F463940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 562 | 257 | 1124 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300020069|Ga0197907_10896267|Ga0197907_108962672 |
| Length | 239 |
| Sequence | VGAGARVSCPSGVPRRLAPVSALQVASVETLETYGAATAGCTRCRLAQGRTQVVFGTGNPRADLMFVGEAPGFHEDKQGVPFVGQAGKLLDGLLAGVQLRREDVYIANVLKCRPPGNRDPQQDEIEACEPHLFRQIELIEPKVIATLGNFATKLLSGRPLGITRVHGQEQELTIAGRSVLLYPIYHPAAALYTPAMLKVLESDFARLPELMGRGSRPAALAEPVPEPVVAEPAEQLGLF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 110 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 114 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 115 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 117 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 125 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 126 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 129 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 137 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 138 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 140 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 141 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 142 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 143 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 144 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 145 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 146 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 147 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 152 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 153 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 154 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 219 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 224 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 225 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 226 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 227 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 254 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.36 |
| Nodule | 0 |
| Rhizoplane | 11.74 |
| Rhizosphere | 87.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0197907_10896267 | 3300020069 | Bacteria | 1407 |
| 2 | Ga0070658_10280594 | 3300005327 | Bacteria | 1418 |
| 3 | Ga0070683_100196505 | 3300005329 | Bacteria | 1915 |
| 4 | Ga0070680_100047923 | 3300005336 | Bacteria | 3481 |
| 5 | Ga0070680_100339421 | 3300005336 | Bacteria | 1276 |
| 6 | Ga0070660_100684499 | 3300005339 | Bacteria | 859 |
| 7 | Ga0070668_100281307 | 3300005347 | Unclassified | 1389 |
| 8 | Ga0070675_100156643 | 3300005354 | Bacteria | 1956 |
| 9 | Ga0070671_100020561 | 3300005355 | Bacteria | 5384 |
| 10 | Ga0070671_100202953 | 3300005355 | Bacteria | 1681 |
| 11 | Ga0070671_100511910 | 3300005355 | Bacteria | 1033 |
| 12 | Ga0070674_100015813 | 3300005356 | Bacteria | 4719 |
| 13 | Ga0070714_100106907 | 3300005435 | Bacteria | 2472 |
| 14 | Ga0070714_100172277 | 3300005435 | Bacteria | 1965 |
| 15 | Ga0070713_100311538 | 3300005436 | Unclassified | 1451 |
| 16 | Ga0070710_10007726 | 3300005437 | Bacteria | 5214 |
| 17 | Ga0070711_100031534 | 3300005439 | Bacteria | 3519 |
| 18 | Ga0070678_100133436 | 3300005456 | Unclassified | 1976 |
| 19 | Ga0070681_10026566 | 3300005458 | Bacteria | 5819 |
| 20 | Ga0068867_100088176 | 3300005459 | Bacteria | 2351 |
| 21 | Ga0070706_100091840 | 3300005467 | Unclassified | 2816 |
| 22 | Ga0070706_100100555 | 3300005467 | Bacteria | 2687 |
| 23 | Ga0070706_100298694 | 3300005467 | Bacteria | 1503 |
| 24 | Ga0070706_100311054 | 3300005467 | Bacteria | 1470 |
| 25 | Ga0070707_100000459 | 3300005468 | Bacteria | 40275 |
| 26 | Ga0070707_100007106 | 3300005468 | Bacteria | 10380 |
| 27 | Ga0070707_100043066 | 3300005468 | Bacteria | 4321 |
| 28 | Ga0070707_100064532 | 3300005468 | Bacteria | 3516 |
| 29 | Ga0070707_100113299 | 3300005468 | Bacteria | 2631 |
| 30 | Ga0070707_100259614 | 3300005468 | Bacteria | 1690 |
| 31 | Ga0070698_100001624 | 3300005471 | Bacteria | 25040 |
| 32 | Ga0070698_100062718 | 3300005471 | Bacteria | 3749 |
| 33 | Ga0070698_100771835 | 3300005471 | Archaea | 905 |
| 34 | Ga0070699_100190872 | 3300005518 | Bacteria | 1820 |
| 35 | Ga0070699_100732652 | 3300005518 | Unclassified | 904 |
| 36 | Ga0070679_100103420 | 3300005530 | Bacteria | 2834 |
| 37 | Ga0070679_100151473 | 3300005530 | Bacteria | 2295 |
| 38 | Ga0070684_100074215 | 3300005535 | Bacteria | 2998 |
| 39 | Ga0070684_100213157 | 3300005535 | Bacteria | 1760 |
| 40 | Ga0070686_100057693 | 3300005544 | Bacteria | 2495 |
| 41 | Ga0070686_100098803 | 3300005544 | Bacteria | 1968 |
| 42 | Ga0070704_100341599 | 3300005549 | Bacteria | 1261 |
| 43 | Ga0070664_100093886 | 3300005564 | Bacteria | 2601 |
| 44 | Ga0068857_100173306 | 3300005577 | Bacteria | 1962 |
| 45 | Ga0068856_100324272 | 3300005614 | Bacteria | 1557 |
| 46 | Ga0068856_100415955 | 3300005614 | Bacteria | 1364 |
| 47 | Ga0070702_100203703 | 3300005615 | Unclassified | 1312 |
| 48 | Ga0068852_100249226 | 3300005616 | Bacteria | 1701 |
| 49 | Ga0068852_100332805 | 3300005616 | Unclassified | 1478 |
| 50 | Ga0068866_10193579 | 3300005718 | Bacteria | 1210 |
| 51 | Ga0068870_10050347 | 3300005840 | Bacteria | 2201 |
| 52 | Ga0068863_100224208 | 3300005841 | Unclassified | 1812 |
| 53 | Ga0070717_10026487 | 3300006028 | Bacteria | 4625 |
| 54 | Ga0070717_10028548 | 3300006028 | Bacteria | 4467 |
| 55 | Ga0070717_10032677 | 3300006028 | Bacteria | 4195 |
| 56 | Ga0070717_10036084 | 3300006028 | Bacteria | 4007 |
| 57 | Ga0070715_10052072 | 3300006163 | Bacteria | 1764 |
| 58 | Ga0070716_100346066 | 3300006173 | Bacteria | 1050 |
| 59 | Ga0070712_100013729 | 3300006175 | Bacteria | 5182 |
| 60 | Ga0070712_100637078 | 3300006175 | Bacteria | 905 |
| 61 | Ga0068871_100089156 | 3300006358 | Bacteria | 2567 |
| 62 | Ga0068871_100212098 | 3300006358 | Bacteria | 1675 |
| 63 | Ga0075431_100012316 | 3300006847 | Bacteria | 8629 |
| 64 | Ga0075433_10004670 | 3300006852 | Bacteria | 10682 |
| 65 | Ga0075434_100001312 | 3300006871 | Bacteria | 20750 |
| 66 | Ga0068865_100029581 | 3300006881 | Bacteria | 3636 |
| 67 | Ga0068865_100104916 | 3300006881 | Bacteria | 2075 |
| 68 | Ga0075436_100055958 | 3300006914 | Bacteria | 2725 |
| 69 | Ga0075435_100133816 | 3300007076 | Bacteria | 2076 |
| 70 | Ga0105250_10109416 | 3300009092 | Bacteria | 1131 |
| 71 | Ga0105240_10237564 | 3300009093 | Bacteria | 2114 |
| 72 | Ga0105240_10423414 | 3300009093 | Bacteria | 1495 |
| 73 | Ga0105240_10636887 | 3300009093 | Unclassified | 1170 |
| 74 | Ga0105240_10753539 | 3300009093 | Bacteria | 1058 |
| 75 | Ga0105240_10898312 | 3300009093 | Bacteria | 953 |
| 76 | Ga0111539_11296795 | 3300009094 | Bacteria | 845 |
| 77 | Ga0105245_10085151 | 3300009098 | Bacteria | 2897 |
| 78 | Ga0105245_10185989 | 3300009098 | Bacteria | 1987 |
| 79 | Ga0105245_10194644 | 3300009098 | Bacteria | 1944 |
| 80 | Ga0105245_10212951 | 3300009098 | Bacteria | 1861 |
