 | Ga0466957_0017384 | Ga0466957_0017384_1329_2138 | 260 |
| 505 | 3300044842 | Ga0466957_0049457 | Ga0466957_0049457_147_968 | 260 |
| 506 | 3300045049 | Ga0466959_0000148 | Ga0466959_0000148_39976_40788 | 260 |
| 507 | 3300045049 | Ga0466959_0002116 | Ga0466959_0002116_8933_9745 | 260 |
| 508 | 3300045049 | Ga0466959_0042263 | Ga0466959_0042263_2017_2826 | 260 |
| 509 | 3300045051 | Ga0451576_0012042 | Ga0451576_0012042_6715_7521 | 260 |
| 510 | 3300045836 | Ga0466958_0006082 | Ga0466958_0006082_2446_3276 | 260 |
| 511 | 3300045836 | Ga0466958_0008710 | Ga0466958_0008710_3483_4304 | 260 |
| 512 | 3300045836 | Ga0466958_0051309 | Ga0466958_0051309_59_871 | 260 |
| 513 | 3300045836 | Ga0466958_0079594 | Ga0466958_0079594_1133_1945 | 260 |
| 514 | 3300045976 | Ga0466967_0588574 | Ga0466967_0588574_166_984 | 260 |
| 515 | 3300046460 | Ga0495638_0000100 | Ga0495638_0000100_131698_132501 | 260 |
| 516 | 3300046471 | Ga0495650_0000350 | Ga0495650_0000350_2988_3800 | 260 |
| 517 | 3300046507 | Ga0495606_0019290 | Ga0495606_0019290_1297_2094 | 260 |
| 518 | 3300046507 | Ga0495606_0098211 | Ga0495606_0098211_439_1251 | 260 |
| 519 | 3300046535 | Ga0495586_0203576 | Ga0495586_0203576_66_875 | 260 |
| 520 | 3300046539 | Ga0495621_0010415 | Ga0495621_0010415_1518_2339 | 260 |
| 521 | 3300046660 | Ga0495625_0126762 | Ga0495625_0126762_506_1315 | 260 |
| 522 | 3300048914 | Ga0496111_0012685 | Ga0496111_0012685_1219_2025 | 260 |
| 523 | 3300048919 | Ga0496116_0041704 | Ga0496116_0041704_1545_2351 | 260 |
| 524 | 3300048920 | Ga0496117_0000056 | Ga0496117_0000056_11145_11942 | 260 |
| 525 | 3300048921 | Ga0496118_0000047 | Ga0496118_0000047_259476_260273 | 260 |
| 526 | 3300048921 | Ga0496118_0097839 | Ga0496118_0097839_929_1738 | 260 |
| 527 | 3300048924 | Ga0496121_0005984 | Ga0496121_0005984_3654_4463 | 260 |
| 528 | 3300048924 | Ga0496121_0023487 | Ga0496121_0023487_2147_2953 | 260 |
| 529 | 3300048924 | Ga0496121_0039863 | Ga0496121_0039863_780_1589 | 260 |
| 530 | 3300048925 | Ga0496122_0005330 | Ga0496122_0005330_7624_8430 | 260 |
| 531 | 3300048926 | Ga0496123_0001547 | Ga0496123_0001547_19772_20578 | 260 |
| 532 | 3300048929 | Ga0496126_0005938 | Ga0496126_0005938_5434_6243 | 260 |
| 533 | 3300048929 | Ga0496126_0202223 | Ga0496126_0202223_857_1660 | 260 |
| 534 | 3300048929 | Ga0496126_0211577 | Ga0496126_0211577_160_963 | 260 |
| 535 | 3300049460 | Ga0495682_0001690 | Ga0495682_0001690_770_1567 | 260 |
| 536 | 3300049570 | Ga0501033_0011789 | Ga0501033_0011789_2580_3383 | 260 |
| 537 | 3300049571 | Ga0501034_0046470 | Ga0501034_0046470_2834_3631 | 260 |
| 538 | 3300049572 | Ga0501036_0093793 | Ga0501036_0093793_582_1385 | 260 |
| 539 | 3300049579 | Ga0501043_0158767 | Ga0501043_0158767_209_1012 | 260 |
| 540 | 3300049580 | Ga0501046_0111214 | Ga0501046_0111214_450_1253 | 260 |
| 541 | 3300049581 | Ga0501047_0195408 | Ga0501047_0195408_818_1621 | 260 |
| 542 | 3300049582 | Ga0501048_0045725 | Ga0501048_0045725_1276_2079 | 260 |
| 543 | 3300049585 | Ga0501069_0000311 | Ga0501069_0000311_402_1202 | 260 |
| 544 | 3300049585 | Ga0501069_0033228 | Ga0501069_0033228_1399_2196 | 260 |
| 545 | 3300049586 | Ga0501070_0013742 | Ga0501070_0013742_1390_2196 | 260 |
| 546 | 3300049586 | Ga0501070_0052824 | Ga0501070_0052824_1613_2416 | 260 |
