F464030

General Info

Members Datasets Scaffolds Average Seq Length
563 281 552 279

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10019363|Ga0081538_100193634
Length 292
Sequence VPPAAPTTTIEARPAGDVAGAVPPAGRRRGRPGRLGDFVLRFVAGLVLVYLFIPIAVIVAFSFNDPSGKFNLTWRGFTLENWADPFRYSQLTDALWTSLQVAALSTAVSIVLGTLVAVALVRQRFAGDRFVETFLVLPLTAPEVVMGASLLTLFLDLGWNRGFGTIIVAHIAFEVSFVALTVRARVRGLDWTLEDAAMDLGATPLRTFVRVTLPLIVPGLVAAAMLSFALSLDDFIITYFNSGSTVTYPLYVNAATKASLPPQINVLATAILVVSLLLIGVITLWQRRRLRA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
8 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
9 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
10 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
11 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
12 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
13 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
167 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
168 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
178 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
179 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
189 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
190 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
214 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
234 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
266 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.05
Metatranscriptomes 0
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.85
Nodule 0.18
Rhizoplane 9.95
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 8.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001606 3300000546 Bacteria 3088
2 JGI24746J21847_1000754 3300001977 Bacteria 4961
3 JGI24739J22299_10050868 3300001989 Bacteria 1338
4 JGI24737J22298_10011958 3300001990 Bacteria 2835
5 JGI24735J21928_10039726 3300002067 Bacteria 1375
6 JGI24735J21928_10080908 3300002067 Bacteria 930
7 JGI24750J21931_1003472 3300002070 Bacteria 1886
8 JGI24748J21848_1003169 3300002074 Bacteria 1876
9 JGI24738J21930_10012502 3300002075 Bacteria 1854
10 JGI24744J21845_10009224 3300002077 Bacteria 2026
11 JGI24034J26672_10003678 3300002239 Bacteria 2142
12 JGI24742J22300_10000895 3300002244 Bacteria 4568
13 JGI24742J22300_10006496 3300002244 Bacteria 1931
14 JGI25407J50210_10002788 3300003373 Bacteria 4152
15 Ga0055540_1001265 3300003792 Bacteria 15402
16 Ga0055540_1003233 3300003792 Bacteria 7989
17 Ga0070658_10146594 3300005327 Bacteria 1974
18 Ga0070676_10006128 3300005328 Bacteria 6420
19 Ga0070690_100032591 3300005330 Bacteria 3256
20 Ga0070666_10109456 3300005335 Bacteria 1910
21 Ga0070680_100093908 3300005336 Bacteria 2486
22 Ga0070682_100001675 3300005337 Bacteria 12333
23 Ga0070682_100004943 3300005337 Bacteria 7405
24 Ga0070682_100098414 3300005337 Bacteria 1927
25 Ga0068868_100027591 3300005338 Bacteria 4332
26 Ga0068868_100348656 3300005338 Bacteria 1267
27 Ga0070689_100024508 3300005340 Bacteria 4526
28 Ga0070689_100166217 3300005340 Bacteria 1786
29 Ga0070687_100111196 3300005343 Bacteria 1551
30 Ga0070668_100002744 3300005347 Bacteria 12961
31 Ga0070668_100015363 3300005347 Bacteria 5722
32 Ga0070668_100021228 3300005347 Bacteria 4909
33 Ga0070668_100222472 3300005347 Bacteria 1557
34 Ga0070668_100235942 3300005347 Bacteria 1514
35 Ga0070668_100269444 3300005347 Bacteria 1419
36 Ga0070669_100001256 3300005353 Bacteria 18407
37 Ga0070669_100048926 3300005353 Bacteria 3086
38 Ga0070671_100000377 3300005355 Bacteria 30681
39 Ga0070671_100172316 3300005355 Bacteria 1831
40 Ga0070671_100188574 3300005355 Bacteria 1748
41 Ga0070674_100013812 3300005356 Bacteria 5002
42 Ga0070674_100096710 3300005356 Bacteria 2143
43 Ga0070674_100448354 3300005356 Bacteria 1064
44 Ga0070673_100347508 3300005364 Bacteria 1316
45 Ga0070688_100004621 3300005365 Bacteria 7189
46 Ga0070688_100278141 3300005365 Bacteria 1201
47 Ga0070659_100117868 3300005366 Bacteria 2147
48 Ga0070667_100000877 3300005367 Bacteria 27795
49 Ga0070667_100000920 3300005367 Bacteria 27197
50 Ga0070667_100011510 3300005367 Bacteria 7317
51 Ga0070667_100033349 3300005367 Bacteria 4303
52 Ga0070667_100146791 3300005367 Bacteria 2069
53 Ga0070667_100192780 3300005367 Bacteria 1806
54 Ga0070667_100360777 3300005367 Bacteria 1317
55 Ga0070709_10005837 3300005434 Bacteria 6674
56 Ga0070714_100216570 3300005435 Bacteria 1758
57 Ga0070710_10001503 3300005437 Bacteria 10991
58 Ga0070710_10006270 3300005437 Bacteria 5698
59 Ga0070701_10000925 3300005438 Bacteria 10625
60 Ga0070711_100000402 3300005439 Bacteria 22353
61 Ga0070711_100002219 3300005439 Bacteria 11011
62 Ga0070711_100257097 3300005439 Bacteria 1372
63 Ga0070705_100018678 3300005440 Bacteria 3638
64 Ga0070700_100003324 3300005441 Bacteria 8289
65 Ga0070700_100020360 3300005441 Bacteria 3841
66 Ga0070694_100001983 3300005444 Bacteria 12153
67 Ga0070694_100078682 3300005444 Bacteria 2287
68 Ga0070663_100016121 3300005455 Bacteria 4841
69 Ga0070663_100101718 3300005455 Bacteria 2145
70 Ga0070678_100001104 3300005456 Bacteria 14151
71 Ga0070678_100150304 3300005456 Bacteria 1875
72 Ga0070678_100544681 3300005456 Bacteria 1029
73 Ga0070662_100056379 3300005457 Bacteria 2852
74 Ga0068867_100000667 3300005459 Bacteria 22759
75 Ga0070685_10034403 3300005466 Bacteria 2854
76 Ga0068853_100002662 3300005539 Bacteria 13458
77 Ga0068853_100085164 3300005539 Bacteria 2770
78 Ga0068853_100413113 3300005539 Bacteria 1265
79 Ga0070686_100338491 3300005544 Bacteria 1127
80 Ga0070695_100023206 3300005545 Bacteria 3810
81 Ga0070696_100001988 3300005546 Bacteria 13423
82 Ga0070696_100012698 3300005546 Bacteria 5656
83 Ga0070693_100014972 3300005547 Bacteria 3987
84 Ga0070665_100018650 3300005548 Bacteria 6954
85 Ga0070665_100051243 3300005548 Bacteria 4140
86 Ga0070665_100070187 3300005548 Bacteria 3510
87 Ga0070704_100001144 3300005549 Bacteria 13849
88 Ga0070704_100009350 3300005549 Bacteria 5917
89 Ga0068854_100017292 3300005578 Bacteria 4823
90 Ga0068854_100140363 3300005578 Bacteria 1853
91 Ga0068859_100000115 3300005617 Bacteria 75584
92 Ga0068859_100040441 3300005617 Bacteria 4680
93 Ga0068864_100019318 3300005618 Bacteria 5697
94 Ga0068866_10000674 3300005718 Bacteria 15478
95 Ga0068866_10021299 3300005718 Bacteria 2985
96 Ga0068861_100005352 3300005719 Bacteria 8675
97 Ga0068861_100019362 3300005719 Bacteria 4862
98 Ga0068861_100034697 3300005719 Bacteria 3732
99 Ga0068861_100273518 3300005719 Bacteria 1451
100 Ga0068863_100000277 3300005841 Bacteria 53361
101 Ga0068863_100006312 3300005841 Bacteria 11635
102 Ga0068863_100377518 3300005841 Bacteria 1384
103 Ga0068858_100001285 3300005842 Bacteria 25947
104 Ga0068858_100017982 3300005842 Bacteria 6621
105 Ga0068858_100305868 3300005842 Bacteria 1517
106 Ga0068860_100000044 3300005843 Bacteria 225595
107 Ga0068860_100000775 3300005843 Bacteria 35961
108 Ga0068860_100113961 3300005843 Bacteria 2585
109 Ga0068860_100237325 3300005843 Bacteria 1773
110 Ga0068862_100000003 3300005844 Bacteria 369793
111 Ga0068862_100020969 3300005844 Bacteria 5460
112 Ga0081455_10004404 3300005937 Bacteria 15825
113 Ga0081455_10009266 3300005937 Bacteria 10140
114 Ga0081538_10001047 3300005981 Bacteria 29464
115 Ga0081538_10019363 3300005981 Bacteria 5061
116 Ga0081540_1066537 3300005983 Bacteria 1688
117 Ga0075365_10005584 3300006038 Bacteria 6801
118 Ga0075365_10010242 3300006038 Bacteria 5448
119 Ga0075365_10046700 3300006038 Bacteria 2844
120 Ga0075365_10076936 3300006038 Bacteria 2254
121 Ga0075368_10002237 3300006042 Bacteria 6291
122 Ga0075363_100001264 3300006048 Bacteria 9404
123 Ga0075363_100013723 3300006048 Bacteria 3939
124 Ga0075363_100094241 3300006048 Bacteria 1650
125 Ga0075363_100138244 3300006048 Bacteria 1370
126 Ga0075364_10006302 3300006051 Bacteria 6967
127 Ga0075364_10013146 3300006051 Bacteria 5079
128 Ga0075364_10019197 3300006051 Bacteria 4289
129 Ga0075364_10025107 3300006051 Bacteria 3791
130 Ga0075364_10025868 3300006051 Bacteria 3739
131 Ga0075364_10142166 3300006051 Bacteria 1615
132 Ga0075364_10147442 3300006051 Bacteria 1585
133 Ga0075364_10166259 3300006051 Bacteria 1490
134 Ga0075364_10307772 3300006051 Bacteria 1079
135 Ga0075364_10339236 3300006051 Bacteria 1024
136 Ga0070715_10010116 3300006163 Bacteria 3351
137 Ga0070716_100019645 3300006173 Bacteria 3533
138 Ga0070712_100001056 3300006175 Bacteria 16636
139 Ga0075362_10009197 3300006177 Bacteria 3810
140 Ga0075362_10018280 3300006177 Bacteria 2898
141 Ga0075367_10008353 3300006178 Bacteria 5363
142 Ga0075367_10110269 3300006178 Bacteria 1688
143 Ga0075367_10132367 3300006178 Bacteria 1542
144 Ga0075367_10297432 3300006178 Bacteria 1016
145 Ga0075369_10002033 3300006186 Bacteria 7127
146 Ga0075369_10008972 3300006186 Bacteria 3868
147 Ga0075369_10014404 3300006186 Bacteria 3158
148 Ga0075369_10022455 3300006186 Bacteria 2602
149 Ga0075369_10030208 3300006186 Bacteria 2281
150 Ga0075369_10137153 3300006186 Bacteria 1114
151 Ga0075370_10000913 3300006353 Bacteria 12127
152 Ga0075370_10034660 3300006353 Bacteria 2829
153 Ga0075370_10126345 3300006353 Bacteria 1491
154 Ga0068871_100183022 3300006358 Bacteria 1801
155 Ga0075428_100020199 3300006844 Bacteria 7377
156 Ga0075431_100347616 3300006847 Bacteria 1491
157 Ga0075429_100057329 3300006880 Bacteria 3391
158 Ga0068865_100021206 3300006881 Bacteria 4223
159 Ga0097620_100000115 3300006931 Bacteria 75584
160 Ga0097620_100040443 3300006931 Bacteria 4680
161 Ga0099795_10002078 3300007788 Bacteria 4600
162 Ga0105250_10016084 3300009092 Bacteria 3053
163 Ga0105250_10045199 3300009092 Bacteria 1765
164 Ga0111539_10001211 3300009094 Bacteria 34323
165 Ga0105245_10039889 3300009098 Bacteria 4181
166 Ga0105245_10084150 3300009098 Bacteria 2913
167 Ga0105245_10165840 3300009098 Bacteria 2100
168 Ga0105247_10000006 3300009101 Bacteria 416061
169 Ga0105247_10000963 3300009101 Bacteria 21722
170 Ga0105247_10186851 3300009101 Bacteria 1385
171 Ga0105243_10002663 3300009148 Bacteria 14835
172 Ga0105241_10643872 3300009174 Bacteria 962
173 Ga0105242_10000459 3300009176 Bacteria 32413
174 Ga0105242_10068447 3300009176 Bacteria 2937
175 Ga0105242_10555327 3300009176 Bacteria 1102
176 Ga0105248_10000062 3300009177 Bacteria 124366
177 Ga0105248_10003658 3300009177 Bacteria 17060
178 Ga0105248_10037831 3300009177 Bacteria 5399
179 Ga0105237_10000472 3300009545 Bacteria 57015
180 Ga0105237_10246511 3300009545 Bacteria 1788
181 Ga0105249_10000008 3300009553 Bacteria 341271
182 Ga0105249_10005042 3300009553 Bacteria 11379
183 Ga0105249_10030325 3300009553 Bacteria 4889
184 Ga0105239_10004121 3300010375 Bacteria 17467
185 Ga0105239_10045701 3300010375 Bacteria 4799
186 Ga0105246_10087742 3300011119 Bacteria 2234
187 Ga0105246_10181210 3300011119 Bacteria 1622
188 Ga0105246_10489610 3300011119 Bacteria 1042
189 Ga0157369_10514139 3300013105 Bacteria 1239
190 Ga0157378_10020555 3300013297 Bacteria 5805
191 Ga0157378_10246868 3300013297 Bacteria 1707
192 Ga0163162_10011983 3300013306 Bacteria 8456
193 Ga0163162_10050133 3300013306 Bacteria 4186
194 Ga0163162_10218452 3300013306 Bacteria 2036
195 Ga0157372_10156677 3300013307 Bacteria 2631
196 Ga0157375_10004926 3300013308 Bacteria 11611
197 Ga0157375_10365609 3300013308 Bacteria 1609
198 Ga0157375_10550681 3300013308 Bacteria 1315
199 Ga0157375_10600198 3300013308 Bacteria 1260
200 Ga0163163_10004804 3300014325 Bacteria 11602
201 Ga0163163_10103328 3300014325 Bacteria 2874
202 Ga0163163_10362572 3300014325 Bacteria 1506
203 Ga0157380_10028427 3300014326 Bacteria 4263
204 Ga0157380_10029054 3300014326 Bacteria 4224
205 Ga0157377_10046382 3300014745 Bacteria 2430
206 Ga0157379_10040857 3300014968 Bacteria 4140
207 Ga0157379_10246682 3300014968 Bacteria 1620
208 Ga0157376_10027668 3300014969 Bacteria 4497
209 Ga0163161_10002277 3300017792 Bacteria 13770
210 Ga0163161_10109229 3300017792 Bacteria 2066
211 Ga0209673_1015499 3300025273 Bacteria 2892
212 Ga0209051_1000652 3300025303 Bacteria 39235
213 Ga0209051_1001152 3300025303 Bacteria 24033
214 Ga0209051_1011577 3300025303 Bacteria 4343
215 Ga0209051_1068562 3300025303 Bacteria 1079
216 Ga0207653_10035070 3300025885 Bacteria 1631
217 Ga0207692_10069054 3300025898 Bacteria 1855
218 Ga0207642_10003323 3300025899 Bacteria 5058
219 Ga0207642_10229497 3300025899 Bacteria 1042
220 Ga0207710_10000025 3300025900 Bacteria 314658
221 Ga0207710_10007952 3300025900 Bacteria 4484
222 Ga0207688_10012942 3300025901 Bacteria 4534
223 Ga0207688_10014434 3300025901 Bacteria 4294
224 Ga0207647_10026548 3300025904 Bacteria 3788
225 Ga0207685_10007318 3300025905 Bacteria 3070
226 Ga0207645_10016970 3300025907 Bacteria 4810
227 Ga0207645_10027576 3300025907 Bacteria 3667
228 Ga0207684_10414351 3300025910 Bacteria 1158
229 Ga0207654_10040837 3300025911 Bacteria 2616
230 Ga0207671_10003210 3300025914 Bacteria 16463
231 Ga0207671_10043220 3300025914 Bacteria 3332
232 Ga0207693_10000381 3300025915 Bacteria 40785
233 Ga0207693_10002302 3300025915 Bacteria 16599
234 Ga0207693_10499466 3300025915 Bacteria 950
235 Ga0207663_10080844 3300025916 Bacteria 2126
236 Ga0207663_10090769 3300025916 Bacteria 2026
237 Ga0207660_10161642 3300025917 Bacteria 1728
238 Ga0207662_10065446 3300025918 Bacteria 2189
239 Ga0207681_10002490 3300025923 Bacteria 11697
240 Ga0207681_10020217 3300025923 Bacteria 4216
241 Ga0207687_10015282 3300025927 Bacteria 5030
242 Ga0207687_10279672 3300025927 Bacteria 1337
243 Ga0207644_10022743 3300025931 Bacteria 4286
244 Ga0207644_10130176 3300025931 Bacteria 1925
245 Ga0207644_10162263 3300025931 Bacteria 1738
246 Ga0207706_10003648 3300025933 Bacteria 14710
247 Ga0207706_10006665 3300025933 Bacteria 10677
248 Ga0207686_10110049 3300025934 Bacteria 1856
249 Ga0207709_10162181 3300025935 Bacteria 1560
250 Ga0207670_10003336 3300025936 Bacteria 8515
251 Ga0207670_10055581 3300025936 Bacteria 2676
252 Ga0207669_10005843 3300025937 Bacteria 5565
253 Ga0207669_10131874 3300025937 Bacteria 1719
254 Ga0207704_10004571 3300025938 Bacteria 6335
255 Ga0207665_10006892 3300025939 Bacteria 7521
256 Ga0207665_10073283 3300025939 Bacteria 2341
257 Ga0207691_10049194 3300025940 Bacteria 3863
258 Ga0207711_10000674 3300025941 Bacteria 33924
259 Ga0207711_10031826 3300025941 Bacteria 4456
260 Ga0207711_10103015 3300025941 Bacteria 2527
261 Ga0207689_10193168 3300025942 Bacteria 1680
262 Ga0207667_10232447 3300025949 Bacteria 1887
263 Ga0207667_10377345 3300025949 Bacteria 1445
264 Ga0207651_10150481 3300025960 Bacteria 1811
265 Ga0207712_10000011 3300025961 Bacteria 412321
266 Ga0207712_10008012 3300025961 Bacteria 6681
267 Ga0207712_10014006 3300025961 Bacteria 5146
268 Ga0207668_10000126 3300025972 Bacteria 54346
269 Ga0207668_10008233 3300025972 Bacteria 6213
270 Ga0207668_10116211 3300025972 Bacteria 2017
271 Ga0207640_10002814 3300025981 Bacteria 9328
272 Ga0207658_10000659 3300025986 Bacteria 30114
273 Ga0207658_10003144 3300025986 Bacteria 11814
274 Ga0207658_10010623 3300025986 Bacteria 6257
275 Ga0207658_10015777 3300025986 Bacteria 5186
276 Ga0207658_10042868 3300025986 Bacteria 3286
277 Ga0207658_10284360 3300025986 Bacteria 1419
278 Ga0207658_10392195 3300025986 Bacteria 1218
279 Ga0207703_10002416 3300026035 Bacteria 16220
280 Ga0207703_10165662 3300026035 Bacteria 1939
281 Ga0207639_10015418 3300026041 Bacteria 5393
282 Ga0207639_10143161 3300026041 Bacteria 1994
283 Ga0207678_10018514 3300026067 Bacteria 6116
284 Ga0207678_10024813 3300026067 Bacteria 5234
285 Ga0207678_10074158 3300026067 Bacteria 2916
286 Ga0207708_10011974 3300026075 Bacteria 6462
287 Ga0207708_10189939 3300026075 Bacteria 1634
288 Ga0207641_10003526 3300026088 Bacteria 13849
289 Ga0207641_10035957 3300026088 Bacteria 4131
290 Ga0207648_10000462 3300026089 Bacteria 45206
291 Ga0207648_10137250 3300026089 Bacteria 2155
292 Ga0207648_10383884 3300026089 Bacteria 1270
293 Ga0207676_10126912 3300026095 Bacteria 2162
294 Ga0207675_100000121 3300026118 Bacteria 64369
295 Ga0207675_100403220 3300026118 Bacteria 1348
296 Ga0207683_10030490 3300026121 Bacteria 4673
297 Ga0207683_10043361 3300026121 Bacteria 3931
298 Ga0207683_10537045 3300026121 Bacteria 1081
299 Ga0209179_1015129 3300027512 Bacteria 1428
300 Ga0207428_10052593 3300027907 Bacteria 3251
301 Ga0268266_10045198 3300028379 Bacteria 3767
302 Ga0268266_10325688 3300028379 Bacteria 1439
303 Ga0268265_10000010 3300028380 Bacteria 370129
304 Ga0268265_10009066 3300028380 Bacteria 6728
305 Ga0268265_10399075 3300028380 Bacteria 1270
306 Ga0268264_10000007 3300028381 Bacteria 815790
307 Ga0268264_10013650 3300028381 Bacteria 6686
308 Ga0268264_10039666 3300028381 Bacteria 3891
309 Ga0307408_100178344 3300031548 Bacteria 1702
310 Ga0316576_10004986 3300031727 Bacteria 8042
311 Ga0316576_10006356 3300031727 Bacteria 7345
312 Ga0316576_10011527 3300031727 Bacteria 5798
313 Ga0316576_10030851 3300031727 Bacteria 3799
314 Ga0316576_10163686 3300031727 Bacteria 1678
315 Ga0316576_10198318 3300031727 Bacteria 1512
316 Ga0316576_10294630 3300031727 Bacteria 1213
317 Ga0316578_10006398 3300031728 Bacteria 5809
318 Ga0316578_10008093 3300031728 Bacteria 5323
319 Ga0316578_10073516 3300031728 Bacteria 2026
320 Ga0316577_10000477 3300031733 Bacteria 15769
321 Ga0316577_10059741 3300031733 Bacteria 2128
322 Ga0316577_10213245 3300031733 Unclassified 1091
323 Ga0307413_10461455 3300031824 Bacteria 1011
324 Ga0307409_100299666 3300031995 Bacteria 1495
325 Ga0373960_0014130 3300035121 Bacteria 2017
326 Ga0316574_0012327 3300035398 Bacteria 4889
327 Ga0373931_0038675 3300035691 Bacteria 2497
328 Ga0316582_0024982 3300036647 Bacteria 3581
329 Ga0316582_0027137 3300036647 Bacteria 3456
330 Ga0316582_0051663 3300036647 Unclassified 2609
331 Ga0316582_0528613 3300036647 Bacteria 813
332 Ga0316584_0003818 3300036712 Bacteria 9873
333 Ga0316584_0028672 3300036712 Bacteria 4107
334 Ga0316584_0085373 3300036712 Bacteria 2363
335 Ga0316584_0098091 3300036712 Bacteria 2194
336 Ga0316584_0284257 3300036712 Bacteria 1201
337 Ga0395901_0125265 3300038443 Bacteria 2700
338 Ga0400484_29055 3300038725 Bacteria 2065
339 Ga0400488_35109 3300038741 Bacteria 7488
340 Ga0400489_13660 3300039093 Bacteria 20514
341 Ga0439461_0011456 3300041410 Bacteria 1646
342 Ga0439466_0033241 3300041411 Bacteria 1753
343 Ga0439465_0002850 3300041413 Bacteria 5661
344 Ga0439465_0010146 3300041413 Bacteria 2960
345 Ga0439465_0012469 3300041413 Bacteria 2657
346 Ga0439465_0033045 3300041413 Bacteria 1653
347 Ga0451793_0421733 3300041452 Bacteria 1379
348 Ga0439431_0032489 3300041997 Bacteria 1301
349 Ga0439442_002837 3300042002 Bacteria 3408
350 Ga0439445_0061414 3300042004 Bacteria 1028
351 Ga0439463_003326 3300042016 Bacteria 4076
352 Ga0439434_0027583 3300042435 Bacteria 1717
353 Ga0439435_0027549 3300042436 Bacteria 1521
354 Ga0439464_0004018 3300042439 Bacteria 3744
355 Ga0451577_0499642 3300042876 Bacteria 1104
356 Ga0466969_0035790 3300044656 Bacteria 2510
357 Ga0466972_0005306 3300044658 Bacteria 6452
358 Ga0466972_0012281 3300044658 Bacteria 4304
359 Ga0466972_0028851 3300044658 Bacteria 2734
360 Ga0466972_0048667 3300044658 Bacteria 2048
361 Ga0466965_0004661 3300044683 Bacteria 6112
362 Ga0466965_0005902 3300044683 Bacteria 5529
363 Ga0466965_0011761 3300044683 Bacteria 4108
364 Ga0466965_0225586 3300044683 Bacteria 999
365 Ga0466966_0028007 3300044684 Bacteria 3671
366 Ga0453684_0007501 3300044712 Bacteria 20009
367 Ga0466971_0017065 3300044719 Bacteria 3209
368 Ga0466968_0004521 3300044735 Bacteria 5203
369 Ga0466968_0035928 3300044735 Bacteria 2075
370 Ga0466970_0236159 3300044765 Bacteria 1022
371 Ga0466957_0073751 3300044842 Bacteria 2115
372 Ga0466960_0220596 3300044901 Bacteria 1043
373 Ga0466959_0003572 3300045049 Bacteria 10233
374 Ga0466959_0065604 3300045049 Bacteria 2634
375 Ga0466967_0079991 3300045976 Bacteria 2948
376 Ga0466967_0157973 3300045976 Bacteria 2126
377 Ga0466967_0236002 3300045976 Bacteria 1743
378 Ga0495638_0004021 3300046460 Bacteria 11283
379 Ga0495638_0004986 3300046460 Bacteria 9958
380 Ga0495582_0159976 3300046473 Bacteria 1280
381 Ga0495583_0027253 3300046506 Bacteria 2822
382 Ga0495648_0000871 3300046524 Bacteria 31818
383 Ga0495654_0099640 3300046530 Bacteria 1339
384 Ga0495640_0012804 3300046533 Bacteria 6401
385 Ga0495611_0049970 3300046648 Bacteria 1883
386 Ga0495581_0026667 3300047315 Bacteria 3350
387 Ga0495672_0009613 3300047320 Bacteria 6980
388 Ga0495683_0171515 3300047323 Bacteria 997
389 Ga0495673_0002224 3300047469 Bacteria 13932
390 Ga0495686_0015167 3300047472 Bacteria 5276
391 Ga0495593_0036396 3300047673 Bacteria 2669
392 Ga0496100_0000898 3300048903 Bacteria 14185
393 Ga0496100_0001144 3300048903 Bacteria 12885
394 Ga0496100_0002625 3300048903 Bacteria 9165
395 Ga0496100_0006818 3300048903 Bacteria 6259
396 Ga0496100_0041044 3300048903 Bacteria 2947
397 Ga0496100_0079168 3300048903 Bacteria 2214
398 Ga0496101_0000002 3300048904 Bacteria 410971
399 Ga0496101_0000019 3300048904 Bacteria 220382
400 Ga0496101_0000065 3300048904 Bacteria 123942
401 Ga0496101_0001860 3300048904 Bacteria 12739
402 Ga0496101_0017197 3300048904 Bacteria 4901
403 Ga0496102_0000007 3300048905 Bacteria 417224
404 Ga0496102_0000009 3300048905 Bacteria 344149
405 Ga0496102_0000402 3300048905 Bacteria 50427
406 Ga0496102_0003421 3300048905 Bacteria 13464
407 Ga0496102_0009359 3300048905 Bacteria 8416
408 Ga0496102_0015316 3300048905 Bacteria 6677
409 Ga0496102_0078630 3300048905 Bacteria 3036
410 Ga0496102_0150449 3300048905 Bacteria 2187
411 Ga0496103_0000005 3300048906 Bacteria 505416
412 Ga0496103_0000013 3300048906 Bacteria 297928
413 Ga0496103_0000651 3300048906 Bacteria 26280
414 Ga0496103_0002747 3300048906 Bacteria 10980
415 Ga0496103_0012531 3300048906 Bacteria 5028
416 Ga0496103_0014397 3300048906 Bacteria 4697
417 Ga0496104_0005592 3300048907 Bacteria 11005
418 Ga0496104_0035752 3300048907 Bacteria 4640
419 Ga0496105_0311667 3300048908 Bacteria 1263
420 Ga0496105_0312261 3300048908 Bacteria 1262
421 Ga0496106_0034530 3300048909 Bacteria 3778
422 Ga0496106_0036376 3300048909 Bacteria 3683
423 Ga0496107_0001314 3300048910 Bacteria 15237
424 Ga0496107_0211200 3300048910 Bacteria 1443
425 Ga0496107_0513876 3300048910 Bacteria 888
426 Ga0496108_0001002 3300048911 Bacteria 22036
427 Ga0496108_0001176 3300048911 Bacteria 20414
428 Ga0496108_0012968 3300048911 Bacteria 6791
429 Ga0496108_0079484 3300048911 Bacteria 2777
430 Ga0496109_0000256 3300048912 Bacteria 51465
431 Ga0496109_0002094 3300048912 Bacteria 16583
432 Ga0496109_0028009 3300048912 Bacteria 5036
433 Ga0496110_0003864 3300048913 Bacteria 11545
434 Ga0496110_0024788 3300048913 Bacteria 5118
435 Ga0496110_0065815 3300048913 Bacteria 3204
436 Ga0496110_0499907 3300048913 Bacteria 1107
437 Ga0496111_0369266 3300048914 Bacteria 1062
438 Ga0496112_0004297 3300048915 Bacteria 12035
439 Ga0496113_0143035 3300048916 Bacteria 1883
440 Ga0496114_0000163 3300048917 Bacteria 47096
441 Ga0496114_0011976 3300048917 Bacteria 6938
442 Ga0496114_0034159 3300048917 Bacteria 4194
443 Ga0496114_0069680 3300048917 Bacteria 2953
444 Ga0496114_0214618 3300048917 Bacteria 1688
445 Ga0496115_0005463 3300048918 Bacteria 9245
446 Ga0496115_0034724 3300048918 Bacteria 3985
447 Ga0496116_0000033 3300048919 Bacteria 418191
448 Ga0496116_0000104 3300048919 Bacteria 193416
449 Ga0496116_0004723 3300048919 Bacteria 12867
450 Ga0496116_0007641 3300048919 Bacteria 9537
451 Ga0496117_0000019 3300048920 Bacteria 469256
452 Ga0496117_0000025 3300048920 Bacteria 418106
453 Ga0496117_0000190 3300048920 Bacteria 125026
454 Ga0496118_0000020 3300048921 Bacteria 470521
455 Ga0496118_0000023 3300048921 Bacteria 418106
456 Ga0496118_0002690 3300048921 Bacteria 23417
457 Ga0496119_0001596 3300048922 Bacteria 26957
458 Ga0496119_0002576 3300048922 Bacteria 19713
459 Ga0496119_0005617 3300048922 Bacteria 11926
460 Ga0496119_0006869 3300048922 Bacteria 10398
461 Ga0496119_0076611 3300048922 Bacteria 1940
462 Ga0496120_0000382 3300048923 Bacteria 71535
463 Ga0496120_0006548 3300048923 Bacteria 8901
464 Ga0496120_0010739 3300048923 Bacteria 6352
465 Ga0496121_0000027 3300048924 Bacteria 444747
466 Ga0496121_0000039 3300048924 Bacteria 351444
467 Ga0496121_0000064 3300048924 Bacteria 272488
468 Ga0496121_0001772 3300048924 Bacteria 35094
469 Ga0496122_0000295 3300048925 Bacteria 110220
470 Ga0496123_0004772 3300048926 Bacteria 14015
471 Ga0496123_0005919 3300048926 Bacteria 12045
472 Ga0496124_0000016 3300048927 Bacteria 444747
473 Ga0496124_0006919 3300048927 Bacteria 12188
474 Ga0496125_0000008 3300048928 Bacteria 704677
475 Ga0496125_0008540 3300048928 Bacteria 10705
476 Ga0496126_0000025 3300048929 Bacteria 444747
477 Ga0496126_0002244 3300048929 Bacteria 26663
478 Ga0496126_0007370 3300048929 Bacteria 12070
479 Ga0496126_0017449 3300048929 Bacteria 7151
480 Ga0496126_0029229 3300048929 Bacteria 5238
481 Ga0496126_0057686 3300048929 Bacteria 3503
482 Ga0501032_0009544 3300049569 Bacteria 7035
483 Ga0501034_0207450 3300049571 Bacteria 1915
484 Ga0501036_0003817 3300049572 Bacteria 12090
485 Ga0501036_0035685 3300049572 Bacteria 4207
486 Ga0501036_0298758 3300049572 Bacteria 1347
487 Ga0501037_0000060 3300049573 Bacteria 100831
488 Ga0501038_0043327 3300049574 Bacteria 3913
489 Ga0501038_0382188 3300049574 Bacteria 1092
490 Ga0501039_0001407 3300049575 Bacteria 17702
491 Ga0501039_0006999 3300049575 Bacteria 8587
492 Ga0501040_0006678 3300049576 Bacteria 7487
493 Ga0501041_0003973 3300049577 Bacteria 8533
494 Ga0501043_0002866 3300049579 Bacteria 14399
495 Ga0501043_0186455 3300049579 Bacteria 1615
496 Ga0501046_0003011 3300049580 Bacteria 15578
497 Ga0501048_0007282 3300049582 Bacteria 8389
498 Ga0501070_0019141 3300049586 Bacteria 5743
499 Ga0501070_0028628 3300049586 Bacteria 4672
500 Ga0501071_0052668 3300049587 Bacteria 2935
501 Ga0501072_0013533 3300049588 Bacteria 6243
502 Ga0501075_0004226 3300049591 Bacteria 9704
503 Ga0501075_0089430 3300049591 Bacteria 2335
504 Ga0501076_0006986 3300049592 Bacteria 8204
505 Ga0501079_0008238 3300049741 Bacteria 7899
506 Ga0501081_0022111 3300049743 Bacteria 4253
507 Ga0501081_0030497 3300049743 Bacteria 3650
508 Ga0501045_0004970 3300049824 Bacteria 9215
509 nmdc:mga03683_29313_c1 3300050489 Bacteria 2194
510 nmdc:mga03683_3615_c1 3300050489 Bacteria 5019
511 nmdc:mga03n38_15787_c1 3300050490 Bacteria 2923
512 nmdc:mga03n38_37999_c1 3300050490 Bacteria 2080
513 nmdc:mga03n38_4652_c1 3300050490 Bacteria 4577
514 nmdc:mga00v17_108641_c1 3300050491 Bacteria 1758
515 nmdc:mga00v17_11676_c1 3300050491 Bacteria 4831
516 nmdc:mga00v17_149942_c1 3300050491 Bacteria 1498
517 nmdc:mga00v17_16260_c1 3300050491 Bacteria 4193
518 nmdc:mga00v17_17329_c1 3300050491 Bacteria 4076
519 nmdc:mga00v17_228132_c1 3300050491 Bacteria 1206
520 nmdc:mga00v17_267353_c1 3300050491 Bacteria 1110
521 nmdc:mga00v17_3626_c1 3300050491 Bacteria 7978
522 nmdc:mga0yw44_1249_c1 3300050492 Bacteria 9989
523 nmdc:mga0yw44_314470_c1 3300050492 Bacteria 1051
524 nmdc:mga0yw44_79967_c1 3300050492 Bacteria 2046
525 nmdc:mga0yw44_90626_c1 3300050492 Bacteria 1932
526 nmdc:mga06z11_64147_c1 3300050494 Bacteria 1924
527 nmdc:mga04h51_2930_c1 3300050495 Bacteria 4102
528 nmdc:mga07m45_10187_c1 3300050496 Bacteria 4901
529 nmdc:mga07m45_211522_c1 3300050496 Bacteria 1128
530 nmdc:mga07m45_23323_c1 3300050496 Bacteria 3382
531 nmdc:mga07m45_3696_c1 3300050496 Bacteria 7402
532 nmdc:mga07m45_94238_c1 3300050496 Bacteria 1717
533 nmdc:mga05p37_189709_c1 3300050507 Bacteria 2496
534 nmdc:mga08y16_409133_c1 3300050511 Bacteria 1388
535 nmdc:mga0sz30_11803_c1 3300050516 Bacteria 3384
536 nmdc:mga0sz30_1185_c1 3300050516 Bacteria 9340
537 nmdc:mga0sz30_1263_c1 3300050516 Bacteria 9028
538 nmdc:mga0sz30_169484_c1 3300050516 Bacteria 968
539 nmdc:mga0sz30_1956_c1 3300050516 Bacteria 7364
540 nmdc:mga0sz30_29020_c1 3300050516 Bacteria 2278
541 nmdc:mga0sz30_52471_c1 3300050516 Bacteria 1731
542 nmdc:mga0sz30_59173_c1 3300050516 Bacteria 1634
543 Ga0495655_0045175 3300053083 Bacteria 1143
544 Ga0500652_000547 3300053131 Bacteria 13106
545 Ga0500568_0056487 3300053139 Bacteria 1530
546 Ga0500616_0025453 3300053153 Bacteria 3282
547 Ga0500627_0004430 3300053158 Bacteria 4513
548 Ga0500645_000035 3300053730 Bacteria 113679
549 Ga0501084_0017440 3300054114 Bacteria 5970
550 Ga0501082_0053197 3300060353 Bacteria 3490
551 Ga0530510_0003778 3300061734 Bacteria 10427
552 Ga0530510_0006827 3300061734 Bacteria 7953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038725 Ga0400484_29055 Ga0400484_29055_439_1239 222
2 3300038741 Ga0400488_35109 Ga0400488_35109_3222_4022 222
3 3300036647 Ga0316582_0528613 Ga0316582_0528613_51_797 223
4 3300044712 Ga0453684_0007501 Ga0453684_0007501_1224_2042 224
5 3300036712 Ga0316584_0098091 Ga0316584_0098091_102_854 225
6 3300036647 Ga0316582_0051663 Ga0316582_0051663_335_1123 228
7 3300031728 Ga0316578_10073516 Ga0316578_100735162 229
8 3300031733 Ga0316577_10059741 Ga0316577_100597412 229
9 3300039093 Ga0400489_13660 Ga0400489_13660_2937_3725 229
10 3300031727 Ga0316576_10006356 Ga0316576_100063563 230
11 3300031733 Ga0316577_10000477 Ga0316577_100004774 230
12 3300031727 Ga0316576_10163686 Ga0316576_101636862 232
13 3300031727 Ga0316576_10198318 Ga0316576_101983182 232
14 3300031727 Ga0316576_10004986 Ga0316576_100049861 233
15 3300031727 Ga0316576_10030851 Ga0316576_100308514 233
16 3300031728 Ga0316578_10006398 Ga0316578_100063983 233
17 3300035398 Ga0316574_0012327 Ga0316574_0012327_1738_2538 233
18 3300036647 Ga0316582_0024982 Ga0316582_0024982_1475_2275 233
19 3300036712 Ga0316584_0085373 Ga0316584_0085373_15_815 233
20 3300038443 Ga0395901_0125265 Ga0395901_0125265_712_1464 233
21 3300031727 Ga0316576_10294630 Ga0316576_102946302 235
22 3300031727 Ga0316576_10011527 Ga0316576_100115271 236
23 3300031728 Ga0316578_10008093 Ga0316578_100080932 236
24 3300031733 Ga0316577_10213245 Ga0316577_102132451 236
25 3300036712 Ga0316584_0003818 Ga0316584_0003818_9033_9824 236
26 3300026121 Ga0207683_10537045 Ga0207683_105370452 238
27 3300009098 Ga0105245_10084150 Ga0105245_100841504 239
28 3300025927 Ga0207687_10279672 Ga0207687_102796722 239
29 3300036647 Ga0316582_0027137 Ga0316582_0027137_1090_1878 240
30 3300036712 Ga0316584_0284257 Ga0316584_0284257_268_1056 240
31 3300006186 Ga0075369_10137153 Ga0075369_101371533 242
32 3300048903 Ga0496100_0041044 Ga0496100_0041044_1877_2620 247
33 3300048904 Ga0496101_0000002 Ga0496101_0000002_257717_258460 247
34 3300048905 Ga0496102_0000009 Ga0496102_0000009_327434_328177 247
35 3300048906 Ga0496103_0000005 Ga0496103_0000005_488701_489444 247
36 3300048919 Ga0496116_0000104 Ga0496116_0000104_16134_16877 247
37 3300048920 Ga0496117_0000019 Ga0496117_0000019_141080_141823 247
38 3300048921 Ga0496118_0000020 Ga0496118_0000020_327434_328177 247
39 3300048922 Ga0496119_0005617 Ga0496119_0005617_7102_7845 247
40 3300048923 Ga0496120_0006548 Ga0496120_0006548_6974_7717 247
41 3300048924 Ga0496121_0000064 Ga0496121_0000064_129332_130075 247
42 3300048929 Ga0496126_0002244 Ga0496126_0002244_3793_4536 247
43 3300042876 Ga0451577_0499642 Ga0451577_0499642_259_1065 248
44 3300009094 Ga0111539_10001211 Ga0111539_1000121131 250
45 3300044656 Ga0466969_0035790 Ga0466969_0035790_41_850 255
46 3300061734 Ga0530510_0006827 Ga0530510_0006827_6258_7130 255
47 3300006051 Ga0075364_10142166 Ga0075364_101421662 257
48 3300048926 Ga0496123_0005919 Ga0496123_0005919_10799_11629 259
49 3300048929 Ga0496126_0029229 Ga0496126_0029229_2775_3605 259
50 3300036712 Ga0316584_0028672 Ga0316584_0028672_1837_2700 260
51 3300044658 Ga0466972_0048667 Ga0466972_0048667_714_1553 260
52 3300045976 Ga0466967_0236002 Ga0466967_0236002_120_959 260
53 3300046460 Ga0495638_0004986 Ga0495638_0004986_5576_6436 261
54 3300053139 Ga0500568_0056487 Ga0500568_0056487_446_1306 261
55 3300005367 Ga0070667_100000877 Ga0070667_10000087725 262
56 3300050491 nmdc:mga00v17_11676_c1 nmdc:mga00v17_11676_c1_3884_4747 262
57 3300050491 nmdc:mga00v17_228132_c1 nmdc:mga00v17_228132_c1_31_894 262
58 3300025986 Ga0207658_10003144 Ga0207658_100031444 263
59 3300048905 Ga0496102_0078630 Ga0496102_0078630_810_1664 263
60 3300053083 Ga0495655_0045175 Ga0495655_0045175_108_902 264
61 3300049586 Ga0501070_0019141 Ga0501070_0019141_3897_4742 266
62 3300050491 nmdc:mga00v17_108641_c1 nmdc:mga00v17_108641_c1_633_1460 266
63 3300050516 nmdc:mga0sz30_169484_c1 nmdc:mga0sz30_169484_c1_141_953 270
64 3300025949 Ga0207667_10377345 Ga0207667_103773452 272
65 3300049572 Ga0501036_0298758 Ga0501036_0298758_189_1058 272
66 3300049591 Ga0501075_0089430 Ga0501075_0089430_328_1197 272
67 3300049743 Ga0501081_0022111 Ga0501081_0022111_3019_3888 272
68 3300031824 Ga0307413_10461455 Ga0307413_104614551 273
69 3300048910 Ga0496107_0513876 Ga0496107_0513876_12_836 273
70 iso_pu_bacteria 2902810491 2902810832 273
71 3300044658 Ga0466972_0012281 Ga0466972_0012281_3371_4201 275
72 3300044683 Ga0466965_0004661 Ga0466965_0004661_2040_2870 275
73 3300044735 Ga0466968_0004521 Ga0466968_0004521_481_1311 275
74 3300044842 Ga0466957_0073751 Ga0466957_0073751_772_1602 275
75 3300044901 Ga0466960_0220596 Ga0466960_0220596_192_1022 275
76 3300045049 Ga0466959_0065604 Ga0466959_0065604_1560_2390 275
77 3300045976 Ga0466967_0157973 Ga0466967_0157973_418_1248 275
78 3300050496 nmdc:mga07m45_23323_c1 nmdc:mga07m45_23323_c1_1831_2658 275
79 3300050516 nmdc:mga0sz30_29020_c1 nmdc:mga0sz30_29020_c1_153_980 275
80 3300009545 Ga0105237_10000472 Ga0105237_100004721 277
81 3300010375 Ga0105239_10004121 Ga0105239_1000412118 277
82 3300025914 Ga0207671_10003210 Ga0207671_1000321018 277
83 3300027907 Ga0207428_10052593 Ga0207428_100525933 277
84 3300031995 Ga0307409_100299666 Ga0307409_1002996662 277
85 3300041410 Ga0439461_0011456 Ga0439461_0011456_460_1296 277
86 3300041413 Ga0439465_0002850 Ga0439465_0002850_1126_1962 277
87 3300041997 Ga0439431_0032489 Ga0439431_0032489_432_1268 277
88 3300042435 Ga0439434_0027583 Ga0439434_0027583_638_1474 277
89 iso_pu_bacteria 2902837492 2902843606 277
90 3300005335 Ga0070666_10109456 Ga0070666_101094562 278
91 3300048903 Ga0496100_0000898 Ga0496100_0000898_437_1291 278
92 3300048904 Ga0496101_0000065 Ga0496101_0000065_26710_27564 278
93 3300048906 Ga0496103_0000651 Ga0496103_0000651_13535_14389 278
94 3300048911 Ga0496108_0001176 Ga0496108_0001176_8842_9696 278
95 3300048912 Ga0496109_0000256 Ga0496109_0000256_13823_14677 278
96 3300048913 Ga0496110_0003864 Ga0496110_0003864_8011_8865 278
97 3300048917 Ga0496114_0000163 Ga0496114_0000163_19401_20255 278
98 3300048917 Ga0496114_0011976 Ga0496114_0011976_1535_2371 278
99 3300048919 Ga0496116_0004723 Ga0496116_0004723_4003_4857 278
100 3300048922 Ga0496119_0006869 Ga0496119_0006869_6467_7321 278
101 3300048924 Ga0496121_0000027 Ga0496121_0000027_116984_117838 278
102 3300048925 Ga0496122_0000295 Ga0496122_0000295_43635_44489 278
103 3300048926 Ga0496123_0004772 Ga0496123_0004772_1585_2439 278
104 3300048927 Ga0496124_0000016 Ga0496124_0000016_116984_117838 278
105 3300048928 Ga0496125_0000008 Ga0496125_0000008_116984_117838 278
106 3300048929 Ga0496126_0000025 Ga0496126_0000025_116984_117838 278
107 3300050511 nmdc:mga08y16_409133_c1 nmdc:mga08y16_409133_c1_228_1085 278
108 3300003373 JGI25407J50210_10002788 JGI25407J50210_100027882 279
109 3300005981 Ga0081538_10001047 Ga0081538_1000104715 279
110 3300006051 Ga0075364_10006302 Ga0075364_100063028 279
111 3300006178 Ga0075367_10297432 Ga0075367_102974321 279
112 3300041413 Ga0439465_0012469 Ga0439465_0012469_1520_2359 279
113 3300047323 Ga0495683_0171515 Ga0495683_0171515_36_875 279
114 3300048922 Ga0496119_0076611 Ga0496119_0076611_378_1217 279
115 3300050516 nmdc:mga0sz30_1185_c1 nmdc:mga0sz30_1185_c1_4751_5590 279
116 iso_pu_bacteria 2643221715 2644633926 279
117 3300001977 JGI24746J21847_1000754 JGI24746J21847_10007545 280
118 3300001989 JGI24739J22299_10050868 JGI24739J22299_100508682 280
119 3300001990 JGI24737J22298_10011958 JGI24737J22298_100119582 280
120 3300002067 JGI24735J21928_10039726 JGI24735J21928_100397262 280
121 3300002067 JGI24735J21928_10080908 JGI24735J21928_100809081 280
122 3300002070 JGI24750J21931_1003472 JGI24750J21931_10034722 280
123 3300002074 JGI24748J21848_1003169 JGI24748J21848_10031692 280
124 3300002075 JGI24738J21930_10012502 JGI24738J21930_100125022 280
125 3300002077 JGI24744J21845_10009224 JGI24744J21845_100092243 280
126 3300002239 JGI24034J26672_10003678 JGI24034J26672_100036783 280
127 3300002244 JGI24742J22300_10000895 JGI24742J22300_100008956 280
128 3300002244 JGI24742J22300_10006496 JGI24742J22300_100064962 280
129 3300005328 Ga0070676_10006128 Ga0070676_100061289 280
130 3300005330 Ga0070690_100032591 Ga0070690_1000325912 280
131 3300005336 Ga0070680_100093908 Ga0070680_1000939082 280
132 3300005337 Ga0070682_100004943 Ga0070682_1000049432 280
133 3300005338 Ga0068868_100027591 Ga0068868_1000275917 280
134 3300005338 Ga0068868_100348656 Ga0068868_1003486562 280
135 3300005340 Ga0070689_100024508 Ga0070689_1000245084 280
136 3300005340 Ga0070689_100166217 Ga0070689_1001662171 280
137 3300005343 Ga0070687_100111196 Ga0070687_1001111962 280
138 3300005347 Ga0070668_100002744 Ga0070668_1000027442 280
139 3300005347 Ga0070668_100021228 Ga0070668_1000212285 280
140 3300005347 Ga0070668_100222472 Ga0070668_1002224722 280
141 3300005347 Ga0070668_100235942 Ga0070668_1002359421 280
142 3300005347 Ga0070668_100269444 Ga0070668_1002694442 280
143 3300005353 Ga0070669_100048926 Ga0070669_1000489263 280
144 3300005355 Ga0070671_100000377 Ga0070671_10000037726 280
145 3300005355 Ga0070671_100188574 Ga0070671_1001885742 280
146 3300005356 Ga0070674_100013812 Ga0070674_1000138122 280
147 3300005356 Ga0070674_100096710 Ga0070674_1000967102 280
148 3300005364 Ga0070673_100347508 Ga0070673_1003475082 280
149 3300005365 Ga0070688_100004621 Ga0070688_1000046212 280
150 3300005365 Ga0070688_100278141 Ga0070688_1002781412 280
151 3300005366 Ga0070659_100117868 Ga0070659_1001178682 280
152 3300005367 Ga0070667_100011510 Ga0070667_1000115106 280
153 3300005367 Ga0070667_100033349 Ga0070667_1000333492 280
154 3300005367 Ga0070667_100146791 Ga0070667_1001467912 280
155 3300005367 Ga0070667_100192780 Ga0070667_1001927803 280
156 3300005434 Ga0070709_10005837 Ga0070709_100058374 280
157 3300005435 Ga0070714_100216570 Ga0070714_1002165702 280
158 3300005437 Ga0070710_10001503 Ga0070710_100015036 280
159 3300005437 Ga0070710_10006270 Ga0070710_100062706 280
160 3300005438 Ga0070701_10000925 Ga0070701_100009256 280
161 3300005439 Ga0070711_100000402 Ga0070711_10000040225 280
162 3300005439 Ga0070711_100002219 Ga0070711_1000022194 280
163 3300005440 Ga0070705_100018678 Ga0070705_1000186784 280
164 3300005441 Ga0070700_100003324 Ga0070700_1000033244 280
165 3300005441 Ga0070700_100020360 Ga0070700_1000203604 280
166 3300005444 Ga0070694_100001983 Ga0070694_1000019832 280
167 3300005444 Ga0070694_100078682 Ga0070694_1000786823 280
168 3300005455 Ga0070663_100016121 Ga0070663_1000161212 280
169 3300005455 Ga0070663_100101718 Ga0070663_1001017182 280
170 3300005456 Ga0070678_100001104 Ga0070678_10000110413 280
171 3300005456 Ga0070678_100150304 Ga0070678_1001503042 280
172 3300005457 Ga0070662_100056379 Ga0070662_1000563792 280
173 3300005459 Ga0068867_100000667 Ga0068867_10000066715 280
174 3300005466 Ga0070685_10034403 Ga0070685_100344033 280
175 3300005539 Ga0068853_100085164 Ga0068853_1000851642 280
176 3300005539 Ga0068853_100413113 Ga0068853_1004131132 280
177 3300005544 Ga0070686_100338491 Ga0070686_1003384912 280
178 3300005545 Ga0070695_100023206 Ga0070695_1000232064 280
179 3300005546 Ga0070696_100001988 Ga0070696_1000019887 280
180 3300005546 Ga0070696_100012698 Ga0070696_1000126982 280
181 3300005547 Ga0070693_100014972 Ga0070693_1000149724 280
182 3300005548 Ga0070665_100051243 Ga0070665_1000512434 280
183 3300005548 Ga0070665_100070187 Ga0070665_1000701873 280
184 3300005549 Ga0070704_100001144 Ga0070704_10000114410 280
185 3300005549 Ga0070704_100009350 Ga0070704_1000093504 280
186 3300005578 Ga0068854_100017292 Ga0068854_1000172922 280
187 3300005578 Ga0068854_100140363 Ga0068854_1001403632 280
188 3300005617 Ga0068859_100040441 Ga0068859_1000404412 280
189 3300005618 Ga0068864_100019318 Ga0068864_1000193185 280
190 3300005718 Ga0068866_10000674 Ga0068866_1000067412 280
191 3300005718 Ga0068866_10021299 Ga0068866_100212992 280
192 3300005719 Ga0068861_100005352 Ga0068861_10000535211 280
193 3300005719 Ga0068861_100019362 Ga0068861_1000193625 280
194 3300005719 Ga0068861_100034697 Ga0068861_1000346972 280
195 3300005719 Ga0068861_100273518 Ga0068861_1002735182 280
196 3300005841 Ga0068863_100006312 Ga0068863_1000063126 280
197 3300005841 Ga0068863_100377518 Ga0068863_1003775182 280
198 3300005842 Ga0068858_100001285 Ga0068858_10000128519 280
199 3300005842 Ga0068858_100305868 Ga0068858_1003058683 280
200 3300005843 Ga0068860_100000775 Ga0068860_10000077528 280
201 3300005843 Ga0068860_100113961 Ga0068860_1001139612 280
202 3300005843 Ga0068860_100237325 Ga0068860_1002373253 280
203 3300005844 Ga0068862_100020969 Ga0068862_1000209696 280
204 3300005937 Ga0081455_10004404 Ga0081455_1000440410 280
205 3300005937 Ga0081455_10009266 Ga0081455_100092663 280
206 3300005981 Ga0081538_10019363 Ga0081538_100193634 280
207 3300005983 Ga0081540_1066537 Ga0081540_10665372 280
208 3300006038 Ga0075365_10005584 Ga0075365_100055849 280
209 3300006038 Ga0075365_10010242 Ga0075365_100102424 280
210 3300006038 Ga0075365_10046700 Ga0075365_100467003 280
211 3300006042 Ga0075368_10002237 Ga0075368_100022377 280
212 3300006048 Ga0075363_100001264 Ga0075363_10000126411 280
213 3300006048 Ga0075363_100013723 Ga0075363_1000137236 280
214 3300006048 Ga0075363_100094241 Ga0075363_1000942412 280
215 3300006051 Ga0075364_10013146 Ga0075364_100131464 280
216 3300006051 Ga0075364_10019197 Ga0075364_100191974 280
217 3300006051 Ga0075364_10025107 Ga0075364_100251072 280
218 3300006051 Ga0075364_10025868 Ga0075364_100258686 280
219 3300006051 Ga0075364_10166259 Ga0075364_101662592 280
220 3300006051 Ga0075364_10307772 Ga0075364_103077722 280
221 3300006163 Ga0070715_10010116 Ga0070715_100101162 280
222 3300006173 Ga0070716_100019645 Ga0070716_1000196454 280
223 3300006175 Ga0070712_100001056 Ga0070712_10000105612 280
224 3300006177 Ga0075362_10009197 Ga0075362_100091973 280
225 3300006177 Ga0075362_10018280 Ga0075362_100182803 280
226 3300006178 Ga0075367_10008353 Ga0075367_100083531 280
227 3300006178 Ga0075367_10110269 Ga0075367_101102693 280
228 3300006178 Ga0075367_10132367 Ga0075367_101323673 280
229 3300006186 Ga0075369_10002033 Ga0075369_100020336 280
230 3300006186 Ga0075369_10014404 Ga0075369_100144043 280
231 3300006186 Ga0075369_10022455 Ga0075369_100224554 280
232 3300006353 Ga0075370_10000913 Ga0075370_100009138 280
233 3300006353 Ga0075370_10034660 Ga0075370_100346603 280
234 3300006353 Ga0075370_10126345 Ga0075370_101263452 280
235 3300006358 Ga0068871_100183022 Ga0068871_1001830223 280
236 3300006844 Ga0075428_100020199 Ga0075428_1000201994 280
237 3300006847 Ga0075431_100347616 Ga0075431_1003476162 280
238 3300006880 Ga0075429_100057329 Ga0075429_1000573293 280
239 3300006881 Ga0068865_100021206 Ga0068865_1000212065 280
240 3300006931 Ga0097620_100040443 Ga0097620_1000404432 280
241 3300007788 Ga0099795_10002078 Ga0099795_100020784 280
242 3300009092 Ga0105250_10016084 Ga0105250_100160844 280
243 3300009092 Ga0105250_10045199 Ga0105250_100451992 280
244 3300009098 Ga0105245_10039889 Ga0105245_100398895 280
245 3300009098 Ga0105245_10165840 Ga0105245_101658402 280
246 3300009101 Ga0105247_10000963 Ga0105247_1000096312 280
247 3300009101 Ga0105247_10186851 Ga0105247_101868512 280
248 3300009148 Ga0105243_10002663 Ga0105243_100026637 280
249 3300009174 Ga0105241_10643872 Ga0105241_106438721 280
250 3300009176 Ga0105242_10000459 Ga0105242_1000045934 280
251 3300009176 Ga0105242_10555327 Ga0105242_105553272 280
252 3300009177 Ga0105248_10003658 Ga0105248_100036589 280
253 3300009545 Ga0105237_10246511 Ga0105237_102465113 280
254 3300009553 Ga0105249_10005042 Ga0105249_1000504214 280
255 3300009553 Ga0105249_10030325 Ga0105249_100303254 280
256 3300010375 Ga0105239_10045701 Ga0105239_100457014 280
257 3300011119 Ga0105246_10087742 Ga0105246_100877422 280
258 3300011119 Ga0105246_10489610 Ga0105246_104896102 280
259 3300013105 Ga0157369_10514139 Ga0157369_105141392 280
260 3300013297 Ga0157378_10020555 Ga0157378_100205553 280
261 3300013297 Ga0157378_10246868 Ga0157378_102468682 280
262 3300013306 Ga0163162_10011983 Ga0163162_100119838 280
263 3300013306 Ga0163162_10050133 Ga0163162_100501332 280
264 3300013307 Ga0157372_10156677 Ga0157372_101566772 280
265 3300013308 Ga0157375_10004926 Ga0157375_1000492618 280
266 3300014325 Ga0163163_10362572 Ga0163163_103625722 280
267 3300014326 Ga0157380_10028427 Ga0157380_100284274 280
268 3300014326 Ga0157380_10029054 Ga0157380_100290543 280
269 3300014745 Ga0157377_10046382 Ga0157377_100463822 280
270 3300014968 Ga0157379_10246682 Ga0157379_102466822 280
271 3300014969 Ga0157376_10027668 Ga0157376_100276684 280
272 3300017792 Ga0163161_10002277 Ga0163161_1000227710 280
273 3300017792 Ga0163161_10109229 Ga0163161_101092292 280
274 3300025885 Ga0207653_10035070 Ga0207653_100350702 280
275 3300025898 Ga0207692_10069054 Ga0207692_100690542 280
276 3300025899 Ga0207642_10003323 Ga0207642_100033236 280
277 3300025899 Ga0207642_10229497 Ga0207642_102294972 280
278 3300025900 Ga0207710_10007952 Ga0207710_100079524 280
279 3300025901 Ga0207688_10012942 Ga0207688_100129424 280
280 3300025901 Ga0207688_10014434 Ga0207688_100144342 280
281 3300025904 Ga0207647_10026548 Ga0207647_100265483 280
282 3300025905 Ga0207685_10007318 Ga0207685_100073182 280
283 3300025907 Ga0207645_10016970 Ga0207645_100169704 280
284 3300025907 Ga0207645_10027576 Ga0207645_100275762 280
285 3300025911 Ga0207654_10040837 Ga0207654_100408371 280
286 3300025914 Ga0207671_10043220 Ga0207671_100432203 280
287 3300025915 Ga0207693_10000381 Ga0207693_1000038133 280
288 3300025915 Ga0207693_10002302 Ga0207693_1000230217 280
289 3300025916 Ga0207663_10080844 Ga0207663_100808442 280
290 3300025916 Ga0207663_10090769 Ga0207663_100907693 280
291 3300025917 Ga0207660_10161642 Ga0207660_101616422 280
292 3300025918 Ga0207662_10065446 Ga0207662_100654462 280
293 3300025923 Ga0207681_10020217 Ga0207681_100202173 280
294 3300025927 Ga0207687_10015282 Ga0207687_100152827 280
295 3300025931 Ga0207644_10022743 Ga0207644_100227434 280
296 3300025931 Ga0207644_10130176 Ga0207644_101301762 280
297 3300025933 Ga0207706_10003648 Ga0207706_1000364817 280
298 3300025933 Ga0207706_10006665 Ga0207706_100066658 280
299 3300025934 Ga0207686_10110049 Ga0207686_101100492 280
300 3300025935 Ga0207709_10162181 Ga0207709_101621812 280
301 3300025936 Ga0207670_10003336 Ga0207670_100033366 280
302 3300025936 Ga0207670_10055581 Ga0207670_100555812 280
303 3300025937 Ga0207669_10005843 Ga0207669_100058433 280
304 3300025938 Ga0207704_10004571 Ga0207704_100045713 280
305 3300025939 Ga0207665_10006892 Ga0207665_100068924 280
306 3300025939 Ga0207665_10073283 Ga0207665_100732833 280
307 3300025940 Ga0207691_10049194 Ga0207691_100491944 280
308 3300025941 Ga0207711_10031826 Ga0207711_100318266 280
309 3300025942 Ga0207689_10193168 Ga0207689_101931682 280
310 3300025949 Ga0207667_10232447 Ga0207667_102324472 280
311 3300025960 Ga0207651_10150481 Ga0207651_101504812 280
312 3300025961 Ga0207712_10008012 Ga0207712_100080126 280
313 3300025961 Ga0207712_10014006 Ga0207712_100140064 280
314 3300025972 Ga0207668_10000126 Ga0207668_1000012622 280
315 3300025972 Ga0207668_10116211 Ga0207668_101162112 280
316 3300025981 Ga0207640_10002814 Ga0207640_100028146 280
317 3300025986 Ga0207658_10010623 Ga0207658_100106235 280
318 3300025986 Ga0207658_10015777 Ga0207658_100157774 280
319 3300025986 Ga0207658_10042868 Ga0207658_100428685 280
320 3300025986 Ga0207658_10392195 Ga0207658_103921952 280
321 3300026035 Ga0207703_10002416 Ga0207703_100024166 280
322 3300026041 Ga0207639_10143161 Ga0207639_101431613 280
323 3300026067 Ga0207678_10018514 Ga0207678_100185142 280
324 3300026067 Ga0207678_10074158 Ga0207678_100741583 280
325 3300026075 Ga0207708_10011974 Ga0207708_100119748 280
326 3300026075 Ga0207708_10189939 Ga0207708_101899393 280
327 3300026088 Ga0207641_10003526 Ga0207641_100035268 280
328 3300026089 Ga0207648_10000462 Ga0207648_1000046215 280
329 3300026089 Ga0207648_10137250 Ga0207648_101372503 280
330 3300026095 Ga0207676_10126912 Ga0207676_101269123 280
331 3300026118 Ga0207675_100000121 Ga0207675_1000001212 280
332 3300026118 Ga0207675_100403220 Ga0207675_1004032202 280
333 3300026121 Ga0207683_10030490 Ga0207683_100304902 280
334 3300026121 Ga0207683_10043361 Ga0207683_100433612 280
335 3300027512 Ga0209179_1015129 Ga0209179_10151292 280
336 3300028379 Ga0268266_10045198 Ga0268266_100451982 280
337 3300028379 Ga0268266_10325688 Ga0268266_103256881 280
338 3300028380 Ga0268265_10009066 Ga0268265_100090668 280
339 3300028380 Ga0268265_10399075 Ga0268265_103990751 280
340 3300028381 Ga0268264_10013650 Ga0268264_100136503 280
341 3300028381 Ga0268264_10039666 Ga0268264_100396664 280
342 3300035121 Ga0373960_0014130 Ga0373960_0014130_858_1700 280
343 3300035691 Ga0373931_0038675 Ga0373931_0038675_1637_2479 280
344 3300041411 Ga0439466_0033241 Ga0439466_0033241_845_1687 280
345 3300041413 Ga0439465_0010146 Ga0439465_0010146_1758_2600 280
346 3300042002 Ga0439442_002837 Ga0439442_002837_2063_2905 280
347 3300042004 Ga0439445_0061414 Ga0439445_0061414_95_937 280
348 3300042016 Ga0439463_003326 Ga0439463_003326_2495_3364 280
349 3300042439 Ga0439464_0004018 Ga0439464_0004018_1995_2864 280
350 3300044658 Ga0466972_0005306 Ga0466972_0005306_5280_6122 280
351 3300044765 Ga0466970_0236159 Ga0466970_0236159_139_987 280
352 3300048903 Ga0496100_0006818 Ga0496100_0006818_1795_2637 280
353 3300048903 Ga0496100_0079168 Ga0496100_0079168_1149_1991 280
354 3300048904 Ga0496101_0017197 Ga0496101_0017197_3745_4587 280
355 3300048905 Ga0496102_0003421 Ga0496102_0003421_10725_11567 280
356 3300048905 Ga0496102_0009359 Ga0496102_0009359_3354_4196 280
357 3300048905 Ga0496102_0015316 Ga0496102_0015316_5720_6562 280
358 3300048906 Ga0496103_0012531 Ga0496103_0012531_2792_3634 280
359 3300048906 Ga0496103_0014397 Ga0496103_0014397_419_1261 280
360 3300048907 Ga0496104_0005592 Ga0496104_0005592_7532_8374 280
361 3300048908 Ga0496105_0312261 Ga0496105_0312261_375_1217 280
362 3300048910 Ga0496107_0001314 Ga0496107_0001314_3184_4026 280
363 3300048911 Ga0496108_0001002 Ga0496108_0001002_15046_15888 280
364 3300048912 Ga0496109_0002094 Ga0496109_0002094_1248_2090 280
365 3300048913 Ga0496110_0024788 Ga0496110_0024788_2786_3628 280
366 3300048913 Ga0496110_0065815 Ga0496110_0065815_1833_2675 280
367 3300048914 Ga0496111_0369266 Ga0496111_0369266_95_937 280
368 3300048915 Ga0496112_0004297 Ga0496112_0004297_10663_11505 280
369 3300048917 Ga0496114_0069680 Ga0496114_0069680_806_1648 280
370 3300048918 Ga0496115_0034724 Ga0496115_0034724_1490_2332 280
371 3300049569 Ga0501032_0009544 Ga0501032_0009544_2557_3402 280
372 3300049571 Ga0501034_0207450 Ga0501034_0207450_489_1334 280
373 3300049572 Ga0501036_0003817 Ga0501036_0003817_195_1040 280
374 3300049572 Ga0501036_0035685 Ga0501036_0035685_1164_2033 280
375 3300049573 Ga0501037_0000060 Ga0501037_0000060_87214_88059 280
376 3300049574 Ga0501038_0043327 Ga0501038_0043327_1407_2252 280
377 3300049574 Ga0501038_0382188 Ga0501038_0382188_43_912 280
378 3300049575 Ga0501039_0001407 Ga0501039_0001407_16806_17651 280
379 3300049575 Ga0501039_0006999 Ga0501039_0006999_2794_3663 280
380 3300049576 Ga0501040_0006678 Ga0501040_0006678_5048_5917 280
381 3300049577 Ga0501041_0003973 Ga0501041_0003973_1549_2418 280
382 3300049579 Ga0501043_0002866 Ga0501043_0002866_13418_14263 280
383 3300049579 Ga0501043_0186455 Ga0501043_0186455_636_1505 280
384 3300049580 Ga0501046_0003011 Ga0501046_0003011_9070_9939 280
385 3300049582 Ga0501048_0007282 Ga0501048_0007282_7484_8353 280
386 3300049586 Ga0501070_0028628 Ga0501070_0028628_3196_4041 280
387 3300049587 Ga0501071_0052668 Ga0501071_0052668_31_900 280
388 3300049588 Ga0501072_0013533 Ga0501072_0013533_694_1563 280
389 3300049591 Ga0501075_0004226 Ga0501075_0004226_5031_5900 280
390 3300049592 Ga0501076_0006986 Ga0501076_0006986_2308_3177 280
391 3300049741 Ga0501079_0008238 Ga0501079_0008238_4301_5170 280
392 3300049743 Ga0501081_0030497 Ga0501081_0030497_1691_2560 280
393 3300049824 Ga0501045_0004970 Ga0501045_0004970_2231_3100 280
394 3300050489 nmdc:mga03683_29313_c1 nmdc:mga03683_29313_c1_229_1074 280
395 3300050489 nmdc:mga03683_3615_c1 nmdc:mga03683_3615_c1_1572_2414 280
396 3300050490 nmdc:mga03n38_15787_c1 nmdc:mga03n38_15787_c1_1930_2775 280
397 3300050490 nmdc:mga03n38_37999_c1 nmdc:mga03n38_37999_c1_1071_1916 280
398 3300050490 nmdc:mga03n38_4652_c1 nmdc:mga03n38_4652_c1_1253_2098 280
399 3300050491 nmdc:mga00v17_16260_c1 nmdc:mga00v17_16260_c1_2285_3127 280
400 3300050491 nmdc:mga00v17_17329_c1 nmdc:mga00v17_17329_c1_3111_3956 280
401 3300050491 nmdc:mga00v17_267353_c1 nmdc:mga00v17_267353_c1_232_1074 280
402 3300050491 nmdc:mga00v17_3626_c1 nmdc:mga00v17_3626_c1_2481_3326 280
403 3300050492 nmdc:mga0yw44_1249_c1 nmdc:mga0yw44_1249_c1_2794_3639 280
404 3300050492 nmdc:mga0yw44_90626_c1 nmdc:mga0yw44_90626_c1_628_1470 280
405 3300050494 nmdc:mga06z11_64147_c1 nmdc:mga06z11_64147_c1_211_1053 280
406 3300050495 nmdc:mga04h51_2930_c1 nmdc:mga04h51_2930_c1_1716_2561 280
407 3300050496 nmdc:mga07m45_10187_c1 nmdc:mga07m45_10187_c1_1962_2807 280
408 3300050496 nmdc:mga07m45_211522_c1 nmdc:mga07m45_211522_c1_208_1050 280
409 3300050496 nmdc:mga07m45_3696_c1 nmdc:mga07m45_3696_c1_3120_3965 280
410 3300050496 nmdc:mga07m45_94238_c1 nmdc:mga07m45_94238_c1_555_1400 280
411 3300050516 nmdc:mga0sz30_11803_c1 nmdc:mga0sz30_11803_c1_1377_2222 280
412 3300050516 nmdc:mga0sz30_1263_c1 nmdc:mga0sz30_1263_c1_2479_3321 280
413 3300050516 nmdc:mga0sz30_52471_c1 nmdc:mga0sz30_52471_c1_371_1216 280
414 3300050516 nmdc:mga0sz30_59173_c1 nmdc:mga0sz30_59173_c1_520_1362 280
415 3300054114 Ga0501084_0017440 Ga0501084_0017440_3814_4683 280
416 3300060353 Ga0501082_0053197 Ga0501082_0053197_1598_2467 280
417 3300061734 Ga0530510_0003778 Ga0530510_0003778_5054_5923 280
418 iso_pu_bacteria 2929212328 2929216092 280
419 iso_pu_bacteria 2939582691 2939585770 280
420 3300005337 Ga0070682_100098414 Ga0070682_1000984142 281
421 3300006051 Ga0075364_10147442 Ga0075364_101474422 281
422 3300006186 Ga0075369_10030208 Ga0075369_100302081 281
423 3300025303 Ga0209051_1000652 Ga0209051_100065216 281
424 3300031548 Ga0307408_100178344 Ga0307408_1001783442 281
425 3300042436 Ga0439435_0027549 Ga0439435_0027549_42_914 281
426 3300044658 Ga0466972_0028851 Ga0466972_0028851_1421_2269 281
427 3300044683 Ga0466965_0005902 Ga0466965_0005902_2872_3720 281
428 3300044683 Ga0466965_0225586 Ga0466965_0225586_131_976 281
429 3300046460 Ga0495638_0004021 Ga0495638_0004021_1944_2807 281
430 3300050491 nmdc:mga00v17_149942_c1 nmdc:mga00v17_149942_c1_314_1177 281
431 3300053158 Ga0500627_0004430 Ga0500627_0004430_524_1387 281
432 iso_pu_bacteria 2842134933 2842137848 281
433 3300005347 Ga0070668_100015363 Ga0070668_1000153634 282
434 3300006186 Ga0075369_10008972 Ga0075369_100089722 282
435 3300025910 Ga0207684_10414351 Ga0207684_104143512 282
436 3300025972 Ga0207668_10008233 Ga0207668_100082337 282
437 3300048908 Ga0496105_0311667 Ga0496105_0311667_397_1248 282
438 3300050516 nmdc:mga0sz30_1956_c1 nmdc:mga0sz30_1956_c1_2071_2928 282
439 3300053153 Ga0500616_0025453 Ga0500616_0025453_443_1303 282
440 iso_pu_bacteria 2643221687 2644485814 282
441 iso_pu_bacteria 2738541274 2738704112 282
442 iso_pu_bacteria 2738543028 2739334489 282
443 iso_pu_bacteria 2902799365 2902800921 282
444 iso_pu_bacteria 2902792274 2902797737 283
445 3300005367 Ga0070667_100360777 Ga0070667_1003607772 284
446 3300005456 Ga0070678_100544681 Ga0070678_1005446811 284
447 3300006038 Ga0075365_10076936 Ga0075365_100769361 284
448 3300006048 Ga0075363_100138244 Ga0075363_1001382442 284
449 3300025986 Ga0207658_10284360 Ga0207658_102843601 284
450 3300026089 Ga0207648_10383884 Ga0207648_103838842 284
451 3300041413 Ga0439465_0033045 Ga0439465_0033045_754_1620 284
452 3300045976 Ga0466967_0079991 Ga0466967_0079991_476_1333 284
453 3300048905 Ga0496102_0150449 Ga0496102_0150449_738_1598 284
454 3300048910 Ga0496107_0211200 Ga0496107_0211200_103_963 284
455 3300048911 Ga0496108_0012968 Ga0496108_0012968_39_896 284
456 3300048911 Ga0496108_0079484 Ga0496108_0079484_472_1329 284
457 3300048913 Ga0496110_0499907 Ga0496110_0499907_165_1025 284
458 3300048917 Ga0496114_0214618 Ga0496114_0214618_87_947 284
459 3300050492 nmdc:mga0yw44_79967_c1 nmdc:mga0yw44_79967_c1_1160_2017 284
460 3300005327 Ga0070658_10146594 Ga0070658_101465941 285
461 3300005337 Ga0070682_100001675 Ga0070682_1000016757 285
462 3300005355 Ga0070671_100172316 Ga0070671_1001723162 285
463 3300005356 Ga0070674_100448354 Ga0070674_1004483541 285
464 3300005439 Ga0070711_100257097 Ga0070711_1002570972 285
465 3300009176 Ga0105242_10068447 Ga0105242_100684473 285
466 3300009177 Ga0105248_10037831 Ga0105248_100378314 285
467 3300011119 Ga0105246_10181210 Ga0105246_101812102 285
468 3300013308 Ga0157375_10365609 Ga0157375_103656091 285
469 3300013308 Ga0157375_10550681 Ga0157375_105506812 285
470 3300014325 Ga0163163_10103328 Ga0163163_101033283 285
471 3300025915 Ga0207693_10499466 Ga0207693_104994661 285
472 3300025931 Ga0207644_10162263 Ga0207644_101622632 285
473 3300025937 Ga0207669_10131874 Ga0207669_101318743 285
474 3300025941 Ga0207711_10103015 Ga0207711_101030152 285
475 3300026067 Ga0207678_10024813 Ga0207678_100248136 285
476 3300044683 Ga0466965_0011761 Ga0466965_0011761_2683_3540 285
477 3300044684 Ga0466966_0028007 Ga0466966_0028007_944_1801 285
478 3300044719 Ga0466971_0017065 Ga0466971_0017065_2071_2928 285
479 3300044735 Ga0466968_0035928 Ga0466968_0035928_1009_1866 285
480 3300045049 Ga0466959_0003572 Ga0466959_0003572_6459_7316 285
481 3300046473 Ga0495582_0159976 Ga0495582_0159976_328_1188 285
482 3300046533 Ga0495640_0012804 Ga0495640_0012804_2447_3307 285
483 3300047315 Ga0495581_0026667 Ga0495581_0026667_2124_2984 285
484 3300047673 Ga0495593_0036396 Ga0495593_0036396_1178_2038 285
485 3300048903 Ga0496100_0001144 Ga0496100_0001144_3611_4471 285
486 3300048904 Ga0496101_0001860 Ga0496101_0001860_8740_9600 285
487 3300048907 Ga0496104_0035752 Ga0496104_0035752_2461_3321 285
488 3300048909 Ga0496106_0034530 Ga0496106_0034530_1679_2539 285
489 3300048912 Ga0496109_0028009 Ga0496109_0028009_1501_2361 285
490 3300048916 Ga0496113_0143035 Ga0496113_0143035_375_1235 285
491 3300048917 Ga0496114_0034159 Ga0496114_0034159_1565_2425 285
492 3300048918 Ga0496115_0005463 Ga0496115_0005463_4628_5488 285
493 3300050507 nmdc:mga05p37_189709_c1 nmdc:mga05p37_189709_c1_1610_2467 285
494 3300003792 Ga0055540_1001265 Ga0055540_100126512 286
495 3300003792 Ga0055540_1003233 Ga0055540_10032332 286
496 3300005353 Ga0070669_100001256 Ga0070669_10000125615 286
497 3300005367 Ga0070667_100000920 Ga0070667_10000092017 286
498 3300005548 Ga0070665_100018650 Ga0070665_1000186505 286
499 3300005617 Ga0068859_100000115 Ga0068859_10000011548 286
500 3300005841 Ga0068863_100000277 Ga0068863_1000002778 286
501 3300005842 Ga0068858_100017982 Ga0068858_1000179825 286
502 3300005843 Ga0068860_100000044 Ga0068860_10000004450 286
503 3300005844 Ga0068862_100000003 Ga0068862_100000003181 286
504 3300006051 Ga0075364_10339236 Ga0075364_103392361 286
505 3300006931 Ga0097620_100000115 Ga0097620_10000011548 286
506 3300009101 Ga0105247_10000006 Ga0105247_10000006140 286
507 3300009177 Ga0105248_10000062 Ga0105248_1000006247 286
508 3300009553 Ga0105249_10000008 Ga0105249_10000008273 286
509 3300013306 Ga0163162_10218452 Ga0163162_102184522 286
510 3300014325 Ga0163163_10004804 Ga0163163_100048042 286
511 3300014968 Ga0157379_10040857 Ga0157379_100408573 286
512 3300025273 Ga0209673_1015499 Ga0209673_10154994 286
513 3300025303 Ga0209051_1001152 Ga0209051_100115213 286
514 3300025303 Ga0209051_1011577 Ga0209051_10115772 286
515 3300025303 Ga0209051_1068562 Ga0209051_10685621 286
516 3300025900 Ga0207710_10000025 Ga0207710_10000025147 286
517 3300025923 Ga0207681_10002490 Ga0207681_100024906 286
518 3300025941 Ga0207711_10000674 Ga0207711_1000067411 286
519 3300025961 Ga0207712_10000011 Ga0207712_1000001148 286
520 3300025986 Ga0207658_10000659 Ga0207658_1000065921 286
521 3300026035 Ga0207703_10165662 Ga0207703_101656622 286
522 3300026088 Ga0207641_10035957 Ga0207641_100359573 286
523 3300028380 Ga0268265_10000010 Ga0268265_10000010181 286
524 3300028381 Ga0268264_10000007 Ga0268264_10000007715 286
525 3300041452 Ga0451793_0421733 Ga0451793_0421733_377_1237 286
526 3300048905 Ga0496102_0000402 Ga0496102_0000402_2775_3635 286
527 3300048906 Ga0496103_0002747 Ga0496103_0002747_7781_8641 286
528 3300048919 Ga0496116_0007641 Ga0496116_0007641_4744_5604 286
529 3300048920 Ga0496117_0000190 Ga0496117_0000190_30744_31604 286
530 3300048921 Ga0496118_0002690 Ga0496118_0002690_13136_13996 286
531 3300048922 Ga0496119_0002576 Ga0496119_0002576_4440_5300 286
532 3300048923 Ga0496120_0010739 Ga0496120_0010739_1673_2533 286
533 3300048924 Ga0496121_0001772 Ga0496121_0001772_3595_4455 286
534 3300048927 Ga0496124_0006919 Ga0496124_0006919_7955_8815 286
535 3300048928 Ga0496125_0008540 Ga0496125_0008540_7360_8220 286
536 3300048929 Ga0496126_0017449 Ga0496126_0017449_3806_4666 286
537 3300048929 Ga0496126_0057686 Ga0496126_0057686_1532_2395 286
538 3300050492 nmdc:mga0yw44_314470_c1 nmdc:mga0yw44_314470_c1_155_1015 286
539 3300053131 Ga0500652_000547 Ga0500652_000547_2359_3219 286
540 3300053730 Ga0500645_000035 Ga0500645_000035_28803_29666 286
541 3300000546 LJNas_1001606 LJNas_10016063 287
542 3300005539 Ga0068853_100002662 Ga0068853_10000266211 287
543 3300013308 Ga0157375_10600198 Ga0157375_106001982 287
544 3300026041 Ga0207639_10015418 Ga0207639_100154183 287
545 3300046506 Ga0495583_0027253 Ga0495583_0027253_1030_1893 287
546 3300046524 Ga0495648_0000871 Ga0495648_0000871_18606_19469 287
547 3300046530 Ga0495654_0099640 Ga0495654_0099640_216_1079 287
548 3300046648 Ga0495611_0049970 Ga0495611_0049970_973_1836 287
549 3300047320 Ga0495672_0009613 Ga0495672_0009613_464_1327 287
550 3300047469 Ga0495673_0002224 Ga0495673_0002224_2056_2919 287
551 3300047472 Ga0495686_0015167 Ga0495686_0015167_962_1825 287
552 3300048903 Ga0496100_0002625 Ga0496100_0002625_8258_9121 287
553 3300048904 Ga0496101_0000019 Ga0496101_0000019_122806_123669 287
554 3300048905 Ga0496102_0000007 Ga0496102_0000007_271027_271890 287
555 3300048906 Ga0496103_0000013 Ga0496103_0000013_151884_152747 287
556 3300048909 Ga0496106_0036376 Ga0496106_0036376_767_1630 287
557 3300048919 Ga0496116_0000033 Ga0496116_0000033_146281_147144 287
558 3300048920 Ga0496117_0000025 Ga0496117_0000025_146211_147074 287
559 3300048921 Ga0496118_0000023 Ga0496118_0000023_271033_271896 287
560 3300048922 Ga0496119_0001596 Ga0496119_0001596_15357_16220 287
561 3300048923 Ga0496120_0000382 Ga0496120_0000382_68119_68982 287
562 3300048924 Ga0496121_0000039 Ga0496121_0000039_105749_106612 287
563 3300048929 Ga0496126_0007370 Ga0496126_0007370_4079_4942 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

109

291

0.83

Feature Viewer

pLDDT pTM Quality
65.94 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map