| 81 | Ga0105247_10110958 | 3300009101 | Bacteria | 1765 |
| 82 | Ga0114129_10021487 | 3300009147 | Bacteria | 9160 |
| 83 | Ga0105243_10050032 | 3300009148 | Bacteria | 3300 |
| 84 | Ga0105242_10055936 | 3300009176 | Bacteria | 3228 |
| 85 | Ga0105242_10118033 | 3300009176 | Bacteria | 2272 |
| 86 | Ga0105242_10132871 | 3300009176 | Bacteria | 2150 |
| 87 | Ga0105242_10175069 | 3300009176 | Bacteria | 1888 |
| 88 | Ga0105248_10671645 | 3300009177 | Bacteria | 1169 |
| 89 | Ga0105237_10139610 | 3300009545 | Bacteria | 2417 |
| 90 | Ga0105238_10002351 | 3300009551 | Bacteria | 19018 |
| 91 | Ga0105249_10116372 | 3300009553 | Bacteria | 2534 |
| 92 | Ga0105249_10421723 | 3300009553 | Unclassified | 1368 |
| 93 | Ga0105249_10647489 | 3300009553 | Bacteria | 1114 |
| 94 | Ga0105239_10204410 | 3300010375 | Bacteria | 2213 |
| 95 | Ga0105239_10733806 | 3300010375 | Bacteria | 1130 |
| 96 | Ga0105246_10019323 | 3300011119 | Bacteria | 4352 |
| 97 | Ga0157373_10468587 | 3300013100 | Bacteria | 908 |
| 98 | Ga0157370_10471103 | 3300013104 | Bacteria | 1154 |
| 99 | Ga0157369_10229946 | 3300013105 | Bacteria | 1939 |
| 100 | Ga0157374_10011139 | 3300013296 | Bacteria | 7773 |
| 101 | Ga0157374_10030374 | 3300013296 | Bacteria | 4906 |
| 102 | Ga0157378_10272924 | 3300013297 | Bacteria | 1627 |
| 103 | Ga0157378_10482070 | 3300013297 | Bacteria | 1236 |
| 104 | Ga0163162_10063209 | 3300013306 | Bacteria | 3743 |
| 105 | Ga0163162_10150799 | 3300013306 | Bacteria | 2442 |
| 106 | Ga0163162_10248097 | 3300013306 | Bacteria | 1912 |
| 107 | Ga0157372_10357775 | 3300013307 | Bacteria | 1701 |
| 108 | Ga0157375_10760938 | 3300013308 | Bacteria | 1119 |
| 109 | Ga0163163_10101520 | 3300014325 | Bacteria | 2899 |
| 110 | Ga0157380_10053568 | 3300014326 | Bacteria | 3199 |
| 111 | Ga0157380_10139872 | 3300014326 | Bacteria | 2078 |
| 112 | Ga0157377_10025073 | 3300014745 | Bacteria | 3178 |
| 113 | Ga0157376_10072300 | 3300014969 | Bacteria | 2934 |
| 114 | Ga0157376_10073327 | 3300014969 | Bacteria | 2915 |
| 115 | Ga0157376_10681308 | 3300014969 | Bacteria | 1031 |
| 116 | Ga0163161_10060869 | 3300017792 | Bacteria | 2749 |
| 117 | Ga0163161_10398243 | 3300017792 | Unclassified | 1103 |
| 118 | Ga0206356_10776365 | 3300020070 | Bacteria | 915 |
| 119 | Ga0206353_10017238 | 3300020082 | Bacteria | 1543 |
| 120 | Ga0206353_11127049 | 3300020082 | Bacteria | 4901 |
| 121 | Ga0224712_10048454 | 3300022467 | Bacteria | 1640 |
| 122 | Ga0207688_10020358 | 3300025901 | Bacteria | 3622 |
| 123 | Ga0207688_10111628 | 3300025901 | Bacteria | 1587 |
| 124 | Ga0207699_10069640 | 3300025906 | Bacteria | 2146 |
| 125 | Ga0207643_10180683 | 3300025908 | Bacteria | 1276 |
| 126 | Ga0207705_10012826 | 3300025909 | Bacteria | 6052 |
| 127 | Ga0207684_10006591 | 3300025910 | Bacteria | 10561 |
| 128 | Ga0207684_10010423 | 3300025910 | Bacteria | 8183 |
| 129 | Ga0207684_10053364 | 3300025910 | Unclassified | 3431 |
| 130 | Ga0207684_10299771 | 3300025910 | Unclassified | 1386 |
| 131 | Ga0207707_10298458 | 3300025912 | Bacteria | 1393 |
| 132 | Ga0207707_10615366 | 3300025912 | Bacteria | 918 |
| 133 | Ga0207695_10061423 | 3300025913 | Bacteria | 3884 |
| 134 | Ga0207695_10510580 | 3300025913 | Bacteria | 1084 |
| 135 | Ga0207693_10000964 | 3300025915 | Bacteria | 25831 |
| 136 | Ga0207693_10014926 | 3300025915 | Bacteria | 6238 |
| 137 | Ga0207693_10154780 | 3300025915 | Bacteria | 1803 |
| 138 | Ga0207663_10030999 | 3300025916 | Bacteria | 3159 |
| 139 | Ga0207660_10305517 | 3300025917 | Bacteria | 1267 |
| 140 | Ga0207657_10073875 | 3300025919 | Bacteria | 2880 |
| 141 | Ga0207657_10517446 | 3300025919 | Bacteria | 934 |
| 142 | Ga0207652_10170617 | 3300025921 | Bacteria | 1952 |
| 143 | Ga0207646_10009128 | 3300025922 | Bacteria | 9840 |
| 144 | Ga0207646_10010128 | 3300025922 | Bacteria | 9239 |
| 145 | Ga0207646_10278416 | 3300025922 | Bacteria | 1512 |
| 146 | Ga0207646_10487274 | 3300025922 | Bacteria | 1111 |
| 147 | Ga0207646_10492898 | 3300025922 | Unclassified | 1104 |
| 148 | Ga0207646_10680904 | 3300025922 | Bacteria | 920 |
| 149 | Ga0207659_10408069 | 3300025926 | Bacteria | 1137 |
| 150 | Ga0207659_10428468 | 3300025926 | Bacteria | 1111 |
| 151 | Ga0207687_10312285 | 3300025927 | Bacteria | 1270 |
| 152 | Ga0207700_10008053 | 3300025928 | Bacteria | 6499 |
| 153 | Ga0207664_10005790 | 3300025929 | Bacteria | 8451 |
| 154 | Ga0207664_10024691 | 3300025929 | Bacteria | 4519 |
| 155 | Ga0207664_10160620 | 3300025929 | Bacteria | 1916 |
| 156 | Ga0207706_10032145 | 3300025933 | Bacteria | 4673 |
| 157 | Ga0207686_10440501 | 3300025934 | Bacteria | 1000 |
| 158 | Ga0207669_10027602 | 3300025937 | Bacteria | 3111 |
| 159 | Ga0207669_10155812 | 3300025937 | Bacteria | 1606 |
| 160 | Ga0207704_10311589 | 3300025938 | Bacteria | 1210 |
| 161 | Ga0207665_10013449 | 3300025939 | Bacteria | 5381 |
| 162 | Ga0207665_10086195 | 3300025939 | Unclassified | 2168 |
| 163 | Ga0207711_10361943 | 3300025941 | Bacteria | 1344 |
| 164 | Ga0207689_10228452 | 3300025942 | Bacteria | 1538 |
| 165 | Ga0207667_10567586 | 3300025949 | Unclassified | 1146 |
| 166 | Ga0207712_10039159 | 3300025961 | Bacteria | 3247 |
| 167 | Ga0207677_10091568 | 3300026023 | Bacteria | 2212 |
| 168 | Ga0207702_10046515 | 3300026078 | Bacteria | 3653 |
| 169 | Ga0207702_10066214 | 3300026078 | Bacteria | 3096 |
| 170 | Ga0207648_10081072 | 3300026089 | Unclassified | 2830 |
| 171 | Ga0207675_100005163 | 3300026118 | Bacteria | 12569 |
| 172 | Ga0207675_100762598 | 3300026118 | Bacteria | 979 |
| 173 | Ga0207683_10066865 | 3300026121 | Bacteria | 3170 |
| 174 | Ga0207698_11108841 | 3300026142 | Bacteria | 804 |
| 175 | Ga0207428_10136165 | 3300027907 | Bacteria | 1877 |
| 176 | Ga0207428_10165518 | 3300027907 | Bacteria | 1677 |
| 177 | Ga0268265_10209152 | 3300028380 | Bacteria | 1699 |
| 178 | Ga0265319_1031087 | 3300028563 | Bacteria | 1861 |
| 179 | Ga0265319_1041820 | 3300028563 | Bacteria | 1544 |
| 180 | Ga0265318_10005350 | 3300028577 | Bacteria | 6032 |
| 181 | Ga0265336_10001570 | 3300028666 | Bacteria | 10254 |
| 182 | Ga0265336_10022541 | 3300028666 | Bacteria | 2004 |
| 183 | Ga0265336_10029650 | 3300028666 | Unclassified | 1706 |
| 184 | Ga0265338_10016515 | 3300028800 | Bacteria | 8024 |
| 185 | Ga0265338_10026870 | 3300028800 | Bacteria | 5791 |
| 186 | Ga0265338_10212468 | 3300028800 | Bacteria | 1451 |
| 187 | Ga0265338_10213717 | 3300028800 | Bacteria | 1446 |
| 188 | Ga0265327_10010269 | 3300031251 | Bacteria | 6602 |
| 189 | Ga0307414_10180782 | 3300032004 | Bacteria | 1696 |
| 190 | Ga0373926_0076531 | 3300035083 | Bacteria | 1234 |
| 191 | Ga0373940_0116355 | 3300035088 | Bacteria | 825 |
| 192 | Ga0373944_0048220 | 3300035089 | Bacteria | 1336 |
| 193 | Ga0373951_0035178 | 3300035091 | Bacteria | 1192 |
| 194 | Ga0373954_0066752 | 3300035118 | Bacteria | 1704 |
| 195 | Ga0373954_0127199 | 3300035118 | Bacteria | 1239 |
| 196 | Ga0373956_0097672 | 3300035119 | Bacteria | 1360 |