| 547 | 3300049586 | Ga0501070_0202134 | Ga0501070_0202134_577_1392 | 260 |
| 548 | 3300049587 | Ga0501071_0279886 | Ga0501071_0279886_136_1038 | 260 |
| 549 | 3300049589 | Ga0501073_0041674 | Ga0501073_0041674_299_1102 | 260 |
| 550 | 3300049589 | Ga0501073_0142861 | Ga0501073_0142861_54_857 | 260 |
| 551 | 3300049590 | Ga0501074_0026881 | Ga0501074_0026881_136_1038 | 260 |
| 552 | 3300049741 | Ga0501079_0208299 | Ga0501079_0208299_84_893 | 260 |
| 553 | 3300049742 | Ga0501080_0129633 | Ga0501080_0129633_458_1261 | 260 |
| 554 | 3300049742 | Ga0501080_0220634 | Ga0501080_0220634_448_1251 | 260 |
| 555 | 3300049742 | Ga0501080_0236532 | Ga0501080_0236532_241_1056 | 260 |
| 556 | 3300049822 | Ga0501035_0167333 | Ga0501035_0167333_621_1424 | 260 |
| 557 | 3300049823 | Ga0501044_0226598 | Ga0501044_0226598_797_1699 | 260 |
| 558 | 3300050493 | nmdc:mga0k408_19504_c1 | nmdc:mga0k408_19504_c1_2775_3575 | 260 |
| 559 | 3300050507 | nmdc:mga05p37_222849_c1 | nmdc:mga05p37_222849_c1_701_1543 | 260 |
| 560 | 3300053121 | Ga0500607_034153 | Ga0500607_034153_1240_2043 | 260 |
| 561 | 3300053177 | Ga0500636_0000139 | Ga0500636_0000139_5584_6387 | 260 |
| 562 | 3300053729 | Ga0500625_027477 | Ga0500625_027477_1770_2576 | 260 |
| 563 | 3300053729 | Ga0500625_151705 | Ga0500625_151705_16_822 | 260 |
| 564 | 3300054114 | Ga0501084_0547379 | Ga0501084_0547379_87_887 | 260 |
| 565 | iso_pu_bacteria | 2928963466 | 2928965832 | 260 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4m7o-assembly1.cif.gz_A | the crystal structure of a possible an iron-binding (periplasmic solute-binding) protein from staphylococcus epidermidis atcc 12228. | 0.851 | 3 | 252 |
| 5ad1-assembly1.cif.gz_A | a complex of the synthetic siderophore analogue fe(iii)-8-licam with the ceue periplasmic protein from campylobacter jejuni | 0.8385 | 4 | 252 |
| 5khl-assembly1.cif.gz_B | crystal structure of periplasmic heme binding protein hutb of vibrio cholerae | 0.8284 | 5 | 251 |
| 8bnw-assembly1.cif.gz_A | x-ray structure of the ceue homologue from parageobacillus thermoglucosidasius - apo form | 0.8276 | 3 | 252 |
| 5lwh-assembly1.cif.gz_A | ceue (y288f variant) a periplasmic protein from campylobacter jejuni. | 0.8273 | 4 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0F6_19_140_3.40.50.1980 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9025 | 5 | 121 | 3.40.50.1980 |
| 2r79A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8831 | 4 | 121 | 3.40.50.1980 |
| 2rg7D01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8826 | 5 | 121 | 3.40.50.1980 |
| 5y8bA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8731 | 3 | 121 | 3.40.50.1980 |
| 5khlB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.8689 | 5 | 121 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850T0U8-F1-model_v4 | ABC transporter substrate-binding protein | 0.987 | 135 | 252 |
|
| AF-A0A2M8E364-F1-model_v4 | Cobalamin-binding protein | 0.9864 | 135 | 255 |
|
| AF-A0A4Q6GJA2-F1-model_v4 | Cobalamin-binding protein | 0.9859 | 135 | 259 |
|
| AF-A0A257CXH8-F1-model_v4 | Cobalamin-binding protein | 0.9814 | 150 | 255 |
|
| AF-A0A1G0HXH0-F1-model_v4 | Cobalamin-binding protein | 0.979 | 3 | 259 |
GO:0071281
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar