F464019

General Info

Members Datasets Scaffolds Average Seq Length
563 246 535 227

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100005750|Ga0070671_1000057506
Length 255
Sequence MIRLTNVCKDYPTRVGMRRVLDSINVTVQPGEHLGILGRNGAGKSTLVRLISGAEAPTLGTIERNMAVSWPLAFSGGFQGSLTGADNVRFICRIYGVDYQPRFEFVKDFSELGIYLNEPVATYSSGMRARLAFAISMTIDFDCYLIDEVMAVGDQRFRERCRVELFEKRRDKAMLIVSHSHRYLKNVCDRFLLIEGGRLEDHNDFDEVYFRYKQLIGEGFESREDMVAAMDASTPEAQLRRERKRLRRLAANAGE

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
4 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
5 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
6 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
7 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
8 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
9 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
10 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
11 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
15 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
16 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
17 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
18 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
19 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
20 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
21 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
22 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
23 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
24 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
25 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
26 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
62 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
119 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
239 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
245 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
246 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.03
Metatranscriptomes 0
Isolates 4.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.8
Nodule 0.89
Rhizoplane 1.95
Rhizosphere 87.74
Stem 0
Stem Tuber 0
Unclassified 4.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000463 3300001915 Bacteria 12346
2 JGI24740J21852_10000050 3300001979 Bacteria 37983
3 JGI24740J21852_10000323 3300001979 Bacteria 20340
4 JGI24739J22299_10010378 3300001989 Bacteria 3459
5 JGI24737J22298_10010456 3300001990 Bacteria 3061
6 JGI24737J22298_10033853 3300001990 Bacteria 1586
7 JGI24743J22301_10014021 3300001991 Bacteria 1475
8 JGI24735J21928_10016107 3300002067 Bacteria 2325
9 JGI24735J21928_10024697 3300002067 Bacteria 1816
10 JGI24738J21930_10003645 3300002075 Bacteria 3858
11 JGI24738J21930_10023772 3300002075 Bacteria 1261
12 JGI24744J21845_10004665 3300002077 Bacteria 2831
13 JGI25162J39368_1000119 3300002737 Bacteria 87157
14 JGI25162J39368_1003173 3300002737 Bacteria 5129
15 JGI25165J46597_1000211 3300003214 Bacteria 82463
16 JGI25165J46597_1002115 3300003214 Bacteria 7205
17 JGI25153J46596_10000007 3300003215 Bacteria 377573
18 rootH1_10041865 3300003316 Bacteria 6454
19 rootH2_10036567 3300003320 Bacteria 1410
20 rootH2_10049253 3300003320 Bacteria 4121
21 rootL2_10008491 3300003322 Bacteria 40034
22 rootH1_10073304 3300003323 Bacteria 3930
23 rootH1_10137120 3300003323 Bacteria 6037
24 rootH1_10154429 3300003323 Bacteria 9461
25 rootH1_10231694 3300003323 Bacteria 2738
26 Ga0055537_1001116 3300003773 Bacteria 11593
27 Ga0058692_1024898 3300003856 Bacteria 1195
28 Ga0070658_10000978 3300005327 Bacteria 24540
29 Ga0070658_10004748 3300005327 Bacteria 11057
30 Ga0070658_10020212 3300005327 Bacteria 5335
31 Ga0070658_10071779 3300005327 Bacteria 2836
32 Ga0070658_10395131 3300005327 Bacteria 1187
33 Ga0070676_10000445 3300005328 Bacteria 19700
34 Ga0070683_100001007 3300005329 Bacteria 21089
35 Ga0070683_100340538 3300005329 Bacteria 1428
36 Ga0070690_100147302 3300005330 Bacteria 1603
37 Ga0070670_100005738 3300005331 Bacteria 10484
38 Ga0070670_100029040 3300005331 Bacteria 4759
39 Ga0070670_100130730 3300005331 Bacteria 2168
40 Ga0068869_100000113 3300005334 Bacteria 38756
41 Ga0070680_100006544 3300005336 Bacteria 8861
42 Ga0068868_100000003 3300005338 Bacteria 155611
43 Ga0068868_100456763 3300005338 Bacteria 1112
44 Ga0070660_100002998 3300005339 Bacteria 11630
45 Ga0070660_100005757 3300005339 Bacteria 8586
46 Ga0070660_100006194 3300005339 Bacteria 8277
47 Ga0070660_100019547 3300005339 Bacteria 4965
48 Ga0070661_100000519 3300005344 Bacteria 29559
49 Ga0070661_100004462 3300005344 Bacteria 9649
50 Ga0070661_100019752 3300005344 Bacteria 4802
51 Ga0070661_100055345 3300005344 Bacteria 2905
52 Ga0070661_100366876 3300005344 Bacteria 1133
53 Ga0070668_100004680 3300005347 Bacteria 10143
54 Ga0070668_100091897 3300005347 Bacteria 2393
55 Ga0070669_100012471 3300005353 Bacteria 6030
56 Ga0070669_100030650 3300005353 Bacteria 3882
57 Ga0070669_100170105 3300005353 Bacteria 1698
58 Ga0070675_100009907 3300005354 Bacteria 7430
59 Ga0070671_100005239 3300005355 Bacteria 10332
60 Ga0070671_100005750 3300005355 Bacteria 9876
61 Ga0070671_100007151 3300005355 Bacteria 8920
62 Ga0070671_100026391 3300005355 Bacteria 4773
63 Ga0070674_100444720 3300005356 Bacteria 1068
64 Ga0070673_100000012 3300005364 Bacteria 141279
65 Ga0070659_100008040 3300005366 Bacteria 7689
66 Ga0070659_100009952 3300005366 Bacteria 6995
67 Ga0070659_100011323 3300005366 Bacteria 6595
68 Ga0070659_100053956 3300005366 Bacteria 3165
69 Ga0070659_100329079 3300005366 Bacteria 1278
70 Ga0070659_100540071 3300005366 Unclassified 997
71 Ga0070667_100000024 3300005367 Bacteria 191216
72 Ga0070667_100004758 3300005367 Bacteria 11377
73 Ga0070708_100031159 3300005445 Bacteria 4613
74 Ga0070663_100000253 3300005455 Bacteria 26965
75 Ga0070663_100001203 3300005455 Bacteria 14224
76 Ga0070678_100025162 3300005456 Bacteria 3999
77 Ga0070662_100082969 3300005457 Bacteria 2391
78 Ga0070662_100267401 3300005457 Bacteria 1379
79 Ga0070662_100275303 3300005457 Bacteria 1360
80 Ga0068867_100000003 3300005459 Bacteria 217886
81 Ga0070679_100368702 3300005530 Bacteria 1383
82 Ga0070679_100453648 3300005530 Bacteria 1227
83 Ga0070684_100022141 3300005535 Bacteria 5297
84 Ga0070684_100276457 3300005535 Bacteria 1538
85 Ga0070684_100893289 3300005535 Bacteria 832
86 Ga0068853_100012330 3300005539 Bacteria 6954
87 Ga0068853_100013336 3300005539 Bacteria 6710
88 Ga0068853_100095057 3300005539 Bacteria 2627
89 Ga0068853_100149652 3300005539 Bacteria 2100
90 Ga0068853_100490306 3300005539 Bacteria 1159
91 Ga0070672_100043418 3300005543 Bacteria 3467
92 Ga0070672_100135203 3300005543 Bacteria 2030
93 Ga0070672_100255996 3300005543 Bacteria 1475
94 Ga0070672_100534854 3300005543 Bacteria 1016
95 Ga0070665_100067218 3300005548 Bacteria 3594
96 Ga0068855_100000213 3300005563 Bacteria 73664
97 Ga0068855_100000916 3300005563 Bacteria 36640
98 Ga0068855_100016410 3300005563 Bacteria 8903
99 Ga0068855_100031315 3300005563 Bacteria 6352
100 Ga0068855_100044942 3300005563 Bacteria 5225
101 Ga0068855_100045093 3300005563 Bacteria 5215
102 Ga0070664_100036196 3300005564 Unclassified 4147
103 Ga0070664_100127643 3300005564 Bacteria 2232
104 Ga0070664_100185895 3300005564 Bacteria 1849
105 Ga0070664_100187592 3300005564 Unclassified 1841
106 Ga0070664_100501949 3300005564 Bacteria 1118
107 Ga0068857_100017104 3300005577 Bacteria 6352
108 Ga0068857_100031885 3300005577 Bacteria 4657
109 Ga0068857_100076500 3300005577 Bacteria 2985
110 Ga0068854_100003016 3300005578 Bacteria 10458
111 Ga0068854_100003821 3300005578 Bacteria 9425
112 Ga0068854_100017262 3300005578 Plasmid 4827
113 Ga0068856_100001363 3300005614 Bacteria 25686
114 Ga0068856_100004335 3300005614 Bacteria 14150
115 Ga0068856_100006889 3300005614 Bacteria 11114
116 Ga0068856_100007588 3300005614 Bacteria 10586
117 Ga0068856_100009981 3300005614 Bacteria 9219
118 Ga0068856_100013961 3300005614 Bacteria 7767
119 Ga0068856_100021434 3300005614 Bacteria 6283
120 Ga0068856_100024263 3300005614 Bacteria 5901
121 Ga0068856_100035195 3300005614 Bacteria 4907
122 Ga0068856_100074319 3300005614 Bacteria 3365
123 Ga0068856_100266091 3300005614 Bacteria 1730
124 Ga0068852_100000226 3300005616 Bacteria 38233
125 Ga0068852_100003368 3300005616 Bacteria 11156
126 Ga0068852_100004455 3300005616 Bacteria 9900
127 Ga0068852_100006535 3300005616 Bacteria 8433
128 Ga0068852_100017513 3300005616 Bacteria 5623
129 Ga0068852_100456123 3300005616 Bacteria 1266
130 Ga0068859_100133504 3300005617 Bacteria 2554
131 Ga0068864_100001264 3300005618 Bacteria 21020
132 Ga0068864_100166577 3300005618 Bacteria 2007
133 Ga0068851_10001112 3300005834 Bacteria 11659
134 Ga0068851_10042003 3300005834 Bacteria 2301
135 Ga0068863_100001711 3300005841 Bacteria 21715
136 Ga0068863_100002921 3300005841 Bacteria 16925
137 Ga0068863_100081940 3300005841 Bacteria 3057
138 Ga0068860_100000719 3300005843 Bacteria 37763
139 Ga0081539_10027576 3300005985 Bacteria 3593
140 Ga0070717_10210095 3300006028 Bacteria 1708
141 Ga0075366_10005516 3300006195 Bacteria 6856
142 Ga0097621_100032494 3300006237 Bacteria 4149
143 Ga0075370_10025069 3300006353 Bacteria 3297
144 Ga0068871_100039556 3300006358 Bacteria 3774
145 Ga0068871_100271288 3300006358 Bacteria 1482
146 Ga0068865_100000002 3300006881 Bacteria 285745
147 Ga0097620_100133503 3300006931 Bacteria 2554
148 Ga0105240_10001585 3300009093 Bacteria 38598
149 Ga0105240_10001987 3300009093 Bacteria 33795
150 Ga0105240_10295381 3300009093 Bacteria 1855
151 Ga0105240_10326806 3300009093 Bacteria 1746
152 Ga0105240_10607184 3300009093 Bacteria 1204
153 Ga0111539_10209722 3300009094 Bacteria 2270
154 Ga0105245_10003064 3300009098 Bacteria 14966
155 Ga0105243_10000031 3300009148 Bacteria 185825
156 Ga0105241_10083202 3300009174 Plasmid 2510
157 Ga0105241_10211974 3300009174 Bacteria 1623
158 Ga0105242_10000044 3300009176 Bacteria 85651
159 Ga0105242_10107995 3300009176 Bacteria 2368
160 Ga0105248_10002807 3300009177 Bacteria 19354
161 Ga0105248_10006110 3300009177 Bacteria 13211
162 Ga0105248_10026893 3300009177 Bacteria 6398
163 Ga0105237_10001260 3300009545 Bacteria 33817
164 Ga0105238_10000628 3300009551 Bacteria 37060
165 Ga0105249_10000045 3300009553 Bacteria 182927
166 Ga0105249_10044089 3300009553 Bacteria 4057
167 Ga0105249_10900160 3300009553 Bacteria 952
168 Ga0105239_10002195 3300010375 Bacteria 25098
169 Ga0105239_10048930 3300010375 Bacteria 4635
170 Ga0105246_10004111 3300011119 Bacteria 8830
171 Ga0157373_10003064 3300013100 Bacteria 12616
172 Ga0157373_10011421 3300013100 Bacteria 6532
173 Ga0157373_10033429 3300013100 Bacteria 3700
174 Ga0157373_10058997 3300013100 Bacteria 2719
175 Ga0157373_10117418 3300013100 Bacteria 1870
176 Ga0157373_10174203 3300013100 Bacteria 1514
177 Ga0157371_10000857 3300013102 Bacteria 34684
178 Ga0157371_10007479 3300013102 Bacteria 8842
179 Ga0157371_10025127 3300013102 Bacteria 4345
180 Ga0157371_10067829 3300013102 Bacteria 2525
181 Ga0157371_10071207 3300013102 Bacteria 2461
182 Ga0157370_10000867 3300013104 Bacteria 38370
183 Ga0157370_10001375 3300013104 Bacteria 30111
184 Ga0157370_10001572 3300013104 Bacteria 28243
185 Ga0157370_10040009 3300013104 Plasmid 4528
186 Ga0157370_10096738 3300013104 Bacteria 2770
187 Ga0157370_10135132 3300013104 Bacteria 2299
188 Ga0157370_10197838 3300013104 Bacteria 1865
189 Ga0157370_10597336 3300013104 Unclassified 1011
190 Ga0157369_10000850 3300013105 Bacteria 38984
191 Ga0157369_10001070 3300013105 Bacteria 34356
192 Ga0157369_10001830 3300013105 Bacteria 25706
193 Ga0157369_10004751 3300013105 Bacteria 15966
194 Ga0157369_10008561 3300013105 Bacteria 11732
195 Ga0157369_10014361 3300013105 Bacteria 8942
196 Ga0157369_10034031 3300013105 Bacteria 5596
197 Ga0157369_10192142 3300013105 Bacteria 2145
198 Ga0157369_10339736 3300013105 Bacteria 1560
199 Ga0157374_10003136 3300013296 Bacteria 13891
200 Ga0157374_10018628 3300013296 Bacteria 6131
201 Ga0157378_10004709 3300013297 Bacteria 11961
202 Ga0163162_10031968 3300013306 Bacteria 5224
203 Ga0163162_10036799 3300013306 Bacteria 4881
204 Ga0163162_10084708 3300013306 Bacteria 3246
205 Ga0163162_10187155 3300013306 Bacteria 2197
206 Ga0163162_10226334 3300013306 Bacteria 2000
207 Ga0157372_10000448 3300013307 Bacteria 45389
208 Ga0157372_10002127 3300013307 Bacteria 21520
209 Ga0157372_10043055 3300013307 Bacteria 4997
210 Ga0157372_10081283 3300013307 Bacteria 3668
211 Ga0157372_10199047 3300013307 Bacteria 2320
212 Ga0157375_10017494 3300013308 Bacteria 6471
213 Ga0163163_10004055 3300014325 Bacteria 12491
214 Ga0163163_10942509 3300014325 Bacteria 927
215 Ga0157379_10000457 3300014968 Bacteria 33074
216 Ga0157376_10000107 3300014969 Bacteria 59840
217 Ga0163161_10190439 3300017792 Bacteria 1577
218 Ga0163161_10209647 3300017792 Bacteria 1505
219 Ga0213875_10004951 3300021388 Bacteria 7227
220 Ga0209437_100042 3300025233 Bacteria 444095
221 Ga0209437_100062 3300025233 Bacteria 336900
222 Ga0209148_1000889 3300025254 Bacteria 20382
223 Ga0209148_1002999 3300025254 Bacteria 5056
224 Ga0209233_1000082 3300025261 Bacteria 336320
225 Ga0209233_1000103 3300025261 Bacteria 284123
226 Ga0209233_1011790 3300025261 Bacteria 2564
227 Ga0209565_1000254 3300025263 Bacteria 56637
228 Ga0209455_1001285 3300025272 Bacteria 11719
229 Ga0209025_1056185 3300025294 Bacteria 1516
230 Ga0209564_1002455 3300025295 Bacteria 14590
231 Ga0209758_1000017 3300025297 Bacteria 754393
232 Ga0209050_1002462 3300025298 Bacteria 15776
233 Ga0207656_10000160 3300025321 Bacteria 25036
234 Ga0207656_10026981 3300025321 Bacteria 2346
235 Ga0207680_10159514 3300025903 Bacteria 1511
236 Ga0207647_10001065 3300025904 Bacteria 21115
237 Ga0207647_10013087 3300025904 Bacteria 5764
238 Ga0207647_10062172 3300025904 Bacteria 2275
239 Ga0207645_10000975 3300025907 Bacteria 23658
240 Ga0207645_10060070 3300025907 Bacteria 2428
241 Ga0207705_10000766 3300025909 Bacteria 26452
242 Ga0207705_10002693 3300025909 Bacteria 13599
243 Ga0207705_10003194 3300025909 Bacteria 12480
244 Ga0207705_10024701 3300025909 Bacteria 4288
245 Ga0207705_10037864 3300025909 Bacteria 3451
246 Ga0207705_10055888 3300025909 Bacteria 2846
247 Ga0207654_10044978 3300025911 Plasmid 2510
248 Ga0207654_10143449 3300025911 Bacteria 1525
249 Ga0207695_10001511 3300025913 Bacteria 38653
250 Ga0207695_10011802 3300025913 Bacteria 10542
251 Ga0207671_10000944 3300025914 Bacteria 36212
252 Ga0207660_10140323 3300025917 Bacteria 1847
253 Ga0207657_10000140 3300025919 Bacteria 74094
254 Ga0207657_10009488 3300025919 Bacteria 9776
255 Ga0207657_10023998 3300025919 Bacteria 5662
256 Ga0207657_10045710 3300025919 Bacteria 3840
257 Ga0207649_10000130 3300025920 Bacteria 64246
258 Ga0207649_10005297 3300025920 Bacteria 6979
259 Ga0207649_10026524 3300025920 Bacteria 3390
260 Ga0207649_10260289 3300025920 Bacteria 1253
261 Ga0207652_10030898 3300025921 Bacteria 4492
262 Ga0207652_10778059 3300025921 Bacteria 851
263 Ga0207681_10013223 3300025923 Bacteria 5103
264 Ga0207694_10002686 3300025924 Bacteria 14385
265 Ga0207694_10544450 3300025924 Bacteria 974
266 Ga0207650_10005442 3300025925 Bacteria 8693
267 Ga0207650_10057374 3300025925 Bacteria 2896
268 Ga0207659_10070678 3300025926 Bacteria 2546
269 Ga0207687_10001332 3300025927 Bacteria 16888
270 Ga0207644_10000141 3300025931 Bacteria 51791
271 Ga0207644_10017199 3300025931 Bacteria 4878
272 Ga0207644_10199749 3300025931 Bacteria 1577
273 Ga0207690_10000063 3300025932 Bacteria 95620
274 Ga0207690_10009586 3300025932 Bacteria 5750
275 Ga0207690_10138841 3300025932 Bacteria 1788
276 Ga0207690_10292566 3300025932 Bacteria 1272
277 Ga0207690_10476338 3300025932 Unclassified 1007
278 Ga0207690_10512973 3300025932 Bacteria 971
279 Ga0207706_10103202 3300025933 Bacteria 2508
280 Ga0207706_10565395 3300025933 Bacteria 978
281 Ga0207686_10000417 3300025934 Bacteria 29017
282 Ga0207709_10000122 3300025935 Bacteria 116068
283 Ga0207704_10000003 3300025938 Bacteria 285808
284 Ga0207691_10057076 3300025940 Bacteria 3555
285 Ga0207711_10001407 3300025941 Bacteria 22537
286 Ga0207711_10027099 3300025941 Bacteria 4812
287 Ga0207711_10040043 3300025941 Bacteria 3986
288 Ga0207689_10000335 3300025942 Bacteria 43825
289 Ga0207661_10000290 3300025944 Bacteria 31735
290 Ga0207679_10001655 3300025945 Bacteria 13900
291 Ga0207679_10075081 3300025945 Bacteria 2564
292 Ga0207679_10156946 3300025945 Unclassified 1859
293 Ga0207679_10202824 3300025945 Bacteria 1658
294 Ga0207679_10382032 3300025945 Bacteria 1235
295 Ga0207667_10000006 3300025949 Bacteria 679876
296 Ga0207667_10000007 3300025949 Bacteria 630590
297 Ga0207667_10000499 3300025949 Bacteria 51798
298 Ga0207667_10011292 3300025949 Bacteria 10387
299 Ga0207667_10027485 3300025949 Bacteria 6191
300 Ga0207667_10034048 3300025949 Bacteria 5473
301 Ga0207667_10094580 3300025949 Bacteria 3085
302 Ga0207651_10000003 3300025960 Bacteria 308050
303 Ga0207712_10023977 3300025961 Bacteria 4033
304 Ga0207668_10001756 3300025972 Bacteria 12691
305 Ga0207668_10010090 3300025972 Bacteria 5691
306 Ga0207668_10278806 3300025972 Bacteria 1370
307 Ga0207640_10000643 3300025981 Bacteria 20424
308 Ga0207640_10005178 3300025981 Bacteria 7092
309 Ga0207640_10005564 3300025981 Bacteria 6866
310 Ga0207640_10051391 3300025981 Bacteria 2679
311 Ga0207658_10000022 3300025986 Bacteria 191235
312 Ga0207677_10000233 3300026023 Bacteria 43366
313 Ga0207703_10000531 3300026035 Bacteria 39275
314 Ga0207703_10024750 3300026035 Bacteria 4723
315 Ga0207639_10000193 3300026041 Bacteria 47121
316 Ga0207639_10003552 3300026041 Bacteria 10476
317 Ga0207639_10133414 3300026041 Bacteria 2059
318 Ga0207639_10205131 3300026041 Bacteria 1693
319 Ga0207678_10000261 3300026067 Bacteria 47649
320 Ga0207678_10003245 3300026067 Bacteria 14693
321 Ga0207678_10006760 3300026067 Bacteria 10171
322 Ga0207678_10518270 3300026067 Bacteria 1040
323 Ga0207702_10001036 3300026078 Bacteria 28486
324 Ga0207702_10005387 3300026078 Bacteria 11206
325 Ga0207702_10006813 3300026078 Bacteria 9799
326 Ga0207702_10012552 3300026078 Bacteria 7045
327 Ga0207702_10014499 3300026078 Bacteria 6544
328 Ga0207702_10016916 3300026078 Bacteria 6035
329 Ga0207702_10023769 3300026078 Bacteria 5084
330 Ga0207702_10030443 3300026078 Bacteria 4498
331 Ga0207702_10052685 3300026078 Bacteria 3444
332 Ga0207702_10506107 3300026078 Bacteria 1178
333 Ga0207641_10004289 3300026088 Bacteria 12393
334 Ga0207641_10006387 3300026088 Bacteria 9944
335 Ga0207641_10039256 3300026088 Bacteria 3959
336 Ga0207648_10000007 3300026089 Bacteria 217865
337 Ga0207648_10205139 3300026089 Bacteria 1749
338 Ga0207676_10059270 3300026095 Bacteria 3022
339 Ga0207674_10001742 3300026116 Bacteria 27825
340 Ga0207674_10104220 3300026116 Bacteria 2815
341 Ga0207674_10171456 3300026116 Bacteria 2123
342 Ga0207683_10016559 3300026121 Bacteria 6276
343 Ga0207698_10000530 3300026142 Bacteria 22187
344 Ga0207698_10001130 3300026142 Bacteria 15528
345 Ga0207698_10002234 3300026142 Bacteria 11447
346 Ga0207698_10005513 3300026142 Bacteria 7828
347 Ga0207698_10009045 3300026142 Bacteria 6326
348 Ga0207698_10553425 3300026142 Bacteria 1128
349 Ga0209371_1005091 3300027312 Bacteria 5389
350 Ga0268266_10222882 3300028379 Unclassified 1734
351 Ga0268265_10005089 3300028380 Bacteria 9014
352 Ga0268264_10000524 3300028381 Bacteria 48665
353 Ga0268264_10136124 3300028381 Unclassified 2184
354 Ga0268256_1004923 3300030500 Bacteria 5389
355 Ga0307408_100015434 3300031548 Bacteria 5085
356 Ga0307408_100099250 3300031548 Unclassified 2215
357 Ga0307408_100120549 3300031548 Bacteria 2031
358 Ga0307408_100243307 3300031548 Unclassified 1480
359 Ga0307405_10000159 3300031731 Bacteria 25466
360 Ga0307405_10001660 3300031731 Bacteria 9481
361 Ga0307405_10015379 3300031731 Bacteria 4144
362 Ga0307405_10206021 3300031731 Bacteria 1432
363 Ga0307413_10003772 3300031824 Bacteria 6455
364 Ga0307413_10144669 3300031824 Bacteria 1648
365 Ga0307413_10148227 3300031824 Bacteria 1631
366 Ga0307410_10003346 3300031852 Bacteria 8026
367 Ga0307410_10005405 3300031852 Bacteria 6757
368 Ga0307410_10021097 3300031852 Bacteria 4001
369 Ga0307410_10023660 3300031852 Bacteria 3824
370 Ga0307410_10308364 3300031852 Bacteria 1251
371 Ga0307410_10402484 3300031852 Bacteria 1106
372 Ga0307406_10004791 3300031901 Bacteria 7372
373 Ga0307406_10012578 3300031901 Bacteria 4825
374 Ga0307406_10021074 3300031901 Bacteria 3850
375 Ga0307406_10063975 3300031901 Bacteria 2385
376 Ga0307406_10104300 3300031901 Bacteria 1938
377 Ga0307406_10233222 3300031901 Bacteria 1376
378 Ga0307407_10007375 3300031903 Bacteria 4976
379 Ga0307407_10015007 3300031903 Bacteria 3812
380 Ga0307407_10101166 3300031903 Bacteria 1789
381 Ga0307407_10346591 3300031903 Bacteria 1050
382 Ga0307407_10553034 3300031903 Bacteria 851
383 Ga0307412_10001872 3300031911 Bacteria 11641
384 Ga0307412_10006623 3300031911 Bacteria 6564
385 Ga0307412_10007975 3300031911 Bacteria 6036
386 Ga0307412_10029465 3300031911 Bacteria 3445
387 Ga0307412_10034224 3300031911 Bacteria 3237
388 Ga0307412_10066353 3300031911 Bacteria 2446
389 Ga0307412_10126196 3300031911 Bacteria 1851
390 Ga0307412_10941811 3300031911 Bacteria 759
391 Ga0307409_100018630 3300031995 Bacteria 4675
392 Ga0307409_100036109 3300031995 Bacteria 3628
393 Ga0307409_100151502 3300031995 Unclassified 2014
394 Ga0307409_100593943 3300031995 Bacteria 1093
395 Ga0307416_100011282 3300032002 Bacteria 5945
396 Ga0307416_100013702 3300032002 Bacteria 5520
397 Ga0307416_100021888 3300032002 Bacteria 4602
398 Ga0307416_100046977 3300032002 Bacteria 3413
399 Ga0307416_100082813 3300032002 Bacteria 2719
400 Ga0307416_100257844 3300032002 Bacteria 1702
401 Ga0307416_100873503 3300032002 Bacteria 998
402 Ga0307414_10025647 3300032004 Bacteria 3780
403 Ga0307414_10084045 3300032004 Bacteria 2340
404 Ga0307411_10011013 3300032005 Bacteria 4855
405 Ga0307411_10035995 3300032005 Bacteria 3097
406 Ga0307411_10053997 3300032005 Bacteria 2636
407 Ga0307411_10056090 3300032005 Bacteria 2595
408 Ga0307411_10066619 3300032005 Bacteria 2420
409 Ga0307411_10080632 3300032005 Bacteria 2238
410 Ga0307411_10584308 3300032005 Bacteria 958
411 Ga0307411_10864087 3300032005 Bacteria 801
412 Ga0307415_100005623 3300032126 Bacteria 6672
413 Ga0307415_100016410 3300032126 Bacteria 4414
414 Ga0307415_100019197 3300032126 Bacteria 4145
415 Ga0307415_100020466 3300032126 Bacteria 4041
416 Ga0307415_100400493 3300032126 Bacteria 1172
417 Ga0307415_100426780 3300032126 Bacteria 1139
418 Ga0373954_0000021 3300035118 Bacteria 58989
419 Ga0373924_0196951 3300035410 Bacteria 888
420 Ga0373935_0424133 3300035692 Bacteria 958
421 Ga0373933_0012672 3300035724 Bacteria 4660
422 Ga0373937_0000982 3300036401 Bacteria 24193
423 Ga0395899_0000850 3300037312 Bacteria 29402
424 Ga0395899_0000943 3300037312 Bacteria 27277
425 Ga0395899_0013653 3300037312 Bacteria 6209
426 Ga0395899_0036605 3300037312 Bacteria 3680
427 Ga0395899_0101433 3300037312 Bacteria 2077
428 Ga0395899_0127154 3300037312 Bacteria 1822
429 Ga0395899_0313699 3300037312 Bacteria 1058
430 Ga0395900_0000971 3300037418 Bacteria 37279
431 Ga0395900_0001252 3300037418 Bacteria 31121
432 Ga0395900_0002045 3300037418 Bacteria 22671
433 Ga0395900_0004357 3300037418 Bacteria 15015
434 Ga0395900_0005701 3300037418 Bacteria 13020
435 Ga0395900_0007138 3300037418 Bacteria 11576
436 Ga0395900_0013055 3300037418 Bacteria 8491
437 Ga0395900_0016657 3300037418 Bacteria 7497
438 Ga0395900_0023867 3300037418 Bacteria 6257
439 Ga0395900_0074830 3300037418 Bacteria 3481
440 Ga0395900_0141937 3300037418 Bacteria 2459
441 Ga0395900_0693733 3300037418 Bacteria 952
442 Ga0395900_0814748 3300037418 Bacteria 861
443 Ga0395898_0001771 3300037466 Bacteria 28186
444 Ga0395898_0002756 3300037466 Bacteria 20245
445 Ga0395898_0018061 3300037466 Bacteria 7195
446 Ga0395898_0029799 3300037466 Bacteria 5463
447 Ga0395898_0034080 3300037466 Bacteria 5077
448 Ga0395898_0087471 3300037466 Bacteria 3001
449 Ga0395898_0908972 3300037466 Bacteria 818
450 Ga0395905_0000915 3300037471 Bacteria 38141
451 Ga0395905_0000920 3300037471 Bacteria 38015
452 Ga0395905_0001250 3300037471 Bacteria 31475
453 Ga0395905_0004810 3300037471 Bacteria 13934
454 Ga0395905_0010244 3300037471 Bacteria 9135
455 Ga0395905_0012450 3300037471 Bacteria 8188
456 Ga0395905_0023018 3300037471 Bacteria 5888
457 Ga0395905_0028486 3300037471 Bacteria 5266
458 Ga0395905_0030212 3300037471 Bacteria 5107
459 Ga0395905_0032395 3300037471 Unclassified 4916
460 Ga0395905_0051284 3300037471 Bacteria 3864
461 Ga0395905_0172556 3300037471 Bacteria 2031
462 Ga0395905_0191306 3300037471 Bacteria 1919
463 Ga0395905_0276404 3300037471 Unclassified 1565
464 Ga0436364_0885024 3300037853 Bacteria 20666
465 Ga0395901_0000810 3300038443 Bacteria 34637
466 Ga0395901_0001847 3300038443 Bacteria 21890
467 Ga0395901_0001911 3300038443 Bacteria 21451
468 Ga0395901_0002995 3300038443 Bacteria 17032
469 Ga0395901_0005384 3300038443 Bacteria 12948
470 Ga0395901_0021665 3300038443 Bacteria 6583
471 Ga0395901_0021784 3300038443 Bacteria 6568
472 Ga0395901_0116632 3300038443 Unclassified 2805
473 Ga0395901_0168524 3300038443 Bacteria 2298
474 Ga0395901_0205825 3300038443 Bacteria 2061
475 Ga0395901_0236940 3300038443 Bacteria 1904
476 Ga0395901_0277760 3300038443 Bacteria 1741
477 Ga0395901_0658839 3300038443 Bacteria 1049
478 Ga0436361_0798855 3300039447 Bacteria 1117
479 Ga0466966_0013578 3300044684 Bacteria 5389
480 Ga0466966_0153390 3300044684 Bacteria 1404
481 Ga0466961_0008433 3300044693 Bacteria 6562
482 Ga0466963_0058690 3300044694 Bacteria 2566
483 Ga0466963_0078534 3300044694 Bacteria 2232
484 Ga0453684_0126490 3300044712 Bacteria 3075
485 Ga0453684_0203978 3300044712 Unclassified 2303
486 Ga0466970_0103212 3300044765 Bacteria 1554
487 Ga0466970_0325833 3300044765 Bacteria 869
488 Ga0466957_0140424 3300044842 Bacteria 1556
489 Ga0466957_0265506 3300044842 Bacteria 1145
490 Ga0466960_0254455 3300044901 Bacteria 976
491 Ga0466960_0387707 3300044901 Bacteria 803
492 Ga0495585_0001441 3300046492 Bacteria 18647
493 Ga0495596_0000037 3300046500 Bacteria 95549
494 Ga0495583_0000120 3300046506 Bacteria 133285
495 Ga0495583_0000122 3300046506 Bacteria 132255
496 Ga0495583_0086231 3300046506 Bacteria 1358
497 Ga0495606_0041049 3300046507 Bacteria 3105
498 Ga0495610_0007663 3300046512 Bacteria 7131
499 Ga0495637_0051131 3300046520 Bacteria 1731
500 Ga0495643_0000126 3300046522 Bacteria 123807
501 Ga0495609_0026462 3300046538 Bacteria 2656
502 Ga0495668_0000013 3300046616 Bacteria 452938
503 Ga0495625_0025886 3300046660 Bacteria 4440
504 Ga0495681_0084321 3300047470 Bacteria 1413
505 Ga0495686_0000072 3300047472 Bacteria 216371
506 Ga0495686_0021978 3300047472 Bacteria 4225
507 Ga0495602_0040472 3300048088 Bacteria 4273
508 Ga0496101_0680776 3300048904 Bacteria 812
509 Ga0496102_0113955 3300048905 Bacteria 2523
510 Ga0496107_0511023 3300048910 Bacteria 891
511 Ga0496108_0002824 3300048911 Bacteria 13936
512 Ga0496110_0435326 3300048913 Bacteria 1195
513 Ga0496111_0071011 3300048914 Bacteria 2534
514 Ga0496112_0002939 3300048915 Bacteria 13887
515 Ga0496112_0147535 3300048915 Bacteria 2320
516 Ga0496113_0048526 3300048916 Bacteria 3159
517 Ga0496113_0167759 3300048916 Bacteria 1738
518 Ga0496117_0103524 3300048920 Bacteria 1794
519 Ga0496119_0012929 3300048922 Bacteria 6716
520 Ga0496120_0026303 3300048923 Bacteria 3595
521 Ga0496121_0003242 3300048924 Bacteria 23388
522 Ga0496121_0004012 3300048924 Bacteria 20280
523 Ga0496122_0014110 3300048925 Bacteria 7750
524 Ga0496123_0103073 3300048926 Bacteria 1654
525 Ga0496126_0005195 3300048929 Bacteria 15033
526 Ga0501034_0142143 3300049571 Bacteria 2379
527 Ga0501042_0335682 3300049578 Bacteria 1093
528 Ga0501047_0317337 3300049581 Bacteria 1399
529 nmdc:mga0k408_11907_c1 3300050493 Plasmid 4745
530 Ga0500592_000272 3300053116 Bacteria 9181
531 Ga0500595_001170 3300053119 Bacteria 14517
532 Ga0500618_000378 3300053125 Bacteria 30686
533 Ga0500616_0028973 3300053153 Bacteria 3049
534 Ga0500645_000003 3300053730 Bacteria 305887
535 Ga0530510_0377356 3300061734 Bacteria 1067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0029799 Ga0395898_0029799_3267_3899 181
2 3300037471 Ga0395905_0012450 Ga0395905_0012450_959_1591 183
3 3300037418 Ga0395900_0814748 Ga0395900_0814748_205_843 187
4 3300038443 Ga0395901_0021784 Ga0395901_0021784_5892_6542 187
5 3300009177 Ga0105248_10026893 Ga0105248_100268933 190
6 3300044842 Ga0466957_0265506 Ga0466957_0265506_240_959 190
7 3300048915 Ga0496112_0147535 Ga0496112_0147535_553_1272 190
8 3300048916 Ga0496113_0167759 Ga0496113_0167759_132_851 190
9 3300003320 rootH2_10049253 rootH2_100492535 192
10 iso_pu_bacteria 2751185897 2753767789 192
11 iso_pu_bacteria 2791355048 2792463237 192
12 iso_pu_bacteria 2843744320 2843748175 192
13 iso_pu_bacteria 2883577096 2883579146 192
14 iso_pu_bacteria 2848297114 2848299276 194
15 3300001979 JGI24740J21852_10000323 JGI24740J21852_100003236 196
16 3300001990 JGI24737J22298_10010456 JGI24737J22298_100104562 196
17 3300001991 JGI24743J22301_10014021 JGI24743J22301_100140212 196
18 3300002067 JGI24735J21928_10016107 JGI24735J21928_100161072 196
19 3300002067 JGI24735J21928_10024697 JGI24735J21928_100246972 196
20 3300002075 JGI24738J21930_10003645 JGI24738J21930_100036452 196
21 3300002075 JGI24738J21930_10023772 JGI24738J21930_100237722 196
22 3300002077 JGI24744J21845_10004665 JGI24744J21845_100046653 196
23 3300002737 JGI25162J39368_1000119 JGI25162J39368_100011963 196
24 3300002737 JGI25162J39368_1003173 JGI25162J39368_10031734 196
25 3300003214 JGI25165J46597_1000211 JGI25165J46597_100021163 196
26 3300003214 JGI25165J46597_1002115 JGI25165J46597_10021155 196
27 3300003215 JGI25153J46596_10000007 JGI25153J46596_10000007166 196
28 3300003316 rootH1_10041865 rootH1_100418656 196
29 3300003320 rootH2_10036567 rootH2_100365672 196
30 3300003322 rootL2_10008491 rootL2_1000849115 196
31 3300003323 rootH1_10154429 rootH1_101544299 196
32 3300003323 rootH1_10231694 rootH1_102316941 196
33 3300003773 Ga0055537_1001116 Ga0055537_10011162 196
34 3300003856 Ga0058692_1024898 Ga0058692_10248982 196
35 3300005327 Ga0070658_10004748 Ga0070658_100047485 196
36 3300005327 Ga0070658_10071779 Ga0070658_100717792 196
37 3300005328 Ga0070676_10000445 Ga0070676_100004456 196
38 3300005329 Ga0070683_100340538 Ga0070683_1003405382 196
39 3300005330 Ga0070690_100147302 Ga0070690_1001473021 196
40 3300005331 Ga0070670_100130730 Ga0070670_1001307302 196
41 3300005334 Ga0068869_100000113 Ga0068869_10000011327 196
42 3300005338 Ga0068868_100000003 Ga0068868_10000000325 196
43 3300005338 Ga0068868_100456763 Ga0068868_1004567632 196
44 3300005339 Ga0070660_100006194 Ga0070660_1000061944 196
45 3300005339 Ga0070660_100019547 Ga0070660_1000195473 196
46 3300005344 Ga0070661_100366876 Ga0070661_1003668762 196
47 3300005347 Ga0070668_100004680 Ga0070668_1000046806 196
48 3300005353 Ga0070669_100012471 Ga0070669_1000124716 196
49 3300005354 Ga0070675_100009907 Ga0070675_1000099074 196
50 3300005355 Ga0070671_100005239 Ga0070671_1000052396 196
51 3300005355 Ga0070671_100026391 Ga0070671_1000263911 196
52 3300005364 Ga0070673_100000012 Ga0070673_10000001212 196
53 3300005366 Ga0070659_100008040 Ga0070659_1000080402 196
54 3300005367 Ga0070667_100004758 Ga0070667_1000047583 196
55 3300005445 Ga0070708_100031159 Ga0070708_1000311592 196
56 3300005456 Ga0070678_100025162 Ga0070678_1000251623 196
57 3300005459 Ga0068867_100000003 Ga0068867_100000003163 196
58 3300005530 Ga0070679_100453648 Ga0070679_1004536482 196
59 3300005535 Ga0070684_100276457 Ga0070684_1002764571 196
60 3300005539 Ga0068853_100013336 Ga0068853_1000133365 196
61 3300005539 Ga0068853_100095057 Ga0068853_1000950572 196
62 3300005543 Ga0070672_100043418 Ga0070672_1000434182 196
63 3300005543 Ga0070672_100135203 Ga0070672_1001352032 196
64 3300005548 Ga0070665_100067218 Ga0070665_1000672184 196
65 3300005563 Ga0068855_100000213 Ga0068855_10000021344 196
66 3300005578 Ga0068854_100003016 Ga0068854_1000030163 196
67 3300005614 Ga0068856_100006889 Ga0068856_1000068894 196
68 3300005614 Ga0068856_100266091 Ga0068856_1002660912 196
69 3300005617 Ga0068859_100133504 Ga0068859_1001335042 196
70 3300005834 Ga0068851_10042003 Ga0068851_100420032 196
71 3300005841 Ga0068863_100001711 Ga0068863_1000017117 196
72 3300005841 Ga0068863_100081940 Ga0068863_1000819402 196
73 3300006028 Ga0070717_10210095 Ga0070717_102100952 196
74 3300006195 Ga0075366_10005516 Ga0075366_100055166 196
75 3300006237 Ga0097621_100032494 Ga0097621_1000324942 196
76 3300006353 Ga0075370_10025069 Ga0075370_100250692 196
77 3300006358 Ga0068871_100039556 Ga0068871_1000395562 196
78 3300006358 Ga0068871_100271288 Ga0068871_1002712882 196
79 3300006881 Ga0068865_100000002 Ga0068865_10000000296 196
80 3300006931 Ga0097620_100133503 Ga0097620_1001335033 196
81 3300009093 Ga0105240_10001585 Ga0105240_1000158511 196
82 3300009093 Ga0105240_10295381 Ga0105240_102953812 196
83 3300009093 Ga0105240_10607184 Ga0105240_106071842 196
84 3300009094 Ga0111539_10209722 Ga0111539_102097223 196
85 3300009098 Ga0105245_10003064 Ga0105245_100030648 196
86 3300009148 Ga0105243_10000031 Ga0105243_10000031162 196
87 3300009174 Ga0105241_10211974 Ga0105241_102119742 196
88 3300009176 Ga0105242_10000044 Ga0105242_1000004416 196
89 3300009176 Ga0105242_10107995 Ga0105242_101079952 196
90 3300009177 Ga0105248_10006110 Ga0105248_1000611011 196
91 3300009553 Ga0105249_10044089 Ga0105249_100440892 196
92 3300009553 Ga0105249_10900160 Ga0105249_109001602 196
93 3300010375 Ga0105239_10048930 Ga0105239_100489304 196
94 3300011119 Ga0105246_10004111 Ga0105246_100041117 196
95 3300013100 Ga0157373_10033429 Ga0157373_100334292 196
96 3300013100 Ga0157373_10174203 Ga0157373_101742032 196
97 3300013104 Ga0157370_10135132 Ga0157370_101351322 196
98 3300013296 Ga0157374_10003136 Ga0157374_100031367 196
99 3300013296 Ga0157374_10018628 Ga0157374_100186282 196
100 3300013297 Ga0157378_10004709 Ga0157378_100047095 196
101 3300013306 Ga0163162_10031968 Ga0163162_100319682 196
102 3300013306 Ga0163162_10036799 Ga0163162_100367993 196
103 3300013306 Ga0163162_10226334 Ga0163162_102263343 196
104 3300013307 Ga0157372_10199047 Ga0157372_101990472 196
105 3300013308 Ga0157375_10017494 Ga0157375_100174943 196
106 3300014325 Ga0163163_10004055 Ga0163163_100040558 196
107 3300014968 Ga0157379_10000457 Ga0157379_1000045720 196
108 3300014969 Ga0157376_10000107 Ga0157376_100001074 196
109 3300021388 Ga0213875_10004951 Ga0213875_100049512 196
110 3300025233 Ga0209437_100042 Ga0209437_100042144 196
111 3300025233 Ga0209437_100062 Ga0209437_100062264 196
112 3300025254 Ga0209148_1000889 Ga0209148_100088911 196
113 3300025254 Ga0209148_1002999 Ga0209148_10029992 196
114 3300025261 Ga0209233_1000082 Ga0209233_1000082264 196
115 3300025261 Ga0209233_1000103 Ga0209233_1000103144 196
116 3300025261 Ga0209233_1011790 Ga0209233_10117903 196
117 3300025263 Ga0209565_1000254 Ga0209565_100025414 196
118 3300025272 Ga0209455_1001285 Ga0209455_10012852 196
119 3300025294 Ga0209025_1056185 Ga0209025_10561852 196
120 3300025295 Ga0209564_1002455 Ga0209564_10024553 196
121 3300025297 Ga0209758_1000017 Ga0209758_1000017166 196
122 3300025298 Ga0209050_1002462 Ga0209050_10024625 196
123 3300025321 Ga0207656_10026981 Ga0207656_100269812 196
124 3300025904 Ga0207647_10013087 Ga0207647_100130872 196
125 3300025907 Ga0207645_10000975 Ga0207645_1000097510 196
126 3300025907 Ga0207645_10060070 Ga0207645_100600702 196
127 3300025909 Ga0207705_10003194 Ga0207705_100031945 196
128 3300025909 Ga0207705_10055888 Ga0207705_100558882 196
129 3300025911 Ga0207654_10143449 Ga0207654_101434492 196
130 3300025913 Ga0207695_10011802 Ga0207695_100118025 196
131 3300025919 Ga0207657_10009488 Ga0207657_100094882 196
132 3300025919 Ga0207657_10045710 Ga0207657_100457102 196
133 3300025920 Ga0207649_10260289 Ga0207649_102602892 196
134 3300025921 Ga0207652_10778059 Ga0207652_107780591 196
135 3300025924 Ga0207694_10544450 Ga0207694_105444502 196
136 3300025925 Ga0207650_10057374 Ga0207650_100573742 196
137 3300025926 Ga0207659_10070678 Ga0207659_100706782 196
138 3300025927 Ga0207687_10001332 Ga0207687_100013327 196
139 3300025931 Ga0207644_10017199 Ga0207644_100171991 196
140 3300025932 Ga0207690_10138841 Ga0207690_101388412 196
141 3300025933 Ga0207706_10565395 Ga0207706_105653951 196
142 3300025934 Ga0207686_10000417 Ga0207686_1000041715 196
143 3300025935 Ga0207709_10000122 Ga0207709_100001223 196
144 3300025938 Ga0207704_10000003 Ga0207704_10000003162 196
145 3300025940 Ga0207691_10057076 Ga0207691_100570762 196
146 3300025941 Ga0207711_10027099 Ga0207711_100270993 196
147 3300025942 Ga0207689_10000335 Ga0207689_100003356 196
148 3300025949 Ga0207667_10000007 Ga0207667_1000000792 196
149 3300025960 Ga0207651_10000003 Ga0207651_10000003162 196
150 3300025961 Ga0207712_10023977 Ga0207712_100239772 196
151 3300025972 Ga0207668_10001756 Ga0207668_100017567 196
152 3300025972 Ga0207668_10278806 Ga0207668_102788062 196
153 3300025981 Ga0207640_10005564 Ga0207640_100055645 196
154 3300025981 Ga0207640_10051391 Ga0207640_100513913 196
155 3300026023 Ga0207677_10000233 Ga0207677_100002335 196
156 3300026035 Ga0207703_10000531 Ga0207703_100005315 196
157 3300026035 Ga0207703_10024750 Ga0207703_100247502 196
158 3300026041 Ga0207639_10003552 Ga0207639_100035527 196
159 3300026041 Ga0207639_10133414 Ga0207639_101334141 196
160 3300026067 Ga0207678_10006760 Ga0207678_100067601 196
161 3300026078 Ga0207702_10006813 Ga0207702_100068134 196
162 3300026078 Ga0207702_10014499 Ga0207702_100144994 196
163 3300026078 Ga0207702_10506107 Ga0207702_105061072 196
164 3300026088 Ga0207641_10004289 Ga0207641_100042899 196
165 3300026088 Ga0207641_10039256 Ga0207641_100392562 196
166 3300026089 Ga0207648_10000007 Ga0207648_1000000730 196
167 3300026121 Ga0207683_10016559 Ga0207683_100165593 196
168 3300027312 Ga0209371_1005091 Ga0209371_10050915 196
169 3300028379 Ga0268266_10222882 Ga0268266_102228822 196
170 3300028381 Ga0268264_10136124 Ga0268264_101361242 196
171 3300030500 Ga0268256_1004923 Ga0268256_10049235 196
172 3300031548 Ga0307408_100099250 Ga0307408_1000992502 196
173 3300031731 Ga0307405_10000159 Ga0307405_1000015918 196
174 3300031911 Ga0307412_10001872 Ga0307412_1000187214 196
175 3300032002 Ga0307416_100873503 Ga0307416_1008735032 196
176 3300032126 Ga0307415_100400493 Ga0307415_1004004932 196
177 3300035118 Ga0373954_0000021 Ga0373954_0000021_13364_14020 196
178 3300035410 Ga0373924_0196951 Ga0373924_0196951_140_796 196
179 3300035692 Ga0373935_0424133 Ga0373935_0424133_284_937 196
180 3300035724 Ga0373933_0012672 Ga0373933_0012672_12_668 196
181 3300036401 Ga0373937_0000982 Ga0373937_0000982_15644_16300 196
182 3300037471 Ga0395905_0010244 Ga0395905_0010244_5156_5818 196
183 3300037471 Ga0395905_0172556 Ga0395905_0172556_763_1422 196
184 3300037471 Ga0395905_0276404 Ga0395905_0276404_321_974 196
185 3300037853 Ga0436364_0885024 Ga0436364_0885024_7036_7689 196
186 3300038443 Ga0395901_0658839 Ga0395901_0658839_214_876 196
187 3300039447 Ga0436361_0798855 Ga0436361_0798855_120_773 196
188 3300044684 Ga0466966_0153390 Ga0466966_0153390_144_800 196
189 3300044694 Ga0466963_0078534 Ga0466963_0078534_1065_1718 196
190 3300044712 Ga0453684_0126490 Ga0453684_0126490_2201_2872 196
191 3300044712 Ga0453684_0203978 Ga0453684_0203978_1394_2044 196
192 3300044765 Ga0466970_0103212 Ga0466970_0103212_511_1167 196
193 3300044765 Ga0466970_0325833 Ga0466970_0325833_138_794 196
194 3300044901 Ga0466960_0254455 Ga0466960_0254455_163_816 196
195 3300044901 Ga0466960_0387707 Ga0466960_0387707_66_722 196
196 3300046492 Ga0495585_0001441 Ga0495585_0001441_1135_1797 196
197 3300046500 Ga0495596_0000037 Ga0495596_0000037_4719_5381 196
198 3300046506 Ga0495583_0000120 Ga0495583_0000120_12552_13211 196
199 3300046506 Ga0495583_0086231 Ga0495583_0086231_11_673 196
200 3300046507 Ga0495606_0041049 Ga0495606_0041049_942_1607 196
201 3300046512 Ga0495610_0007663 Ga0495610_0007663_2468_3148 196
202 3300046520 Ga0495637_0051131 Ga0495637_0051131_61_723 196
203 3300046522 Ga0495643_0000126 Ga0495643_0000126_55922_56584 196
204 3300046538 Ga0495609_0026462 Ga0495609_0026462_1304_2035 196
205 3300046616 Ga0495668_0000013 Ga0495668_0000013_340369_341031 196
206 3300046660 Ga0495625_0025886 Ga0495625_0025886_551_1282 196
207 3300047470 Ga0495681_0084321 Ga0495681_0084321_593_1324 196
208 3300047472 Ga0495686_0000072 Ga0495686_0000072_130366_131028 196
209 3300047472 Ga0495686_0021978 Ga0495686_0021978_796_1458 196
210 3300048088 Ga0495602_0040472 Ga0495602_0040472_1855_2511 196
211 3300048904 Ga0496101_0680776 Ga0496101_0680776_123_785 196
212 3300048910 Ga0496107_0511023 Ga0496107_0511023_166_813 196
213 3300048920 Ga0496117_0103524 Ga0496117_0103524_406_1140 196
214 3300048922 Ga0496119_0012929 Ga0496119_0012929_5253_5987 196
215 3300048923 Ga0496120_0026303 Ga0496120_0026303_1779_2513 196
216 3300048924 Ga0496121_0003242 Ga0496121_0003242_1809_2471 196
217 3300048924 Ga0496121_0004012 Ga0496121_0004012_5106_5768 196
218 3300048925 Ga0496122_0014110 Ga0496122_0014110_5411_6145 196
219 3300048926 Ga0496123_0103073 Ga0496123_0103073_812_1546 196
220 3300048929 Ga0496126_0005195 Ga0496126_0005195_1167_1829 196
221 3300049571 Ga0501034_0142143 Ga0501034_0142143_1190_1924 196
222 3300049578 Ga0501042_0335682 Ga0501042_0335682_312_959 196
223 3300049581 Ga0501047_0317337 Ga0501047_0317337_506_1162 196
224 3300050493 nmdc:mga0k408_11907_c1 nmdc:mga0k408_11907_c1_3171_3833 196
225 3300053125 Ga0500618_000378 Ga0500618_000378_20257_20991 196
226 3300053153 Ga0500616_0028973 Ga0500616_0028973_2034_2693 196
227 3300061734 Ga0530510_0377356 Ga0530510_0377356_353_1000 196
228 iso_pu_bacteria 2510917022 2511135616 196
229 iso_pu_bacteria 2511231027 2511388573 196
230 iso_pu_bacteria 2582581307 2585272691 196
231 iso_pu_bacteria 2582581315 2585327324 196
232 iso_pu_bacteria 2582581316 2585335290 196
233 iso_pu_bacteria 2585427531 2585562359 196
234 iso_pu_bacteria 2585427608 2585896800 196
235 iso_pu_bacteria 2585427609 2585906474 196
236 iso_pu_bacteria 2585428125 2587981896 196
237 iso_pu_bacteria 2615840698 2616551904 196
238 iso_pu_bacteria 2667528174 2671114412 196
239 iso_pu_bacteria 2818991448 2819607538 196
240 iso_pu_bacteria 2838029111 2838032036 196
241 iso_pu_bacteria 2842475841 2842478768 196
242 iso_pu_bacteria 2842502639 2842505913 196
243 iso_pu_bacteria 2842871566 2842876022 196
244 iso_pu_bacteria 2919408235 2919413134 196
245 iso_pu_bacteria 2928521798 2928525768 196
246 iso_pu_bacteria 2954011201 2954012144 196
247 iso_pu_bacteria 3002141150 3002146424 196
248 iso_pu_bacteria 8005484373 8005490015 196
249 iso_pu_bacteria 8005645114 8005650896 196
250 iso_pu_bacteria 8005682033 8005688450 196
251 3300053116 Ga0500592_000272 Ga0500592_000272_4094_4747 199
252 3300048913 Ga0496110_0435326 Ga0496110_0435326_87_764 200
253 3300028380 Ga0268265_10005089 Ga0268265_100050898 203
254 3300005347 Ga0070668_100091897 Ga0070668_1000918972 205
255 3300005353 Ga0070669_100030650 Ga0070669_1000306503 205
256 3300005367 Ga0070667_100000024 Ga0070667_10000002425 205
257 3300005843 Ga0068860_100000719 Ga0068860_10000071929 205
258 3300009553 Ga0105249_10000045 Ga0105249_1000004542 205
259 3300025923 Ga0207681_10013223 Ga0207681_100132234 205
260 3300025972 Ga0207668_10010090 Ga0207668_100100905 205
261 3300025986 Ga0207658_10000022 Ga0207658_10000022154 205
262 3300028381 Ga0268264_10000524 Ga0268264_1000052425 205
263 3300001915 JGI24741J21665_1000463 JGI24741J21665_100046316 206
264 3300001979 JGI24740J21852_10000050 JGI24740J21852_1000005026 206
265 3300001989 JGI24739J22299_10010378 JGI24739J22299_100103783 206
266 3300001990 JGI24737J22298_10033853 JGI24737J22298_100338532 206
267 3300003323 rootH1_10073304 rootH1_100733043 206
268 3300003323 rootH1_10137120 rootH1_101371203 206
269 3300005327 Ga0070658_10000978 Ga0070658_100009789 206
270 3300005327 Ga0070658_10020212 Ga0070658_100202122 206
271 3300005327 Ga0070658_10395131 Ga0070658_103951312 206
272 3300005329 Ga0070683_100001007 Ga0070683_10000100714 206
273 3300005331 Ga0070670_100005738 Ga0070670_1000057387 206
274 3300005331 Ga0070670_100029040 Ga0070670_1000290404 206
275 3300005336 Ga0070680_100006544 Ga0070680_1000065447 206
276 3300005339 Ga0070660_100002998 Ga0070660_1000029983 206
277 3300005339 Ga0070660_100005757 Ga0070660_1000057577 206
278 3300005344 Ga0070661_100000519 Ga0070661_10000051929 206
279 3300005344 Ga0070661_100004462 Ga0070661_1000044625 206
280 3300005344 Ga0070661_100019752 Ga0070661_1000197524 206
281 3300005344 Ga0070661_100055345 Ga0070661_1000553452 206
282 3300005353 Ga0070669_100170105 Ga0070669_1001701052 206
283 3300005355 Ga0070671_100005750 Ga0070671_1000057506 206
284 3300005355 Ga0070671_100007151 Ga0070671_1000071512 206
285 3300005356 Ga0070674_100444720 Ga0070674_1004447201 206
286 3300005366 Ga0070659_100009952 Ga0070659_1000099525 206
287 3300005366 Ga0070659_100011323 Ga0070659_1000113234 206
288 3300005366 Ga0070659_100053956 Ga0070659_1000539561 206
289 3300005366 Ga0070659_100329079 Ga0070659_1003290792 206
290 3300005366 Ga0070659_100540071 Ga0070659_1005400712 206
291 3300005455 Ga0070663_100000253 Ga0070663_10000025318 206
292 3300005455 Ga0070663_100001203 Ga0070663_1000012033 206
293 3300005457 Ga0070662_100082969 Ga0070662_1000829693 206
294 3300005457 Ga0070662_100267401 Ga0070662_1002674012 206
295 3300005457 Ga0070662_100275303 Ga0070662_1002753032 206
296 3300005530 Ga0070679_100368702 Ga0070679_1003687022 206
297 3300005535 Ga0070684_100022141 Ga0070684_1000221412 206
298 3300005535 Ga0070684_100893289 Ga0070684_1008932891 206
299 3300005539 Ga0068853_100012330 Ga0068853_1000123303 206
300 3300005539 Ga0068853_100149652 Ga0068853_1001496523 206
301 3300005539 Ga0068853_100490306 Ga0068853_1004903062 206
302 3300005543 Ga0070672_100255996 Ga0070672_1002559962 206
303 3300005543 Ga0070672_100534854 Ga0070672_1005348541 206
304 3300005563 Ga0068855_100000916 Ga0068855_1000009168 206
305 3300005563 Ga0068855_100016410 Ga0068855_1000164105 206
306 3300005563 Ga0068855_100031315 Ga0068855_1000313154 206
307 3300005563 Ga0068855_100044942 Ga0068855_1000449422 206
308 3300005563 Ga0068855_100045093 Ga0068855_1000450934 206
309 3300005564 Ga0070664_100036196 Ga0070664_1000361961 206
310 3300005564 Ga0070664_100127643 Ga0070664_1001276432 206
311 3300005564 Ga0070664_100185895 Ga0070664_1001858952 206
312 3300005564 Ga0070664_100187592 Ga0070664_1001875922 206
313 3300005564 Ga0070664_100501949 Ga0070664_1005019492 206
314 3300005577 Ga0068857_100017104 Ga0068857_1000171044 206
315 3300005577 Ga0068857_100031885 Ga0068857_1000318855 206
316 3300005577 Ga0068857_100076500 Ga0068857_1000765003 206
317 3300005578 Ga0068854_100003821 Ga0068854_1000038215 206
318 3300005578 Ga0068854_100017262 Ga0068854_1000172622 206
319 3300005614 Ga0068856_100001363 Ga0068856_10000136314 206
320 3300005614 Ga0068856_100004335 Ga0068856_1000043359 206
321 3300005614 Ga0068856_100007588 Ga0068856_10000758812 206
322 3300005614 Ga0068856_100009981 Ga0068856_1000099814 206
323 3300005614 Ga0068856_100013961 Ga0068856_1000139614 206
324 3300005614 Ga0068856_100021434 Ga0068856_1000214343 206
325 3300005614 Ga0068856_100024263 Ga0068856_1000242634 206
326 3300005614 Ga0068856_100035195 Ga0068856_1000351953 206
327 3300005614 Ga0068856_100074319 Ga0068856_1000743193 206
328 3300005616 Ga0068852_100000226 Ga0068852_1000002268 206
329 3300005616 Ga0068852_100003368 Ga0068852_1000033685 206
330 3300005616 Ga0068852_100004455 Ga0068852_1000044557 206
331 3300005616 Ga0068852_100006535 Ga0068852_1000065356 206
332 3300005616 Ga0068852_100017513 Ga0068852_1000175133 206
333 3300005616 Ga0068852_100456123 Ga0068852_1004561232 206
334 3300005618 Ga0068864_100001264 Ga0068864_10000126414 206
335 3300005618 Ga0068864_100166577 Ga0068864_1001665773 206
336 3300005834 Ga0068851_10001112 Ga0068851_100011124 206
337 3300005841 Ga0068863_100002921 Ga0068863_10000292113 206
338 3300005985 Ga0081539_10027576 Ga0081539_100275763 206
339 3300009093 Ga0105240_10001987 Ga0105240_1000198714 206
340 3300009093 Ga0105240_10326806 Ga0105240_103268062 206
341 3300009174 Ga0105241_10083202 Ga0105241_100832022 206
342 3300009177 Ga0105248_10002807 Ga0105248_100028077 206
343 3300009545 Ga0105237_10001260 Ga0105237_1000126014 206
344 3300009551 Ga0105238_10000628 Ga0105238_1000062815 206
345 3300010375 Ga0105239_10002195 Ga0105239_1000219512 206
346 3300013100 Ga0157373_10003064 Ga0157373_100030643 206
347 3300013100 Ga0157373_10011421 Ga0157373_100114213 206
348 3300013100 Ga0157373_10058997 Ga0157373_100589972 206
349 3300013100 Ga0157373_10117418 Ga0157373_101174182 206
350 3300013102 Ga0157371_10000857 Ga0157371_1000085711 206
351 3300013102 Ga0157371_10007479 Ga0157371_100074796 206
352 3300013102 Ga0157371_10025127 Ga0157371_100251274 206
353 3300013102 Ga0157371_10067829 Ga0157371_100678293 206
354 3300013102 Ga0157371_10071207 Ga0157371_100712072 206
355 3300013104 Ga0157370_10000867 Ga0157370_1000086723 206
356 3300013104 Ga0157370_10001375 Ga0157370_100013756 206
357 3300013104 Ga0157370_10001572 Ga0157370_1000157213 206
358 3300013104 Ga0157370_10040009 Ga0157370_100400093 206
359 3300013104 Ga0157370_10096738 Ga0157370_100967382 206
360 3300013104 Ga0157370_10197838 Ga0157370_101978381 206
361 3300013104 Ga0157370_10597336 Ga0157370_105973362 206
362 3300013105 Ga0157369_10000850 Ga0157369_100008508 206
363 3300013105 Ga0157369_10001070 Ga0157369_1000107012 206
364 3300013105 Ga0157369_10001830 Ga0157369_100018307 206
365 3300013105 Ga0157369_10004751 Ga0157369_1000475114 206
366 3300013105 Ga0157369_10008561 Ga0157369_100085617 206
367 3300013105 Ga0157369_10014361 Ga0157369_100143614 206
368 3300013105 Ga0157369_10034031 Ga0157369_100340314 206
369 3300013105 Ga0157369_10192142 Ga0157369_101921422 206
370 3300013105 Ga0157369_10339736 Ga0157369_103397362 206
371 3300013306 Ga0163162_10084708 Ga0163162_100847082 206
372 3300013306 Ga0163162_10187155 Ga0163162_101871553 206
373 3300013307 Ga0157372_10000448 Ga0157372_1000044819 206
374 3300013307 Ga0157372_10002127 Ga0157372_1000212717 206
375 3300013307 Ga0157372_10043055 Ga0157372_100430554 206
376 3300013307 Ga0157372_10081283 Ga0157372_100812834 206
377 3300014325 Ga0163163_10942509 Ga0163163_109425092 206
378 3300017792 Ga0163161_10190439 Ga0163161_101904392 206
379 3300017792 Ga0163161_10209647 Ga0163161_102096472 206
380 3300025321 Ga0207656_10000160 Ga0207656_100001604 206
381 3300025903 Ga0207680_10159514 Ga0207680_101595142 206
382 3300025904 Ga0207647_10001065 Ga0207647_1000106512 206
383 3300025904 Ga0207647_10062172 Ga0207647_100621722 206
384 3300025909 Ga0207705_10000766 Ga0207705_1000076614 206
385 3300025909 Ga0207705_10002693 Ga0207705_100026935 206
386 3300025909 Ga0207705_10024701 Ga0207705_100247013 206
387 3300025909 Ga0207705_10037864 Ga0207705_100378644 206
388 3300025911 Ga0207654_10044978 Ga0207654_100449783 206
389 3300025913 Ga0207695_10001511 Ga0207695_1000151111 206
390 3300025914 Ga0207671_10000944 Ga0207671_1000094412 206
391 3300025917 Ga0207660_10140323 Ga0207660_101403231 206
392 3300025919 Ga0207657_10000140 Ga0207657_1000014028 206
393 3300025919 Ga0207657_10023998 Ga0207657_100239982 206
394 3300025920 Ga0207649_10000130 Ga0207649_1000013020 206
395 3300025920 Ga0207649_10005297 Ga0207649_100052975 206
396 3300025920 Ga0207649_10026524 Ga0207649_100265243 206
397 3300025921 Ga0207652_10030898 Ga0207652_100308983 206
398 3300025924 Ga0207694_10002686 Ga0207694_1000268614 206
399 3300025925 Ga0207650_10005442 Ga0207650_100054422 206
400 3300025931 Ga0207644_10000141 Ga0207644_1000014149 206
401 3300025931 Ga0207644_10199749 Ga0207644_101997492 206
402 3300025932 Ga0207690_10000063 Ga0207690_1000006341 206
403 3300025932 Ga0207690_10009586 Ga0207690_100095864 206
404 3300025932 Ga0207690_10292566 Ga0207690_102925662 206
405 3300025932 Ga0207690_10476338 Ga0207690_104763382 206
406 3300025932 Ga0207690_10512973 Ga0207690_105129732 206
407 3300025933 Ga0207706_10103202 Ga0207706_101032023 206
408 3300025941 Ga0207711_10001407 Ga0207711_1000140714 206
409 3300025941 Ga0207711_10040043 Ga0207711_100400434 206
410 3300025944 Ga0207661_10000290 Ga0207661_1000029016 206
411 3300025945 Ga0207679_10001655 Ga0207679_100016558 206
412 3300025945 Ga0207679_10075081 Ga0207679_100750813 206
413 3300025945 Ga0207679_10156946 Ga0207679_101569462 206
414 3300025945 Ga0207679_10202824 Ga0207679_102028242 206
415 3300025945 Ga0207679_10382032 Ga0207679_103820322 206
416 3300025949 Ga0207667_10000006 Ga0207667_10000006116 206
417 3300025949 Ga0207667_10000499 Ga0207667_1000049918 206
418 3300025949 Ga0207667_10011292 Ga0207667_100112924 206
419 3300025949 Ga0207667_10027485 Ga0207667_100274854 206
420 3300025949 Ga0207667_10034048 Ga0207667_100340484 206
421 3300025949 Ga0207667_10094580 Ga0207667_100945803 206
422 3300025981 Ga0207640_10000643 Ga0207640_100006439 206
423 3300025981 Ga0207640_10005178 Ga0207640_100051784 206
424 3300026041 Ga0207639_10000193 Ga0207639_1000019322 206
425 3300026041 Ga0207639_10205131 Ga0207639_102051312 206
426 3300026067 Ga0207678_10000261 Ga0207678_1000026120 206
427 3300026067 Ga0207678_10003245 Ga0207678_100032458 206
428 3300026067 Ga0207678_10518270 Ga0207678_105182702 206
429 3300026078 Ga0207702_10001036 Ga0207702_100010369 206
430 3300026078 Ga0207702_10005387 Ga0207702_100053874 206
431 3300026078 Ga0207702_10012552 Ga0207702_100125523 206
432 3300026078 Ga0207702_10016916 Ga0207702_100169166 206
433 3300026078 Ga0207702_10023769 Ga0207702_100237695 206
434 3300026078 Ga0207702_10030443 Ga0207702_100304434 206
435 3300026078 Ga0207702_10052685 Ga0207702_100526854 206
436 3300026088 Ga0207641_10006387 Ga0207641_100063879 206
437 3300026089 Ga0207648_10205139 Ga0207648_102051393 206
438 3300026095 Ga0207676_10059270 Ga0207676_100592703 206
439 3300026116 Ga0207674_10001742 Ga0207674_1000174213 206
440 3300026116 Ga0207674_10104220 Ga0207674_101042203 206
441 3300026116 Ga0207674_10171456 Ga0207674_101714562 206
442 3300026142 Ga0207698_10000530 Ga0207698_1000053021 206
443 3300026142 Ga0207698_10001130 Ga0207698_100011308 206
444 3300026142 Ga0207698_10002234 Ga0207698_100022344 206
445 3300026142 Ga0207698_10005513 Ga0207698_100055132 206
446 3300026142 Ga0207698_10009045 Ga0207698_100090455 206
447 3300026142 Ga0207698_10553425 Ga0207698_105534252 206
448 3300031548 Ga0307408_100015434 Ga0307408_1000154342 206
449 3300031548 Ga0307408_100120549 Ga0307408_1001205493 206
450 3300031548 Ga0307408_100243307 Ga0307408_1002433072 206
451 3300031731 Ga0307405_10001660 Ga0307405_100016607 206
452 3300031731 Ga0307405_10015379 Ga0307405_100153793 206
453 3300031731 Ga0307405_10206021 Ga0307405_102060212 206
454 3300031824 Ga0307413_10003772 Ga0307413_100037726 206
455 3300031824 Ga0307413_10144669 Ga0307413_101446692 206
456 3300031824 Ga0307413_10148227 Ga0307413_101482272 206
457 3300031852 Ga0307410_10003346 Ga0307410_100033463 206
458 3300031852 Ga0307410_10005405 Ga0307410_100054053 206
459 3300031852 Ga0307410_10021097 Ga0307410_100210973 206
460 3300031852 Ga0307410_10023660 Ga0307410_100236604 206
461 3300031852 Ga0307410_10308364 Ga0307410_103083642 206
462 3300031852 Ga0307410_10402484 Ga0307410_104024841 206
463 3300031901 Ga0307406_10004791 Ga0307406_100047915 206
464 3300031901 Ga0307406_10012578 Ga0307406_100125782 206
465 3300031901 Ga0307406_10021074 Ga0307406_100210744 206
466 3300031901 Ga0307406_10063975 Ga0307406_100639753 206
467 3300031901 Ga0307406_10104300 Ga0307406_101043003 206
468 3300031901 Ga0307406_10233222 Ga0307406_102332222 206
469 3300031903 Ga0307407_10007375 Ga0307407_100073753 206
470 3300031903 Ga0307407_10015007 Ga0307407_100150073 206
471 3300031903 Ga0307407_10101166 Ga0307407_101011662 206
472 3300031903 Ga0307407_10346591 Ga0307407_103465912 206
473 3300031903 Ga0307407_10553034 Ga0307407_105530341 206
474 3300031911 Ga0307412_10006623 Ga0307412_100066235 206
475 3300031911 Ga0307412_10007975 Ga0307412_100079754 206
476 3300031911 Ga0307412_10029465 Ga0307412_100294652 206
477 3300031911 Ga0307412_10034224 Ga0307412_100342242 206
478 3300031911 Ga0307412_10066353 Ga0307412_100663533 206
479 3300031911 Ga0307412_10126196 Ga0307412_101261962 206
480 3300031911 Ga0307412_10941811 Ga0307412_109418111 206
481 3300031995 Ga0307409_100018630 Ga0307409_1000186304 206
482 3300031995 Ga0307409_100036109 Ga0307409_1000361094 206
483 3300031995 Ga0307409_100151502 Ga0307409_1001515022 206
484 3300031995 Ga0307409_100593943 Ga0307409_1005939432 206
485 3300032002 Ga0307416_100011282 Ga0307416_1000112824 206
486 3300032002 Ga0307416_100013702 Ga0307416_1000137023 206
487 3300032002 Ga0307416_100021888 Ga0307416_1000218882 206
488 3300032002 Ga0307416_100046977 Ga0307416_1000469773 206
489 3300032002 Ga0307416_100082813 Ga0307416_1000828132 206
490 3300032002 Ga0307416_100257844 Ga0307416_1002578442 206
491 3300032004 Ga0307414_10025647 Ga0307414_100256474 206
492 3300032004 Ga0307414_10084045 Ga0307414_100840452 206
493 3300032005 Ga0307411_10011013 Ga0307411_100110132 206
494 3300032005 Ga0307411_10035995 Ga0307411_100359953 206
495 3300032005 Ga0307411_10053997 Ga0307411_100539972 206
496 3300032005 Ga0307411_10056090 Ga0307411_100560903 206
497 3300032005 Ga0307411_10066619 Ga0307411_100666192 206
498 3300032005 Ga0307411_10080632 Ga0307411_100806322 206
499 3300032005 Ga0307411_10584308 Ga0307411_105843082 206
500 3300032005 Ga0307411_10864087 Ga0307411_108640872 206
501 3300032126 Ga0307415_100005623 Ga0307415_1000056234 206
502 3300032126 Ga0307415_100016410 Ga0307415_1000164102 206
503 3300032126 Ga0307415_100019197 Ga0307415_1000191973 206
504 3300032126 Ga0307415_100020466 Ga0307415_1000204662 206
505 3300032126 Ga0307415_100426780 Ga0307415_1004267802 206
506 3300037312 Ga0395899_0000850 Ga0395899_0000850_13041_13793 206
507 3300037312 Ga0395899_0000943 Ga0395899_0000943_6668_7375 206
508 3300037312 Ga0395899_0013653 Ga0395899_0013653_3278_3985 206
509 3300037312 Ga0395899_0036605 Ga0395899_0036605_1452_2147 206
510 3300037312 Ga0395899_0101433 Ga0395899_0101433_843_1544 206
511 3300037312 Ga0395899_0127154 Ga0395899_0127154_441_1148 206
512 3300037312 Ga0395899_0313699 Ga0395899_0313699_55_750 206
513 3300037418 Ga0395900_0000971 Ga0395900_0000971_22059_22811 206
514 3300037418 Ga0395900_0001252 Ga0395900_0001252_26930_27625 206
515 3300037418 Ga0395900_0002045 Ga0395900_0002045_10657_11358 206
516 3300037418 Ga0395900_0004357 Ga0395900_0004357_788_1495 206
517 3300037418 Ga0395900_0005701 Ga0395900_0005701_10935_11642 206
518 3300037418 Ga0395900_0007138 Ga0395900_0007138_7583_8278 206
519 3300037418 Ga0395900_0013055 Ga0395900_0013055_5113_5820 206
520 3300037418 Ga0395900_0016657 Ga0395900_0016657_167_874 206
521 3300037418 Ga0395900_0023867 Ga0395900_0023867_504_1205 206
522 3300037418 Ga0395900_0074830 Ga0395900_0074830_559_1254 206
523 3300037418 Ga0395900_0141937 Ga0395900_0141937_1565_2260 206
524 3300037418 Ga0395900_0693733 Ga0395900_0693733_34_735 206
525 3300037466 Ga0395898_0001771 Ga0395898_0001771_2615_3322 206
526 3300037466 Ga0395898_0002756 Ga0395898_0002756_5025_5777 206
527 3300037466 Ga0395898_0018061 Ga0395898_0018061_3294_3989 206
528 3300037466 Ga0395898_0034080 Ga0395898_0034080_3425_4132 206
529 3300037466 Ga0395898_0087471 Ga0395898_0087471_1302_1997 206
530 3300037466 Ga0395898_0908972 Ga0395898_0908972_76_783 206
531 3300037471 Ga0395905_0000915 Ga0395905_0000915_10437_11144 206
532 3300037471 Ga0395905_0000920 Ga0395905_0000920_15152_15904 206
533 3300037471 Ga0395905_0001250 Ga0395905_0001250_2615_3322 206
534 3300037471 Ga0395905_0004810 Ga0395905_0004810_3929_4636 206
535 3300037471 Ga0395905_0023018 Ga0395905_0023018_1898_2605 206
536 3300037471 Ga0395905_0028486 Ga0395905_0028486_1402_2097 206
537 3300037471 Ga0395905_0030212 Ga0395905_0030212_4031_4732 206
538 3300037471 Ga0395905_0032395 Ga0395905_0032395_107_814 206
539 3300037471 Ga0395905_0051284 Ga0395905_0051284_483_1178 206
540 3300037471 Ga0395905_0191306 Ga0395905_0191306_320_1021 206
541 3300038443 Ga0395901_0000810 Ga0395901_0000810_22112_22864 206
542 3300038443 Ga0395901_0001847 Ga0395901_0001847_6437_7138 206
543 3300038443 Ga0395901_0001911 Ga0395901_0001911_10969_11664 206
544 3300038443 Ga0395901_0002995 Ga0395901_0002995_4931_5638 206
545 3300038443 Ga0395901_0005384 Ga0395901_0005384_8505_9212 206
546 3300038443 Ga0395901_0021665 Ga0395901_0021665_5805_6512 206
547 3300038443 Ga0395901_0116632 Ga0395901_0116632_1623_2318 206
548 3300038443 Ga0395901_0168524 Ga0395901_0168524_416_1111 206
549 3300038443 Ga0395901_0205825 Ga0395901_0205825_857_1558 206
550 3300038443 Ga0395901_0236940 Ga0395901_0236940_296_997 206
551 3300038443 Ga0395901_0277760 Ga0395901_0277760_399_1094 206
552 3300044684 Ga0466966_0013578 Ga0466966_0013578_541_1236 206
553 3300044693 Ga0466961_0008433 Ga0466961_0008433_5525_6220 206
554 3300044694 Ga0466963_0058690 Ga0466963_0058690_763_1458 206
555 3300044842 Ga0466957_0140424 Ga0466957_0140424_357_1052 206
556 3300046506 Ga0495583_0000122 Ga0495583_0000122_94971_95666 206
557 3300048905 Ga0496102_0113955 Ga0496102_0113955_1511_2218 206
558 3300048911 Ga0496108_0002824 Ga0496108_0002824_4430_5137 206
559 3300048914 Ga0496111_0071011 Ga0496111_0071011_1223_1930 206
560 3300048915 Ga0496112_0002939 Ga0496112_0002939_4198_4905 206
561 3300048916 Ga0496113_0048526 Ga0496113_0048526_1400_2107 206
562 3300053119 Ga0500595_001170 Ga0500595_001170_3332_4027 206
563 3300053730 Ga0500645_000003 Ga0500645_000003_133828_134523 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

151

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m96-assembly1.cif.gz_A-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8903 2 194
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8846 2 203
7p48-assembly1.cif.gz_6 staphylococcus aureus ribosome in complex with sal(b) 0.8779 1 196
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8767 2 203
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8712 1 205
ID Description Score Start End Superfamily
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9143 1 194 3.40.50.300
af_A0A0P0VBQ7_902_1031_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8881 2 63 3.40.50.300
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.885 2 63 3.40.50.300
af_A0A1D6JBW9_1150_1300_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8811 2 65 3.40.50.300
af_A0A0R0IY12_408_566_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8787 2 63 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9549 1 205 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7G4RK67-F1-model_v4 ABC transporter domain-containing protein 0.9515 1 204 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7X4K8Y7-F1-model_v4 ATP-binding cassette domain-containing protein 0.9459 1 205 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-Q93UJ9-F1-model_v4 Wzt2 0.943 5 204 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A382UWD2-F1-model_v4 ABC transporter domain-containing protein 0.9423 71 188 GO:0005524

Feature Viewer

pLDDT pTM Quality
88.09 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map