| 197 | Ga0373943_0000925 | 3300035170 | Bacteria | 12925 |
| 198 | Ga0373943_0011428 | 3300035170 | Bacteria | 3995 |
| 199 | Ga0373946_0039567 | 3300035171 | Bacteria | 1925 |
| 200 | Ga0373946_0269215 | 3300035171 | Unclassified | 835 |
| 201 | Ga0373955_0082248 | 3300035172 | Bacteria | 1822 |
| 202 | Ga0373924_0058158 | 3300035410 | Unclassified | 1614 |
| 203 | Ga0373924_0088641 | 3300035410 | Bacteria | 1322 |
| 204 | Ga0373931_0037715 | 3300035691 | Bacteria | 2524 |
| 205 | Ga0373935_0014242 | 3300035692 | Bacteria | 4800 |
| 206 | Ga0373927_0070784 | 3300035695 | Bacteria | 2257 |
| 207 | Ga0373933_0321189 | 3300035724 | Bacteria | 1004 |
| 208 | Ga0373947_0002909 | 3300035725 | Bacteria | 10218 |
| 209 | Ga0373937_0003744 | 3300036401 | Bacteria | 12853 |
| 210 | Ga0373937_0078910 | 3300036401 | Bacteria | 3043 |
| 211 | Ga0373937_0184320 | 3300036401 | Bacteria | 1960 |
| 212 | Ga0373937_0451335 | 3300036401 | Bacteria | 1221 |
| 213 | Ga0373937_1042662 | 3300036401 | Bacteria | 766 |
| 214 | Ga0373925_0002949 | 3300037068 | Bacteria | 13431 |
| 215 | Ga0395899_0433849 | 3300037312 | Bacteria | 863 |
| 216 | Ga0395900_0001510 | 3300037418 | Bacteria | 27641 |
| 217 | Ga0395900_0006843 | 3300037418 | Bacteria | 11828 |
| 218 | Ga0395900_0026078 | 3300037418 | Bacteria | 5984 |
| 219 | Ga0395900_0080499 | 3300037418 | Bacteria | 3347 |
| 220 | Ga0395898_0003922 | 3300037466 | Bacteria | 16418 |
| 221 | Ga0395898_0004808 | 3300037466 | Bacteria | 14701 |
| 222 | Ga0395898_0006939 | 3300037466 | Bacteria | 12040 |
| 223 | Ga0395898_0058964 | 3300037466 | Bacteria | 3736 |
| 224 | Ga0395898_0080416 | 3300037466 | Bacteria | 3143 |
| 225 | Ga0395898_0398081 | 3300037466 | Unclassified | 1313 |
| 226 | Ga0395905_0001678 | 3300037471 | Bacteria | 26104 |
| 227 | Ga0395905_0089002 | 3300037471 | Bacteria | 2893 |
| 228 | Ga0395905_0270122 | 3300037471 | Bacteria | 1586 |
| 229 | Ga0395905_0359270 | 3300037471 | Unclassified | 1349 |
| 230 | Ga0395905_0458923 | 3300037471 | Bacteria | 1172 |
| 231 | Ga0395901_0003395 | 3300038443 | Bacteria | 16041 |
| 232 | Ga0395901_0004972 | 3300038443 | Bacteria | 13414 |
| 233 | Ga0395901_0055982 | 3300038443 | Bacteria | 4102 |
| 234 | Ga0395901_0276910 | 3300038443 | Bacteria | 1744 |
| 235 | Ga0395901_0667511 | 3300038443 | Bacteria | 1041 |
| 236 | Ga0395901_0850848 | 3300038443 | Bacteria | 897 |
| 237 | Ga0436360_0135256 | 3300039438 | Bacteria | 6477 |
| 238 | Ga0439453_0007585 | 3300041408 | Bacteria | 1726 |
| 239 | Ga0451797_0771178 | 3300041453 | Bacteria | 733 |
| 240 | Ga0439431_0036060 | 3300041997 | Bacteria | 1244 |
| 241 | Ga0439433_0003746 | 3300041999 | Bacteria | 3266 |
| 242 | Ga0439442_004946 | 3300042002 | Bacteria | 2657 |
| 243 | Ga0439445_0022687 | 3300042004 | Bacteria | 1585 |
| 244 | Ga0439448_0000320 | 3300042005 | Bacteria | 10629 |
| 245 | Ga0450900_000091 | 3300042136 | Bacteria | 4863 |
| 246 | Ga0439446_0017414 | 3300042156 | Bacteria | 2008 |
| 247 | Ga0439434_0003566 | 3300042435 | Bacteria | 4543 |
| 248 | Ga0439460_0002740 | 3300042461 | Bacteria | 4246 |
| 249 | Ga0466969_0041058 | 3300044656 | Bacteria | 2316 |
| 250 | Ga0466965_0088939 | 3300044683 | Bacteria | 1569 |
| 251 | Ga0466966_0036173 | 3300044684 | Bacteria | 3189 |
| 252 | Ga0466963_0001734 | 3300044694 | Bacteria | 11873 |
| 253 | Ga0466963_0003784 | 3300044694 | Bacteria | 8722 |
| 254 | Ga0466963_0004956 | 3300044694 | Bacteria | 7763 |
| 255 | Ga0466963_0009337 | 3300044694 | Bacteria | 5904 |
| 256 | Ga0466963_0014973 | 3300044694 | Bacteria | 4792 |
| 257 | Ga0466963_0018403 | 3300044694 | Bacteria | 4367 |
| 258 | Ga0466963_0088074 | 3300044694 | Bacteria | 2111 |
| 259 | Ga0466964_0001680 | 3300044706 | Bacteria | 7642 |
| 260 | Ga0466964_0001976 | 3300044706 | Bacteria | 7194 |
| 261 | Ga0466964_0022864 | 3300044706 | Bacteria | 2428 |
| 262 | Ga0466964_0024426 | 3300044706 | Bacteria | 2355 |
| 263 | Ga0466964_0262963 | 3300044706 | Bacteria | 855 |
| 264 | Ga0466971_0004164 | 3300044719 | Bacteria | 6233 |
| 265 | Ga0466971_0042925 | 3300044719 | Bacteria | 2032 |
| 266 | Ga0466971_0184332 | 3300044719 | Bacteria | 982 |
| 267 | Ga0466968_0001841 | 3300044735 | Bacteria | 7657 |
| 268 | Ga0466968_0048223 | 3300044735 | Bacteria | 1812 |
| 269 | Ga0466968_0063899 | 3300044735 | Bacteria | 1591 |
| 270 | Ga0466970_0261757 | 3300044765 | Bacteria | 970 |
| 271 | Ga0466957_0000839 | 3300044842 | Bacteria | 15709 |
| 272 | Ga0466957_0005089 | 3300044842 | Bacteria | 7355 |
| 273 | Ga0466957_0005602 | 3300044842 | Bacteria | 7057 |
| 274 | Ga0466957_0010143 | 3300044842 | Bacteria | 5391 |
| 275 | Ga0466957_0011876 | 3300044842 | Bacteria | 5034 |
| 276 | Ga0466957_0014602 | 3300044842 | Bacteria | 4576 |
| 277 | Ga0466957_0016238 | 3300044842 | Bacteria | 4354 |
| 278 | Ga0466957_0021347 | 3300044842 | Bacteria | 3815 |
| 279 | Ga0466957_0186591 | 3300044842 | Bacteria | 1356 |
| 280 | Ga0466957_0304985 | 3300044842 | Bacteria | 1071 |
| 281 | Ga0466960_0038468 | 3300044901 | Bacteria | 2250 |
| 282 | Ga0466959_0002503 | 3300045049 | Bacteria | 11770 |
| 283 | Ga0466959_0133999 | 3300045049 | Bacteria | 1755 |
| 284 | Ga0466958_0001766 | 3300045836 | Bacteria | 10466 |
| 285 | Ga0466958_0004935 | 3300045836 | Bacteria | 7113 |
| 286 | Ga0466958_0006747 | 3300045836 | Bacteria | 6268 |
| 287 | Ga0466958_0028945 | 3300045836 | Bacteria | 3286 |
| 288 | Ga0466958_0036350 | 3300045836 | Bacteria | 2947 |
| 289 | Ga0466958_0099554 | 3300045836 | Bacteria | 1806 |
| 290 | Ga0466958_0118946 | 3300045836 | Unclassified | 1653 |
| 291 | Ga0466958_0220295 | 3300045836 | Bacteria | 1210 |
| 292 | Ga0466967_0002062 | 3300045976 | Bacteria | 12283 |
| 293 | Ga0466967_0005328 | 3300045976 | Bacteria | 8886 |
| 294 | Ga0466967_0005346 | 3300045976 | Bacteria | 8876 |
| 295 | Ga0466967_0007439 | 3300045976 | Bacteria | 7899 |
| 296 | Ga0466967_0008127 | 3300045976 | Bacteria | 7657 |
| 297 | Ga0466967_0018105 | 3300045976 | Bacteria | 5620 |
| 298 | Ga0466967_0026573 | 3300045976 | Bacteria | 4796 |
| 299 | Ga0466967_0034363 | 3300045976 | Bacteria | 4302 |
| 300 | Ga0466967_0034548 | 3300045976 | Bacteria | 4293 |
| 301 | Ga0466967_0047556 | 3300045976 | Bacteria | 3740 |
| 302 | Ga0466967_0057450 | 3300045976 | Bacteria | 3435 |
| 303 | Ga0466967_0088241 | 3300045976 | Bacteria | 2814 |
| 304 | Ga0466967_0183720 | 3300045976 | Bacteria | 1973 |
| 305 | Ga0466967_0189422 | 3300045976 | Bacteria | 1943 |
| 306 | Ga0466967_0219569 | 3300045976 | Bacteria | 1806 |
| 307 | Ga0466967_0378450 | 3300045976 | Bacteria | 1374 |
| 308 | Ga0466967_0406344 | 3300045976 | Unclassified | 1325 |
| 309 | Ga0466967_0551557 | 3300045976 | Bacteria | 1134 |
| 310 | Ga0495592_0000716 | 3300046454 | Bacteria | 23196 |
| 311 | Ga0495592_0006583 | 3300046454 | Bacteria | 8656 |
| 312 | Ga0495592_0046840 | 3300046454 | Bacteria | 3222 |
| 313 | Ga0495592_0133518 | 3300046454 | Bacteria | 1733 |
| 314 | Ga0495603_0233814 | 3300046455 | Bacteria | 1059 |
| 315 | Ga0495629_0019911 | 3300046459 | Bacteria | 4788 |
| 316 | Ga0495629_0023550 | 3300046459 | Bacteria | 4386 |
| 317 | Ga0495641_0013879 | 3300046461 | Bacteria | 4391 |
| 318 | Ga0495641_0132352 | 3300046461 | Bacteria | 1113 |
| 319 | Ga0495651_0000001 | 3300046462 | Bacteria | 210544 |
| 320 | Ga0495651_0002853 | 3300046462 | Bacteria | 13391 |
| 321 | Ga0495651_0102021 | 3300046462 | Bacteria | 2134 |
| 322 | Ga0495651_0121844 | 3300046462 | Bacteria | 1915 |
| 323 | Ga0495651_0220658 | 3300046462 | Bacteria | 1312 |
| 324 | Ga0495651_0405217 | 3300046462 | Bacteria | 889 |
| 325 | Ga0495653_0002945 | 3300046463 | Bacteria | 13629 |
| 326 | Ga0495653_0053390 | 3300046463 | Bacteria | 3092 |
| 327 | Ga0495653_0059110 | 3300046463 | Bacteria | 2911 |
| 328 | Ga0495653_0130896 | 3300046463 | Bacteria | 1776 |
| 329 | Ga0495580_0060943 | 3300046472 | Bacteria | 2650 |
| 330 | Ga0495580_0070766 | 3300046472 | Bacteria | 2437 |
| 331 | Ga0495580_0291612 | 3300046472 | Bacteria | 1112 |
| 332 | Ga0495582_0000805 | 3300046473 | Bacteria | 17419 |
| 333 | Ga0495639_0002102 | 3300046475 | Bacteria | 8795 |
| 334 | Ga0495662_0003155 | 3300046476 | Bacteria | 8317 |
| 335 | Ga0495662_0016626 | 3300046476 | Bacteria | 3565 |
| 336 | Ga0495662_0133098 | 3300046476 | Bacteria | 1223 |
| 337 | Ga0495664_0159264 | 3300046477 | Bacteria | 1369 |
| 338 | Ga0495584_0148316 | 3300046491 | Bacteria | 1192 |
| 339 | Ga0495594_0239827 | 3300046499 | Bacteria | 1033 |
| 340 | Ga0495608_0000448 | 3300046511 | Bacteria | 28730 |
| 341 | Ga0495608_0033438 | 3300046511 | Bacteria | 3475 |
| 342 | Ga0495608_0038599 | 3300046511 | Bacteria | 3206 |
| 343 | Ga0495608_0134585 | 3300046511 | Bacteria | 1580 |
| 344 | Ga0495618_0003288 | 3300046514 | Bacteria | 10120 |
| 345 | Ga0495618_0036945 | 3300046514 | Bacteria | 3065 |
| 346 | Ga0495618_0081289 | 3300046514 | Unclassified | 2069 |
| 347 | Ga0495628_0000500 | 3300046516 | Bacteria | 35932 |
| 348 | Ga0495628_0007520 | 3300046516 | Bacteria | 9426 |
| 349 | Ga0495628_0026416 | 3300046516 | Bacteria | 4734 |
| 350 | Ga0495630_0076741 | 3300046517 | Bacteria | 2518 |
| 351 | Ga0495630_0137962 | 3300046517 | Bacteria | 1853 |
| 352 | Ga0495644_0117880 | 3300046523 | Bacteria | 1009 |
| 353 | Ga0495666_0001439 | 3300046526 | Bacteria | 11572 |
| 354 | Ga0495666_0041331 | 3300046526 | Bacteria | 2233 |
| 355 | Ga0495652_0000015 | 3300046529 | Bacteria | 222624 |
| 356 | Ga0495652_0036455 | 3300046529 | Bacteria | 4276 |
| 357 | Ga0495652_0109559 | 3300046529 | Bacteria | 2223 |
| 358 | Ga0495652_0182921 | 3300046529 | Bacteria | 1606 |
| 359 | Ga0495652_0203086 | 3300046529 | Bacteria | 1503 |
| 360 | Ga0495652_0292041 | 3300046529 | Bacteria | 1189 |
| 361 | Ga0495665_0001480 | 3300046531 | Bacteria | 12592 |
| 362 | Ga0495665_0027373 | 3300046531 | Bacteria | 3059 |
| 363 | Ga0495640_0016020 | 3300046533 | Bacteria | 5621 |
| 364 | Ga0495640_0065435 | 3300046533 | Bacteria | 2454 |
| 365 | Ga0495640_0109285 | 3300046533 | Bacteria | 1808 |
| 366 | Ga0495586_0002164 | 3300046535 | Bacteria | 10681 |
| 367 | Ga0495586_0055562 | 3300046535 | Bacteria | 2145 |
| 368 | Ga0495587_0000036 | 3300046536 | Bacteria | 117570 |
| 369 | Ga0495587_0094377 | 3300046536 | Bacteria | 1727 |
| 370 | Ga0495587_0184889 | 3300046536 | Bacteria | 1181 |
| 371 | Ga0495645_0000039 | 3300046543 | Bacteria | 94569 |
| 372 | Ga0495645_0026226 | 3300046543 | Bacteria | 4229 |
| 373 | Ga0495645_0130879 | 3300046543 | Bacteria | 1758 |
| 374 | Ga0495645_0299006 | 3300046543 | Bacteria | 1052 |
| 375 | Ga0495667_0030520 | 3300046559 | Bacteria | 3621 |
| 376 | Ga0495667_0140996 | 3300046559 | Bacteria | 1553 |
| 377 | Ga0495667_0269835 | 3300046559 | Bacteria | 1081 |
| 378 | Ga0495656_0044998 | 3300046615 | Bacteria | 1861 |
| 379 | Ga0495656_0057597 | 3300046615 | Bacteria | 1683 |
| 380 | Ga0495656_0239729 | 3300046615 | Bacteria | 913 |
| 381 | Ga0495634_0005773 | 3300046642 | Bacteria | 9452 |
| 382 | Ga0495634_0015248 | 3300046642 | Bacteria | 5526 |
| 383 | Ga0495634_0277853 | 3300046642 | Bacteria | 1018 |
| 384 | Ga0495611_0157099 | 3300046648 | Bacteria | 1062 |
| 385 | Ga0495611_0183640 | 3300046648 | Bacteria | 977 |
| 386 | Ga0495635_0062502 | 3300046663 | Bacteria | 2557 |
| 387 | Ga0495659_0060222 | 3300046664 | Bacteria | 1400 |
| 388 | Ga0495588_0027199 | 3300046674 | Bacteria | 2858 |
| 389 | Ga0495657_0028255 | 3300046675 | Bacteria | 3948 |
| 390 | Ga0495657_0057531 | 3300046675 | Bacteria | 2585 |
| 391 | Ga0495657_0325385 | 3300046675 | Unclassified | 913 |
| 392 | Ga0495599_0000055 | 3300046678 | Bacteria | 79065 |
| 393 | Ga0495599_0000409 | 3300046678 | Bacteria | 24585 |
| 394 | Ga0495599_0163509 | 3300046678 | Bacteria | 1375 |
| 395 | Ga0495623_0000445 | 3300046679 | Bacteria | 27187 |
| 396 | Ga0495623_0181194 | 3300046679 | Bacteria | 1224 |
| 397 | Ga0495646_0031152 | 3300046680 | Bacteria | 3326 |
| 398 | Ga0495647_0001179 | 3300046681 | Bacteria | 8036 |
| 399 | Ga0495658_0004116 | 3300046683 | Bacteria | 7163 |
| 400 | Ga0495613_0034278 | 3300046689 | Bacteria | 3770 |
| 401 | Ga0495613_0143402 | 3300046689 | Bacteria | 1705 |
| 402 | Ga0495613_0204555 | 3300046689 | Unclassified | 1391 |
| 403 | Ga0495624_0043442 | 3300046690 | Bacteria | 2867 |
| 404 | Ga0495589_0149701 | 3300046794 | Bacteria | 1115 |
| 405 | Ga0495589_0202357 | 3300046794 | Bacteria | 937 |
| 406 | Ga0495600_0024976 | 3300046809 | Bacteria | 3848 |
| 407 | Ga0495600_0032611 | 3300046809 | Bacteria | 3381 |
| 408 | Ga0495600_0090653 | 3300046809 | Bacteria | 1994 |
| 409 | Ga0495600_0198933 | 3300046809 | Bacteria | 1287 |
| 410 | Ga0495600_0212976 | 3300046809 | Bacteria | 1238 |
| 411 | Ga0495581_0013174 | 3300047315 | Bacteria | 4794 |
| 412 | Ga0495581_0016709 | 3300047315 | Bacteria | 4265 |
| 413 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 414 | Ga0495604_0099616 | 3300047317 | Bacteria | 2138 |
| 415 | Ga0495604_0169862 | 3300047317 | Bacteria | 1535 |
| 416 | Ga0495604_0295555 | 3300047317 | Bacteria | 1089 |
| 417 | Ga0495604_0344348 | 3300047317 | Bacteria | 992 |
| 418 | Ga0495674_0042802 | 3300047319 | Bacteria | 4036 |
| 419 | Ga0495674_0224375 | 3300047319 | Bacteria | 1552 |
| 420 | Ga0495676_0004734 | 3300047321 | Bacteria | 12459 |
| 421 | Ga0495676_0036226 | 3300047321 | Bacteria | 4122 |
| 422 | Ga0495676_0307846 | 3300047321 | Bacteria | 1067 |
| 423 | Ga0495680_0013749 | 3300047322 | Bacteria | 7044 |
| 424 | Ga0495680_0048360 | 3300047322 | Bacteria | 3340 |
| 425 | Ga0495680_0093782 | 3300047322 | Bacteria | 2247 |
| 426 | Ga0495680_0197762 | 3300047322 | Bacteria | 1443 |
| 427 | Ga0495675_0000250 | 3300047444 | Bacteria | 38818 |
| 428 | Ga0495675_0313430 | 3300047444 | Bacteria | 929 |
| 429 | Ga0495675_0353073 | 3300047444 | Bacteria | 864 |
| 430 | Ga0495684_0017002 | 3300047471 | Bacteria | 5604 |
| 431 | Ga0495684_0020148 | 3300047471 | Bacteria | 5136 |
| 432 | Ga0495684_0020962 | 3300047471 | Bacteria | 5034 |
| 433 | Ga0495684_0097766 | 3300047471 | Bacteria | 2220 |
| 434 | Ga0495684_0103387 | 3300047471 | Bacteria | 2153 |
| 435 | Ga0495684_0219032 | 3300047471 | Unclassified | 1396 |
| 436 | Ga0495684_0249750 | 3300047471 | Bacteria | 1291 |
| 437 | Ga0495593_0002267 | 3300047673 | Bacteria | 11530 |
| 438 | Ga0495593_0041653 | 3300047673 | Bacteria | 2468 |
| 439 | Ga0495602_0000235 | 3300048088 | Bacteria | 51786 |
| 440 | Ga0495602_0007762 | 3300048088 | Bacteria | 11216 |
| 441 | Ga0495602_0171549 | 3300048088 | Bacteria | 1683 |
| 442 | Ga0495602_0239467 | 3300048088 | Bacteria | 1358 |
| 443 | Ga0495602_0248059 | 3300048088 | Bacteria | 1328 |
| 444 | Ga0495614_0000112 | 3300048089 | Bacteria | 27892 |
| 445 | Ga0496100_0012368 | 3300048903 | Bacteria | 4890 |
| 446 | Ga0496100_0057261 | 3300048903 | Bacteria | 2552 |
| 447 | Ga0496100_0229156 | 3300048903 | Bacteria | 1366 |
| 448 | Ga0496100_0351579 | 3300048903 | Bacteria | 1113 |
| 449 | Ga0496101_0009414 | 3300048904 | Bacteria | 6420 |
| 450 | Ga0496101_0053189 | 3300048904 | Bacteria | 2920 |
| 451 | Ga0496101_0149360 | 3300048904 | Unclassified | 1786 |
| 452 | Ga0496101_0174367 | 3300048904 | Bacteria | 1653 |
| 453 | Ga0496102_0032716 | 3300048905 | Bacteria | 4673 |
| 454 | Ga0496102_0049063 | 3300048905 | Bacteria | 3839 |
| 455 | Ga0496102_0152466 | 3300048905 | Bacteria | 2172 |
| 456 | Ga0496102_0988074 | 3300048905 | Bacteria | 762 |
| 457 | Ga0496103_0066378 | 3300048906 | Bacteria | 2252 |
| 458 | Ga0496103_0156432 | 3300048906 | Unclassified | 1461 |
| 459 | Ga0496104_0029020 | 3300048907 | Bacteria | 5129 |
| 460 | Ga0496104_0156978 | 3300048907 | Bacteria | 2183 |
| 461 | Ga0496104_0230292 | 3300048907 | Bacteria | 1765 |
| 462 | Ga0496104_0497929 | 3300048907 | Bacteria | 1129 |
| 463 | Ga0496105_0017975 | 3300048908 | Bacteria | 5674 |
| 464 | Ga0496105_0043165 | 3300048908 | Bacteria | 3718 |
| 465 | Ga0496105_0057053 | 3300048908 | Bacteria | 3224 |
| 466 | Ga0496105_0251061 | 3300048908 | Bacteria | 1433 |
| 467 | Ga0496105_0422377 | 3300048908 | Bacteria | 1055 |
| 468 | Ga0496106_0008840 | 3300048909 | Bacteria | 7444 |
| 469 | Ga0496106_0030374 | 3300048909 | Bacteria | 4030 |
| 470 | Ga0496106_0031770 | 3300048909 | Bacteria | 3934 |
| 471 | Ga0496107_0009407 | 3300048910 | Bacteria | 6780 |
| 472 | Ga0496107_0059855 | 3300048910 | Bacteria | 2756 |
| 473 | Ga0496108_0008091 | 3300048911 | Bacteria | 8529 |
| 474 | Ga0496108_0023961 | 3300048911 | Bacteria | 5024 |
| 475 | Ga0496108_0031623 | 3300048911 | Bacteria | 4392 |
| 476 | Ga0496108_0034350 | 3300048911 | Bacteria | 4213 |
| 477 | Ga0496108_0084150 | 3300048911 | Bacteria | 2699 |
| 478 | Ga0496108_0198694 | 3300048911 | Bacteria | 1740 |
| 479 | Ga0496109_0006728 | 3300048912 | Bacteria | 9680 |
| 480 | Ga0496109_0053696 | 3300048912 | Bacteria | 3675 |
| 481 | Ga0496109_0107411 | 3300048912 | Bacteria | 2592 |
| 482 | Ga0496109_0375630 | 3300048912 | Bacteria | 1343 |
| 483 | Ga0496109_0397239 | 3300048912 | Bacteria | 1302 |
| 484 | Ga0496110_0038024 | 3300048913 | Bacteria | 4185 |
| 485 | Ga0496110_0097343 | 3300048913 | Bacteria | 2636 |
| 486 | Ga0496110_0959914 | 3300048913 | Bacteria | 762 |
| 487 | Ga0496111_0002503 | 3300048914 | Bacteria | 11081 |
| 488 | Ga0496111_0021414 | 3300048914 | Bacteria | 4514 |
| 489 | Ga0496111_0072549 | 3300048914 | Bacteria | 2506 |
| 490 | Ga0496111_0355289 | 3300048914 | Bacteria | 1085 |
| 491 | Ga0496112_0003774 | 3300048915 | Bacteria | 12646 |
| 492 | Ga0496112_0190526 | 3300048915 | Bacteria | 2013 |
| 493 | Ga0496112_0472137 | 3300048915 | Bacteria | 1191 |
| 494 | Ga0496113_0006507 | 3300048916 | Bacteria | 7415 |
| 495 | Ga0496113_0040740 | 3300048916 | Bacteria | 3424 |
| 496 | Ga0496114_0023811 | 3300048917 | Bacteria | 4997 |
| 497 | Ga0496114_0068218 | 3300048917 | Bacteria | 2985 |
| 498 | Ga0496114_0091189 | 3300048917 | Bacteria | 2588 |
| 499 | Ga0496114_0163235 | 3300048917 | Unclassified | 1938 |
| 500 | Ga0496114_0238248 | 3300048917 | Unclassified | 1599 |
| 501 | Ga0496114_0276690 | 3300048917 | Unclassified | 1479 |
| 502 | Ga0496114_0530916 | 3300048917 | Bacteria | 1040 |
| 503 | Ga0496115_0001171 | 3300048918 | Bacteria | 18799 |
| 504 | Ga0496115_0088491 | 3300048918 | Bacteria | 2528 |
| 505 | Ga0496115_0096138 | 3300048918 | Bacteria | 2425 |
| 506 | Ga0496115_0121200 | 3300048918 | Bacteria | 2152 |
| 507 | Ga0496115_0299613 | 3300048918 | Bacteria | 1317 |
| 508 | Ga0496115_0588795 | 3300048918 | Bacteria | 885 |
| 509 | Ga0496115_0665444 | 3300048918 | Bacteria | 822 |
| 510 | Ga0501034_0004154 | 3300049571 | Bacteria | 16214 |
| 511 | Ga0501042_0014784 | 3300049578 | Bacteria | 5330 |
| 512 | Ga0501043_0165008 | 3300049579 | Bacteria | 1730 |
| 513 | Ga0501046_0442826 | 3300049580 | Bacteria | 935 |
| 514 | Ga0501047_0099637 | 3300049581 | Bacteria | 2785 |
| 515 | Ga0501068_0384778 | 3300049584 | Bacteria | 904 |
| 516 | Ga0501069_0130613 | 3300049585 | Bacteria | 1438 |
| 517 | Ga0501072_0015504 | 3300049588 | Bacteria | 5841 |
| 518 | Ga0501074_0010895 | 3300049590 | Bacteria | 6600 |
| 519 | Ga0501074_0029258 | 3300049590 | Bacteria | 3990 |
| 520 | Ga0501079_0369025 | 3300049741 | Bacteria | 1125 |
| 521 | Ga0501080_0002096 | 3300049742 | Bacteria | 17315 |
| 522 | Ga0501081_0222002 | 3300049743 | Unclassified | 1374 |
| 523 | Ga0501081_0662213 | 3300049743 | Bacteria | 783 |
| 524 | Ga0501083_0009464 | 3300049744 | Bacteria | 6883 |
| 525 | nmdc:mga05p37_234556_c1 | 3300050507 | Bacteria | 2209 |
| 526 | nmdc:mga05p37_368750_c1 | 3300050507 | Bacteria | 1686 |
| 527 | nmdc:mga05p37_516388_c1 | 3300050507 | Bacteria | 1367 |
| 528 | nmdc:mga09592_513159_c1 | 3300050508 | Unclassified | 1031 |
| 529 | nmdc:mga08y16_803005_c1 | 3300050511 | Bacteria | 934 |
| 530 | nmdc:mga0n895_19432_c1 | 3300050512 | Bacteria | 6316 |
| 531 | nmdc:mga0n895_20742_c1 | 3300050512 | Bacteria | 6135 |
| 532 | nmdc:mga0n895_468911_c1 | 3300050512 | Bacteria | 1270 |
| 533 | nmdc:mga0n895_5602_c1 | 3300050512 | Bacteria | 10514 |
| 534 | nmdc:mga0rr50_124002_c1 | 3300050513 | Bacteria | 2060 |
| 535 | nmdc:mga0rr50_20108_c1 | 3300050513 | Bacteria | 4524 |
| 536 | nmdc:mga0rr50_52507_c1 | 3300050513 | Bacteria | 3030 |
| 537 | nmdc:mga08x19_163031_c1 | 3300050514 | Bacteria | 1515 |
| 538 | nmdc:mga08x19_87079_c1 | 3300050514 | Bacteria | 2057 |
| 539 | Ga0495601_0000553 | 3300053077 | Bacteria | 19807 |
| 540 | Ga0495601_0010794 | 3300053077 | Bacteria | 5451 |
| 541 | Ga0495612_0002155 | 3300053078 | Bacteria | 8097 |
| 542 | Ga0495612_0019744 | 3300053078 | Bacteria | 2700 |
| 543 | Ga0495612_0031034 | 3300053078 | Bacteria | 2154 |
| 544 | Ga0495612_0034904 | 3300053078 | Bacteria | 2037 |
| 545 | Ga0495655_0069730 | 3300053083 | Bacteria | 980 |
| 546 | Ga0495595_0005478 | 3300053084 | Bacteria | 5141 |
| 547 | Ga0495595_0014414 | 3300053084 | Bacteria | 3354 |
| 548 | Ga0495595_0020515 | 3300053084 | Bacteria | 2877 |
| 549 | Ga0495595_0039072 | 3300053084 | Bacteria | 2164 |
| 550 | Ga0495595_0076530 | 3300053084 | Bacteria | 1588 |
| 551 | Ga0495619_0007907 | 3300053085 | Bacteria | 6727 |
| 552 | Ga0495619_0085936 | 3300053085 | Bacteria | 2125 |
| 553 | Ga0495619_0089025 | 3300053085 | Bacteria | 2088 |
| 554 | Ga0495619_0129982 | 3300053085 | Unclassified | 1730 |
| 555 | Ga0495619_0141482 | 3300053085 | Bacteria | 1657 |
| 556 | Ga0495619_0145665 | 3300053085 | Bacteria | 1633 |
| 557 | Ga0495619_0267577 | 3300053085 | Bacteria | 1184 |
| 558 | Ga0500566_0295248 | 3300053094 | Bacteria | 765 |
| 559 | Ga0500657_088586 | 3300053728 | Bacteria | 1310 |
| 560 | Ga0501082_0098702 | 3300060353 | Bacteria | 2525 |
| 561 | Ga0466962_0002540 | 3300061719 | Bacteria | 8660 |
| 562 | Ga0530510_0015321 | 3300061734 | Bacteria | 5416 |
| 563 | Ga0197907_10896267 | |||
| 564 | Ga0070658_10280594 | |||
| 565 | Ga0070683_100196505 | |||
| 566 | Ga0070680_100047923 | |||
| 567 | Ga0070680_100339421 | |||
| 568 | Ga0070660_100684499 | |||
| 569 | Ga0070668_100281307 | |||
| 570 | Ga0070675_100156643 | |||
| 571 | Ga0070671_100020561 | |||
| 572 | Ga0070671_100202953 | |||
| 573 | Ga0070671_100511910 | |||
| 574 | Ga0070674_100015813 | |||
| 575 | Ga0070714_100106907 | |||
| 576 | Ga0070714_100172277 | |||
| 577 | Ga0070713_100311538 | |||
| 578 | Ga0070710_10007726 | |||
| 579 | Ga0070711_100031534 | |||
| 580 | Ga0070678_100133436 | |||
| 581 | Ga0070681_10026566 | |||
| 582 | Ga0068867_100088176 | |||
| 583 | Ga0070706_100091840 | |||
| 584 | Ga0070706_100100555 | |||
| 585 | Ga0070706_100298694 | |||
| 586 | Ga0070706_100311054 | |||
| 587 | Ga0070707_100000459 | |||
| 588 | Ga0070707_100007106 | |||
| 589 | Ga0070707_100043066 | |||
| 590 | Ga0070707_100064532 | |||
| 591 | Ga0070707_100113299 | |||
| 592 | Ga0070707_100259614 | |||
| 593 | Ga0070698_100001624 | |||
| 594 | Ga0070698_100062718 | |||
| 595 | Ga0070698_100771835 | |||
| 596 | Ga0070699_100190872 | |||
| 597 | Ga0070699_100732652 | |||
| 598 | Ga0070679_100103420 | |||
| 599 | Ga0070679_100151473 | |||
| 600 | Ga0070684_100074215 | |||
| 601 | Ga0070684_100213157 | |||
| 602 | Ga0070686_100057693 | |||
| 603 | Ga0070686_100098803 | |||
| 604 | Ga0070704_100341599 | |||
| 605 | Ga0070664_100093886 | |||
| 606 | Ga0068857_100173306 | |||
| 607 | Ga0068856_100324272 | |||
| 608 | Ga0068856_100415955 | |||
| 609 | Ga0070702_100203703 | |||
| 610 | Ga0068852_100249226 | |||
| 611 | Ga0068852_100332805 | |||
| 612 | Ga0068866_10193579 | |||
| 613 | Ga0068870_10050347 | |||
| 614 | Ga0068863_100224208 | |||
| 615 | Ga0070717_10026487 | |||
| 616 | Ga0070717_10028548 | |||
| 617 | Ga0070717_10032677 | |||
| 618 | Ga0070717_10036084 | |||
| 619 | Ga0070715_10052072 | |||
| 620 | Ga0070716_100346066 | |||
| 621 | Ga0070712_100013729 | |||
| 622 | Ga0070712_100637078 | |||
| 623 | Ga0068871_100089156 | |||
| 624 | Ga0068871_100212098 | |||
| 625 | Ga0075431_100012316 | |||
| 626 | Ga0075433_10004670 | |||
| 627 | Ga0075434_100001312 | |||
| 628 | Ga0068865_100029581 | |||
| 629 | Ga0068865_100104916 | |||
| 630 | Ga0075436_100055958 | |||
| 631 | Ga0075435_100133816 | |||
| 632 | Ga0105250_10109416 | |||
| 633 | Ga0105240_10237564 | |||
| 634 | Ga0105240_10423414 | |||
| 635 | Ga0105240_10636887 | |||
| 636 | Ga0105240_10753539 | |||
| 637 | Ga0105240_10898312 | |||
| 638 | Ga0111539_11296795 | |||
| 639 | Ga0105245_10085151 | |||
| 640 | Ga0105245_10185989 | |||
| 641 | Ga0105245_10194644 | |||
| 642 | Ga0105245_10212951 | |||
| 643 | Ga0105247_10110958 | |||
| 644 | Ga0114129_10021487 | |||
| 645 | Ga0105243_10050032 | |||
| 646 | Ga0105242_10055936 | |||
| 647 | Ga0105242_10118033 | |||
| 648 | Ga0105242_10132871 | |||
| 649 | Ga0105242_10175069 | |||
| 650 | Ga0105248_10671645 | |||
| 651 | Ga0105237_10139610 | |||
| 652 | Ga0105238_10002351 | |||
| 653 | Ga0105249_10116372 | |||
| 654 | Ga0105249_10421723 | |||
| 655 | Ga0105249_10647489 | |||
| 656 | Ga0105239_10204410 | |||
| 657 | Ga0105239_10733806 | |||
| 658 | Ga0105246_10019323 | |||
| 659 | Ga0157373_10468587 | |||
| 660 | Ga0157370_10471103 | |||
| 661 | Ga0157369_10229946 | |||
| 662 | Ga0157374_10011139 | |||
| 663 | Ga0157374_10030374 | |||
| 664 | Ga0157378_10272924 | |||
| 665 | Ga0157378_10482070 | |||
| 666 | Ga0163162_10063209 | |||
| 667 | Ga0163162_10150799 | |||
| 668 | Ga0163162_10248097 | |||
| 669 | Ga0157372_10357775 | |||
| 670 | Ga0157375_10760938 | |||
| 671 | Ga0163163_10101520 | |||
| 672 | Ga0157380_10053568 | |||
| 673 | Ga0157380_10139872 | |||
| 674 | Ga0157377_10025073 | |||
| 675 | Ga0157376_10072300 | |||
| 676 | Ga0157376_10073327 | |||
| 677 | Ga0157376_10681308 | |||
| 678 | Ga0163161_10060869 | |||
| 679 | Ga0163161_10398243 | |||
| 680 | Ga0206356_10776365 | |||
| 681 | Ga0206353_10017238 | |||
| 682 | Ga0206353_11127049 | |||
| 683 | Ga0224712_10048454 | |||
| 684 | Ga0207688_10020358 | |||
| 685 | Ga0207688_10111628 | |||
| 686 | Ga0207699_10069640 | |||
| 687 | Ga0207643_10180683 | |||
| 688 | Ga0207705_10012826 | |||
| 689 | Ga0207684_10006591 | |||
| 690 | Ga0207684_10010423 | |||
| 691 | Ga0207684_10053364 | |||
| 692 | Ga0207684_10299771 | |||
| 693 | Ga0207707_10298458 | |||
| 694 | Ga0207707_10615366 | |||
| 695 | Ga0207695_10061423 | |||
| 696 | Ga0207695_10510580 | |||
| 697 | Ga0207693_10000964 | |||
| 698 | Ga0207693_10014926 | |||
| 699 | Ga0207693_10154780 | |||
| 700 | Ga0207663_10030999 | |||
| 701 | Ga0207660_10305517 | |||
| 702 | Ga0207657_10073875 | |||
| 703 | Ga0207657_10517446 | |||
| 704 | Ga0207652_10170617 | |||
| 705 | Ga0207646_10009128 | |||
| 706 | Ga0207646_10010128 | |||
| 707 | Ga0207646_10278416 | |||
| 708 | Ga0207646_10487274 | |||
| 709 | Ga0207646_10492898 | |||
| 710 | Ga0207646_10680904 | |||
| 711 | Ga0207659_10408069 | |||
| 712 | Ga0207659_10428468 | |||
| 713 | Ga0207687_10312285 | |||
| 714 | Ga0207700_10008053 | |||
| 715 | Ga0207664_10005790 | |||
| 716 | Ga0207664_10024691 | |||
| 717 | Ga0207664_10160620 | |||
| 718 | Ga0207706_10032145 | |||
| 719 | Ga0207686_10440501 | |||
| 720 | Ga0207669_10027602 | |||
| 721 | Ga0207669_10155812 | |||
| 722 | Ga0207704_10311589 | |||
| 723 | Ga0207665_10013449 | |||
| 724 | Ga0207665_10086195 | |||
| 725 | Ga0207711_10361943 | |||
| 726 | Ga0207689_10228452 | |||
| 727 | Ga0207667_10567586 | |||
| 728 | Ga0207712_10039159 | |||
| 729 | Ga0207677_10091568 | |||
| 730 | Ga0207702_10046515 | |||
| 731 | Ga0207702_10066214 | |||
| 732 | Ga0207648_10081072 | |||
| 733 | Ga0207675_100005163 | |||
| 734 | Ga0207675_100762598 | |||
| 735 | Ga0207683_10066865 | |||
| 736 | Ga0207698_11108841 | |||
| 737 | Ga0207428_10136165 | |||
| 738 | Ga0207428_10165518 | |||
| 739 | Ga0268265_10209152 | |||
| 740 | Ga0265319_1031087 | |||
| 741 | Ga0265319_1041820 | |||
| 742 | Ga0265318_10005350 | |||
| 743 | Ga0265336_10001570 | |||
| 744 | Ga0265336_10022541 | |||
| 745 | Ga0265336_10029650 | |||
| 746 | Ga0265338_10016515 | |||
| 747 | Ga0265338_10026870 | |||
| 748 | Ga0265338_10212468 | |||
| 749 | Ga0265338_10213717 | |||
| 750 | Ga0265327_10010269 | |||
| 751 | Ga0307414_10180782 | |||
| 752 | Ga0373926_0076531 | |||
| 753 | Ga0373940_0116355 | |||
| 754 | Ga0373944_0048220 | |||
| 755 | Ga0373951_0035178 | |||
| 756 | Ga0373954_0066752 | |||
| 757 | Ga0373954_0127199 | |||
| 758 | Ga0373956_0097672 | |||
| 759 | Ga0373943_0000925 | |||
| 760 | Ga0373943_0011428 | |||
| 761 | Ga0373946_0039567 | |||
| 762 | Ga0373946_0269215 | |||
| 763 | Ga0373955_0082248 | |||
| 764 | Ga0373924_0058158 | |||
| 765 | Ga0373924_0088641 | |||
| 766 | Ga0373931_0037715 | |||
| 767 | Ga0373935_0014242 | |||
| 768 | Ga0373927_0070784 | |||
| 769 | Ga0373933_0321189 | |||
| 770 | Ga0373947_0002909 | |||
| 771 | Ga0373937_0003744 | |||
| 772 | Ga0373937_0078910 | |||
| 773 | Ga0373937_0184320 | |||
| 774 | Ga0373937_0451335 | |||
| 775 | Ga0373937_1042662 | |||
| 776 | Ga0373925_0002949 | |||
| 777 | Ga0395899_0433849 | |||
| 778 | Ga0395900_0001510 | |||
| 779 | Ga0395900_0006843 | |||
| 780 | Ga0395900_0026078 | |||
| 781 | Ga0395900_0080499 | |||
| 782 | Ga0395898_0003922 | |||
| 783 | Ga0395898_0004808 | |||
| 784 | Ga0395898_0006939 | |||
| 785 | Ga0395898_0058964 | |||
| 786 | Ga0395898_0080416 | |||
| 787 | Ga0395898_0398081 | |||
| 788 | Ga0395905_0001678 | |||
| 789 | Ga0395905_0089002 | |||
| 790 | Ga0395905_0270122 | |||
| 791 | Ga0395905_0359270 | |||
| 792 | Ga0395905_0458923 | |||
| 793 | Ga0395901_0003395 | |||
| 794 | Ga0395901_0004972 | |||
| 795 | Ga0395901_0055982 | |||
| 796 | Ga0395901_0276910 | |||
| 797 | Ga0395901_0667511 | |||
| 798 | Ga0395901_0850848 | |||
| 799 | Ga0436360_0135256 | |||
| 800 | Ga0439453_0007585 | |||
| 801 | Ga0451797_0771178 | |||
| 802 | Ga0439431_0036060 | |||
| 803 | Ga0439433_0003746 | |||
| 804 | Ga0439442_004946 | |||
| 805 | Ga0439445_0022687 | |||
| 806 | Ga0439448_0000320 | |||
| 807 | Ga0450900_000091 | |||
| 808 | Ga0439446_0017414 | |||
| 809 | Ga0439434_0003566 | |||
| 810 | Ga0439460_0002740 | |||
| 811 | Ga0466969_0041058 | |||
| 812 | Ga0466965_0088939 | |||
| 813 | Ga0466966_0036173 | |||
| 814 | Ga0466963_0001734 | |||
| 815 | Ga0466963_0003784 | |||
| 816 | Ga0466963_0004956 | |||
| 817 | Ga0466963_0009337 | |||
| 818 | Ga0466963_0014973 | |||
| 819 | Ga0466963_0018403 | |||
| 820 | Ga0466963_0088074 | |||
| 821 | Ga0466964_0001680 | |||
| 822 | Ga0466964_0001976 | |||
| 823 | Ga0466964_0022864 | |||
| 824 | Ga0466964_0024426 | |||
| 825 | Ga0466964_0262963 | |||
| 826 | Ga0466971_0004164 | |||
| 827 | Ga0466971_0042925 | |||
| 828 | Ga0466971_0184332 | |||
| 829 | Ga0466968_0001841 | |||
| 830 | Ga0466968_0048223 | |||
| 831 | Ga0466968_0063899 | |||
| 832 | Ga0466970_0261757 | |||
| 833 | Ga0466957_0000839 | |||
| 834 | Ga0466957_0005089 | |||
| 835 | Ga0466957_0005602 | |||
| 836 | Ga0466957_0010143 | |||
| 837 | Ga0466957_0011876 | |||
| 838 | Ga0466957_0014602 | |||
| 839 | Ga0466957_0016238 | |||
| 840 | Ga0466957_0021347 | |||
| 841 | Ga0466957_0186591 | |||
| 842 | Ga0466957_0304985 | |||
| 843 | Ga0466960_0038468 | |||
| 844 | Ga0466959_0002503 | |||
| 845 | Ga0466959_0133999 | |||
| 846 | Ga0466958_0001766 | |||
| 847 | Ga0466958_0004935 | |||
| 848 | Ga0466958_0006747 | |||
| 849 | Ga0466958_0028945 | |||
| 850 | Ga0466958_0036350 | |||
| 851 | Ga0466958_0099554 | |||
| 852 | Ga0466958_0118946 | |||
| 853 | Ga0466958_0220295 | |||
| 854 | Ga0466967_0002062 | |||
| 855 | Ga0466967_0005328 | |||
| 856 | Ga0466967_0005346 | |||
| 857 | Ga0466967_0007439 | |||
| 858 | Ga0466967_0008127 | |||
| 859 | Ga0466967_0018105 | |||
| 860 | Ga0466967_0026573 | |||
| 861 | Ga0466967_0034363 | |||
| 862 | Ga0466967_0034548 | |||
| 863 | Ga0466967_0047556 | |||
| 864 | Ga0466967_0057450 | |||
| 865 | Ga0466967_0088241 | |||
| 866 | Ga0466967_0183720 | |||
| 867 | Ga0466967_0189422 | |||
| 868 | Ga0466967_0219569 | |||
| 869 | Ga0466967_0378450 | |||
| 870 | Ga0466967_0406344 | |||
| 871 | Ga0466967_0551557 | |||
| 872 | Ga0495592_0000716 | |||
| 873 | Ga0495592_0006583 | |||
| 874 | Ga0495592_0046840 | |||
| 875 | Ga0495592_0133518 | |||
| 876 | Ga0495603_0233814 | |||
| 877 | Ga0495629_0019911 | |||
| 878 | Ga0495629_0023550 | |||
| 879 | Ga0495641_0013879 | |||
| 880 | Ga0495641_0132352 | |||
| 881 | Ga0495651_0000001 | |||
| 882 | Ga0495651_0002853 | |||
| 883 | Ga0495651_0102021 | |||
| 884 | Ga0495651_0121844 | |||
| 885 | Ga0495651_0220658 | |||
| 886 | Ga0495651_0405217 | |||
| 887 | Ga0495653_0002945 | |||
| 888 | Ga0495653_0053390 | |||
| 889 | Ga0495653_0059110 | |||
| 890 | Ga0495653_0130896 | |||
| 891 | Ga0495580_0060943 | |||
| 892 | Ga0495580_0070766 | |||
| 893 | Ga0495580_0291612 | |||
| 894 | Ga0495582_0000805 | |||
| 895 | Ga0495639_0002102 | |||
| 896 | Ga0495662_0003155 | |||
| 897 | Ga0495662_0016626 | |||
| 898 | Ga0495662_0133098 | |||
| 899 | Ga0495664_0159264 | |||
| 900 | Ga0495584_0148316 | |||
| 901 | Ga0495594_0239827 | |||
| 902 | Ga0495608_0000448 | |||
| 903 | Ga0495608_0033438 | |||
| 904 | Ga0495608_0038599 | |||
| 905 | Ga0495608_0134585 | |||
| 906 | Ga0495618_0003288 | |||
| 907 | Ga0495618_0036945 | |||
| 908 | Ga0495618_0081289 | |||
| 909 | Ga0495628_0000500 | |||
| 910 | Ga0495628_0007520 | |||
| 911 | Ga0495628_0026416 | |||
| 912 | Ga0495630_0076741 | |||
| 913 | Ga0495630_0137962 | |||
| 914 | Ga0495644_0117880 | |||
| 915 | Ga0495666_0001439 | |||
| 916 | Ga0495666_0041331 | |||
| 917 | Ga0495652_0000015 | |||
| 918 | Ga0495652_0036455 | |||
| 919 | Ga0495652_0109559 | |||
| 920 | Ga0495652_0182921 | |||
| 921 | Ga0495652_0203086 | |||
| 922 | Ga0495652_0292041 | |||
| 923 | Ga0495665_0001480 | |||
| 924 | Ga0495665_0027373 | |||
| 925 | Ga0495640_0016020 | |||
| 926 | Ga0495640_0065435 | |||
| 927 | Ga0495640_0109285 | |||
| 928 | Ga0495586_0002164 | |||
| 929 | Ga0495586_0055562 | |||
| 930 | Ga0495587_0000036 | |||
| 931 | Ga0495587_0094377 | |||
| 932 | Ga0495587_0184889 | |||
| 933 | Ga0495645_0000039 | |||
| 934 | Ga0495645_0026226 | |||
| 935 | Ga0495645_0130879 | |||
| 936 | Ga0495645_0299006 | |||
| 937 | Ga0495667_0030520 | |||
| 938 | Ga0495667_0140996 | |||
| 939 | Ga0495667_0269835 | |||
| 940 | Ga0495656_0044998 | |||
| 941 | Ga0495656_0057597 | |||
| 942 | Ga0495656_0239729 | |||
| 943 | Ga0495634_0005773 | |||
| 944 | Ga0495634_0015248 | |||
| 945 | Ga0495634_0277853 | |||
| 946 | Ga0495611_0157099 | |||
| 947 | Ga0495611_0183640 | |||
| 948 | Ga0495635_0062502 | |||
| 949 | Ga0495659_0060222 | |||
| 950 | Ga0495588_0027199 | |||
| 951 | Ga0495657_0028255 | |||
| 952 | Ga0495657_0057531 | |||
| 953 | Ga0495657_0325385 | |||
| 954 | Ga0495599_0000055 | |||
| 955 | Ga0495599_0000409 | |||
| 956 | Ga0495599_0163509 | |||
| 957 | Ga0495623_0000445 | |||
| 958 | Ga0495623_0181194 | |||
| 959 | Ga0495646_0031152 | |||
| 960 | Ga0495647_0001179 | |||
| 961 | Ga0495658_0004116 | |||
| 962 | Ga0495613_0034278 | |||
| 963 | Ga0495613_0143402 | |||
| 964 | Ga0495613_0204555 | |||
| 965 | Ga0495624_0043442 | |||
| 966 | Ga0495589_0149701 | |||
| 967 | Ga0495589_0202357 | |||
| 968 | Ga0495600_0024976 | |||
| 969 | Ga0495600_0032611 | |||
| 970 | Ga0495600_0090653 | |||
| 971 | Ga0495600_0198933 | |||
| 972 | Ga0495600_0212976 | |||
| 973 | Ga0495581_0013174 | |||
| 974 | Ga0495581_0016709 | |||
| 975 | Ga0495604_0000004 | |||
| 976 | Ga0495604_0099616 | |||
| 977 | Ga0495604_0169862 | |||
| 978 | Ga0495604_0295555 | |||
| 979 | Ga0495604_0344348 | |||
| 980 | Ga0495674_0042802 | |||
| 981 | Ga0495674_0224375 | |||
| 982 | Ga0495676_0004734 | |||
| 983 | Ga0495676_0036226 | |||
| 984 | Ga0495676_0307846 | |||
| 985 | Ga0495680_0013749 | |||
| 986 | Ga0495680_0048360 | |||
| 987 | Ga0495680_0093782 | |||
| 988 | Ga0495680_0197762 | |||
| 989 | Ga0495675_0000250 | |||
| 990 | Ga0495675_0313430 | |||
| 991 | Ga0495675_0353073 | |||
| 992 | Ga0495684_0017002 | |||
| 993 | Ga0495684_0020148 | |||
| 994 | Ga0495684_0020962 | |||
| 995 | Ga0495684_0097766 | |||
| 996 | Ga0495684_0103387 | |||
| 997 | Ga0495684_0219032 | |||
| 998 | Ga0495684_0249750 | |||
| 999 | Ga0495593_0002267 | |||
| 1000 | Ga0495593_0041653 | |||
| 1001 | Ga0495602_0000235 | |||
| 1002 | Ga0495602_0007762 | |||
| 1003 | Ga0495602_0171549 | |||
| 1004 | Ga0495602_0239467 | |||
| 1005 | Ga0495602_0248059 | |||
| 1006 | Ga0495614_0000112 | |||
| 1007 | Ga0496100_0012368 | |||
| 1008 | Ga0496100_0057261 | |||
| 1009 | Ga0496100_0229156 | |||
| 1010 | Ga0496100_0351579 | |||
| 1011 | Ga0496101_0009414 | |||
| 1012 | Ga0496101_0053189 | |||
| 1013 | Ga0496101_0149360 | |||
| 1014 | Ga0496101_0174367 | |||
| 1015 | Ga0496102_0032716 | |||
| 1016 | Ga0496102_0049063 | |||
| 1017 | Ga0496102_0152466 | |||
| 1018 | Ga0496102_0988074 | |||
| 1019 | Ga0496103_0066378 | |||
| 1020 | Ga0496103_0156432 | |||
| 1021 | Ga0496104_0029020 | |||
| 1022 | Ga0496104_0156978 | |||
| 1023 | Ga0496104_0230292 | |||
| 1024 | Ga0496104_0497929 | |||
| 1025 | Ga0496105_0017975 | |||
| 1026 | Ga0496105_0043165 | |||
| 1027 | Ga0496105_0057053 | |||
| 1028 | Ga0496105_0251061 | |||
| 1029 | Ga0496105_0422377 | |||
| 1030 | Ga0496106_0008840 | |||
| 1031 | Ga0496106_0030374 | |||
| 1032 | Ga0496106_0031770 | |||
| 1033 | Ga0496107_0009407 | |||
| 1034 | Ga0496107_0059855 | |||
| 1035 | Ga0496108_0008091 | |||
| 1036 | Ga0496108_0023961 | |||
| 1037 | Ga0496108_0031623 | |||
| 1038 | Ga0496108_0034350 | |||
| 1039 | Ga0496108_0084150 | |||
| 1040 | Ga0496108_0198694 | |||
| 1041 | Ga0496109_0006728 | |||
| 1042 | Ga0496109_0053696 | |||
| 1043 | Ga0496109_0107411 | |||
| 1044 | Ga0496109_0375630 | |||
| 1045 | Ga0496109_0397239 | |||
| 1046 | Ga0496110_0038024 | |||
| 1047 | Ga0496110_0097343 | |||
| 1048 | Ga0496110_0959914 | |||
| 1049 | Ga0496111_0002503 | |||
| 1050 | Ga0496111_0021414 | |||
| 1051 | Ga0496111_0072549 | |||
| 1052 | Ga0496111_0355289 | |||
| 1053 | Ga0496112_0003774 | |||
| 1054 | Ga0496112_0190526 | |||
| 1055 | Ga0496112_0472137 | |||
| 1056 | Ga0496113_0006507 | |||
| 1057 | Ga0496113_0040740 | |||
| 1058 | Ga0496114_0023811 | |||
| 1059 | Ga0496114_0068218 | |||
| 1060 | Ga0496114_0091189 | |||
| 1061 | Ga0496114_0163235 | |||
| 1062 | Ga0496114_0238248 | |||
| 1063 | Ga0496114_0276690 | |||
| 1064 | Ga0496114_0530916 | |||
| 1065 | Ga0496115_0001171 | |||
| 1066 | Ga0496115_0088491 | |||
| 1067 | Ga0496115_0096138 | |||
| 1068 | Ga0496115_0121200 | |||
| 1069 | Ga0496115_0299613 | |||
| 1070 | Ga0496115_0588795 | |||
| 1071 | Ga0496115_0665444 | |||
| 1072 | Ga0501034_0004154 | |||
| 1073 | Ga0501042_0014784 | |||
| 1074 | Ga0501043_0165008 | |||
| 1075 | Ga0501046_0442826 | |||
| 1076 | Ga0501047_0099637 | |||
| 1077 | Ga0501068_0384778 | |||
| 1078 | Ga0501069_0130613 | |||
| 1079 | Ga0501072_0015504 | |||
| 1080 | Ga0501074_0010895 | |||
| 1081 | Ga0501074_0029258 | |||
| 1082 | Ga0501079_0369025 | |||
| 1083 | Ga0501080_0002096 | |||
| 1084 | Ga0501081_0222002 | |||
| 1085 | Ga0501081_0662213 | |||
| 1086 | Ga0501083_0009464 | |||
| 1087 | nmdc:mga05p37_234556_c1 | |||
| 1088 | nmdc:mga05p37_368750_c1 | |||
| 1089 | nmdc:mga05p37_516388_c1 | |||
| 1090 | nmdc:mga09592_513159_c1 | |||
| 1091 | nmdc:mga08y16_803005_c1 | |||
| 1092 | nmdc:mga0n895_19432_c1 | |||
| 1093 | nmdc:mga0n895_20742_c1 | |||
| 1094 | nmdc:mga0n895_468911_c1 | |||
| 1095 | nmdc:mga0n895_5602_c1 | |||
| 1096 | nmdc:mga0rr50_124002_c1 | |||
| 1097 | nmdc:mga0rr50_20108_c1 | |||
| 1098 | nmdc:mga0rr50_52507_c1 | |||
| 1099 | nmdc:mga08x19_163031_c1 | |||
| 1100 | nmdc:mga08x19_87079_c1 | |||
| 1101 | Ga0495601_0000553 | |||
| 1102 | Ga0495601_0010794 | |||
| 1103 | Ga0495612_0002155 | |||
| 1104 | Ga0495612_0019744 | |||
| 1105 | Ga0495612_0031034 | |||
| 1106 | Ga0495612_0034904 | |||
| 1107 | Ga0495655_0069730 | |||
| 1108 | Ga0495595_0005478 | |||
| 1109 | Ga0495595_0014414 | |||
| 1110 | Ga0495595_0020515 | |||
| 1111 | Ga0495595_0039072 | |||
| 1112 | Ga0495595_0076530 | |||
| 1113 | Ga0495619_0007907 | |||
| 1114 | Ga0495619_0085936 | |||
| 1115 | Ga0495619_0089025 | |||
| 1116 | Ga0495619_0129982 | |||
| 1117 | Ga0495619_0141482 | |||
| 1118 | Ga0495619_0145665 | |||
| 1119 | Ga0495619_0267577 | |||
| 1120 | Ga0500566_0295248 | |||
| 1121 | Ga0500657_088586 | |||
| 1122 | Ga0501082_0098702 | |||
| 1123 | Ga0466962_0002540 | |||
| 1124 | Ga0530510_0015321 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.9481 | 12 | 192 |
| 8iiq-assembly1.cif.gz_A | msmudgx h109s/e52n double mutant | 0.916 | 12 | 185 |
| 1vk2-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution | 0.9081 | 8 | 184 |
| 8iie-assembly1.cif.gz_A | complex form of msmudgx and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx | 0.8987 | 12 | 185 |
| 8iir-assembly1.cif.gz_A | msmudgx h109s/q53a double mutant | 0.8984 | 12 | 185 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9481 | 12 | 192 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9027 | 12 | 193 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8909 | 12 | 192 | 3.40.470.10 |
| 1ui0A00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.853 | 12 | 193 | 3.40.470.10 |
| af_Q9V4D8_761_956_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.7621 | 27 | 193 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JZS6-F1-model_v4 | Type-4 uracil-DNA glycosylase (EC 3.2.2.27) | 0.9821 | 1 | 195 |
GO:0004844
GO:0006281 GO:0046872 GO:0051539 |
| AF-A0A538JZS6-F1-model_v4 | Type-4 uracil-DNA glycosylase (EC 3.2.2.27) | 0.9772 | 1 | 195 |
GO:0004844
GO:0006281 GO:0046872 GO:0051539 |
| AF-A0A7T9F4L6-F1-model_v4 | deleted | 0.9763 | 24 | 193 |
|
| AF-A0A7J2NKB8-F1-model_v4 | Type-4 uracil-DNA glycosylase (EC 3.2.2.27) | 0.9754 | 20 | 187 |
GO:0004844
GO:0006281 GO:0046872 GO:0051539 |
| AF-X1CDQ8-F1-model_v4 | Type-4 uracil-DNA glycosylase (EC 3.2.2.27) | 0.9731 | 12 | 188 |
GO:0004844
GO:0006281 GO:0046872 GO:0051539 |