F463940

General Info

Members Datasets Scaffolds Average Seq Length
562 257 1124 210

Family's Representative Sequence

Representative Sequence 3300020069|Ga0197907_10896267|Ga0197907_108962672
Length 239
Sequence VGAGARVSCPSGVPRRLAPVSALQVASVETLETYGAATAGCTRCRLAQGRTQVVFGTGNPRADLMFVGEAPGFHEDKQGVPFVGQAGKLLDGLLAGVQLRREDVYIANVLKCRPPGNRDPQQDEIEACEPHLFRQIELIEPKVIATLGNFATKLLSGRPLGITRVHGQEQELTIAGRSVLLYPIYHPAAALYTPAMLKVLESDFARLPELMGRGSRPAALAEPVPEPVVAEPAEQLGLF

Samples

Sample ID Description Type Environment
1 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 11.74
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0197907_10896267 3300020069 Bacteria 1407
2 Ga0070658_10280594 3300005327 Bacteria 1418
3 Ga0070683_100196505 3300005329 Bacteria 1915
4 Ga0070680_100047923 3300005336 Bacteria 3481
5 Ga0070680_100339421 3300005336 Bacteria 1276
6 Ga0070660_100684499 3300005339 Bacteria 859
7 Ga0070668_100281307 3300005347 Unclassified 1389
8 Ga0070675_100156643 3300005354 Bacteria 1956
9 Ga0070671_100020561 3300005355 Bacteria 5384
10 Ga0070671_100202953 3300005355 Bacteria 1681
11 Ga0070671_100511910 3300005355 Bacteria 1033
12 Ga0070674_100015813 3300005356 Bacteria 4719
13 Ga0070714_100106907 3300005435 Bacteria 2472
14 Ga0070714_100172277 3300005435 Bacteria 1965
15 Ga0070713_100311538 3300005436 Unclassified 1451
16 Ga0070710_10007726 3300005437 Bacteria 5214
17 Ga0070711_100031534 3300005439 Bacteria 3519
18 Ga0070678_100133436 3300005456 Unclassified 1976
19 Ga0070681_10026566 3300005458 Bacteria 5819
20 Ga0068867_100088176 3300005459 Bacteria 2351
21 Ga0070706_100091840 3300005467 Unclassified 2816
22 Ga0070706_100100555 3300005467 Bacteria 2687
23 Ga0070706_100298694 3300005467 Bacteria 1503
24 Ga0070706_100311054 3300005467 Bacteria 1470
25 Ga0070707_100000459 3300005468 Bacteria 40275
26 Ga0070707_100007106 3300005468 Bacteria 10380
27 Ga0070707_100043066 3300005468 Bacteria 4321
28 Ga0070707_100064532 3300005468 Bacteria 3516
29 Ga0070707_100113299 3300005468 Bacteria 2631
30 Ga0070707_100259614 3300005468 Bacteria 1690
31 Ga0070698_100001624 3300005471 Bacteria 25040
32 Ga0070698_100062718 3300005471 Bacteria 3749
33 Ga0070698_100771835 3300005471 Archaea 905
34 Ga0070699_100190872 3300005518 Bacteria 1820
35 Ga0070699_100732652 3300005518 Unclassified 904
36 Ga0070679_100103420 3300005530 Bacteria 2834
37 Ga0070679_100151473 3300005530 Bacteria 2295
38 Ga0070684_100074215 3300005535 Bacteria 2998
39 Ga0070684_100213157 3300005535 Bacteria 1760
40 Ga0070686_100057693 3300005544 Bacteria 2495
41 Ga0070686_100098803 3300005544 Bacteria 1968
42 Ga0070704_100341599 3300005549 Bacteria 1261
43 Ga0070664_100093886 3300005564 Bacteria 2601
44 Ga0068857_100173306 3300005577 Bacteria 1962
45 Ga0068856_100324272 3300005614 Bacteria 1557
46 Ga0068856_100415955 3300005614 Bacteria 1364
47 Ga0070702_100203703 3300005615 Unclassified 1312
48 Ga0068852_100249226 3300005616 Bacteria 1701
49 Ga0068852_100332805 3300005616 Unclassified 1478
50 Ga0068866_10193579 3300005718 Bacteria 1210
51 Ga0068870_10050347 3300005840 Bacteria 2201
52 Ga0068863_100224208 3300005841 Unclassified 1812
53 Ga0070717_10026487 3300006028 Bacteria 4625
54 Ga0070717_10028548 3300006028 Bacteria 4467
55 Ga0070717_10032677 3300006028 Bacteria 4195
56 Ga0070717_10036084 3300006028 Bacteria 4007
57 Ga0070715_10052072 3300006163 Bacteria 1764
58 Ga0070716_100346066 3300006173 Bacteria 1050
59 Ga0070712_100013729 3300006175 Bacteria 5182
60 Ga0070712_100637078 3300006175 Bacteria 905
61 Ga0068871_100089156 3300006358 Bacteria 2567
62 Ga0068871_100212098 3300006358 Bacteria 1675
63 Ga0075431_100012316 3300006847 Bacteria 8629
64 Ga0075433_10004670 3300006852 Bacteria 10682
65 Ga0075434_100001312 3300006871 Bacteria 20750
66 Ga0068865_100029581 3300006881 Bacteria 3636
67 Ga0068865_100104916 3300006881 Bacteria 2075
68 Ga0075436_100055958 3300006914 Bacteria 2725
69 Ga0075435_100133816 3300007076 Bacteria 2076
70 Ga0105250_10109416 3300009092 Bacteria 1131
71 Ga0105240_10237564 3300009093 Bacteria 2114
72 Ga0105240_10423414 3300009093 Bacteria 1495
73 Ga0105240_10636887 3300009093 Unclassified 1170
74 Ga0105240_10753539 3300009093 Bacteria 1058
75 Ga0105240_10898312 3300009093 Bacteria 953
76 Ga0111539_11296795 3300009094 Bacteria 845
77 Ga0105245_10085151 3300009098 Bacteria 2897
78 Ga0105245_10185989 3300009098 Bacteria 1987
79 Ga0105245_10194644 3300009098 Bacteria 1944
80 Ga0105245_10212951 3300009098 Bacteria 1861
81 Ga0105247_10110958 3300009101 Bacteria 1765
82 Ga0114129_10021487 3300009147 Bacteria 9160
83 Ga0105243_10050032 3300009148 Bacteria 3300
84 Ga0105242_10055936 3300009176 Bacteria 3228
85 Ga0105242_10118033 3300009176 Bacteria 2272
86 Ga0105242_10132871 3300009176 Bacteria 2150
87 Ga0105242_10175069 3300009176 Bacteria 1888
88 Ga0105248_10671645 3300009177 Bacteria 1169
89 Ga0105237_10139610 3300009545 Bacteria 2417
90 Ga0105238_10002351 3300009551 Bacteria 19018
91 Ga0105249_10116372 3300009553 Bacteria 2534
92 Ga0105249_10421723 3300009553 Unclassified 1368
93 Ga0105249_10647489 3300009553 Bacteria 1114
94 Ga0105239_10204410 3300010375 Bacteria 2213
95 Ga0105239_10733806 3300010375 Bacteria 1130
96 Ga0105246_10019323 3300011119 Bacteria 4352
97 Ga0157373_10468587 3300013100 Bacteria 908
98 Ga0157370_10471103 3300013104 Bacteria 1154
99 Ga0157369_10229946 3300013105 Bacteria 1939
100 Ga0157374_10011139 3300013296 Bacteria 7773
101 Ga0157374_10030374 3300013296 Bacteria 4906
102 Ga0157378_10272924 3300013297 Bacteria 1627
103 Ga0157378_10482070 3300013297 Bacteria 1236
104 Ga0163162_10063209 3300013306 Bacteria 3743
105 Ga0163162_10150799 3300013306 Bacteria 2442
106 Ga0163162_10248097 3300013306 Bacteria 1912
107 Ga0157372_10357775 3300013307 Bacteria 1701
108 Ga0157375_10760938 3300013308 Bacteria 1119
109 Ga0163163_10101520 3300014325 Bacteria 2899
110 Ga0157380_10053568 3300014326 Bacteria 3199
111 Ga0157380_10139872 3300014326 Bacteria 2078
112 Ga0157377_10025073 3300014745 Bacteria 3178
113 Ga0157376_10072300 3300014969 Bacteria 2934
114 Ga0157376_10073327 3300014969 Bacteria 2915
115 Ga0157376_10681308 3300014969 Bacteria 1031
116 Ga0163161_10060869 3300017792 Bacteria 2749
117 Ga0163161_10398243 3300017792 Unclassified 1103
118 Ga0206356_10776365 3300020070 Bacteria 915
119 Ga0206353_10017238 3300020082 Bacteria 1543
120 Ga0206353_11127049 3300020082 Bacteria 4901
121 Ga0224712_10048454 3300022467 Bacteria 1640
122 Ga0207688_10020358 3300025901 Bacteria 3622
123 Ga0207688_10111628 3300025901 Bacteria 1587
124 Ga0207699_10069640 3300025906 Bacteria 2146
125 Ga0207643_10180683 3300025908 Bacteria 1276
126 Ga0207705_10012826 3300025909 Bacteria 6052
127 Ga0207684_10006591 3300025910 Bacteria 10561
128 Ga0207684_10010423 3300025910 Bacteria 8183
129 Ga0207684_10053364 3300025910 Unclassified 3431
130 Ga0207684_10299771 3300025910 Unclassified 1386
131 Ga0207707_10298458 3300025912 Bacteria 1393
132 Ga0207707_10615366 3300025912 Bacteria 918
133 Ga0207695_10061423 3300025913 Bacteria 3884
134 Ga0207695_10510580 3300025913 Bacteria 1084
135 Ga0207693_10000964 3300025915 Bacteria 25831
136 Ga0207693_10014926 3300025915 Bacteria 6238
137 Ga0207693_10154780 3300025915 Bacteria 1803
138 Ga0207663_10030999 3300025916 Bacteria 3159
139 Ga0207660_10305517 3300025917 Bacteria 1267
140 Ga0207657_10073875 3300025919 Bacteria 2880
141 Ga0207657_10517446 3300025919 Bacteria 934
142 Ga0207652_10170617 3300025921 Bacteria 1952
143 Ga0207646_10009128 3300025922 Bacteria 9840
144 Ga0207646_10010128 3300025922 Bacteria 9239
145 Ga0207646_10278416 3300025922 Bacteria 1512
146 Ga0207646_10487274 3300025922 Bacteria 1111
147 Ga0207646_10492898 3300025922 Unclassified 1104
148 Ga0207646_10680904 3300025922 Bacteria 920
149 Ga0207659_10408069 3300025926 Bacteria 1137
150 Ga0207659_10428468 3300025926 Bacteria 1111
151 Ga0207687_10312285 3300025927 Bacteria 1270
152 Ga0207700_10008053 3300025928 Bacteria 6499
153 Ga0207664_10005790 3300025929 Bacteria 8451
154 Ga0207664_10024691 3300025929 Bacteria 4519
155 Ga0207664_10160620 3300025929 Bacteria 1916
156 Ga0207706_10032145 3300025933 Bacteria 4673
157 Ga0207686_10440501 3300025934 Bacteria 1000
158 Ga0207669_10027602 3300025937 Bacteria 3111
159 Ga0207669_10155812 3300025937 Bacteria 1606
160 Ga0207704_10311589 3300025938 Bacteria 1210
161 Ga0207665_10013449 3300025939 Bacteria 5381
162 Ga0207665_10086195 3300025939 Unclassified 2168
163 Ga0207711_10361943 3300025941 Bacteria 1344
164 Ga0207689_10228452 3300025942 Bacteria 1538
165 Ga0207667_10567586 3300025949 Unclassified 1146
166 Ga0207712_10039159 3300025961 Bacteria 3247
167 Ga0207677_10091568 3300026023 Bacteria 2212
168 Ga0207702_10046515 3300026078 Bacteria 3653
169 Ga0207702_10066214 3300026078 Bacteria 3096
170 Ga0207648_10081072 3300026089 Unclassified 2830
171 Ga0207675_100005163 3300026118 Bacteria 12569
172 Ga0207675_100762598 3300026118 Bacteria 979
173 Ga0207683_10066865 3300026121 Bacteria 3170
174 Ga0207698_11108841 3300026142 Bacteria 804
175 Ga0207428_10136165 3300027907 Bacteria 1877
176 Ga0207428_10165518 3300027907 Bacteria 1677
177 Ga0268265_10209152 3300028380 Bacteria 1699
178 Ga0265319_1031087 3300028563 Bacteria 1861
179 Ga0265319_1041820 3300028563 Bacteria 1544
180 Ga0265318_10005350 3300028577 Bacteria 6032
181 Ga0265336_10001570 3300028666 Bacteria 10254
182 Ga0265336_10022541 3300028666 Bacteria 2004
183 Ga0265336_10029650 3300028666 Unclassified 1706
184 Ga0265338_10016515 3300028800 Bacteria 8024
185 Ga0265338_10026870 3300028800 Bacteria 5791
186 Ga0265338_10212468 3300028800 Bacteria 1451
187 Ga0265338_10213717 3300028800 Bacteria 1446
188 Ga0265327_10010269 3300031251 Bacteria 6602
189 Ga0307414_10180782 3300032004 Bacteria 1696
190 Ga0373926_0076531 3300035083 Bacteria 1234
191 Ga0373940_0116355 3300035088 Bacteria 825
192 Ga0373944_0048220 3300035089 Bacteria 1336
193 Ga0373951_0035178 3300035091 Bacteria 1192
194 Ga0373954_0066752 3300035118 Bacteria 1704
195 Ga0373954_0127199 3300035118 Bacteria 1239
196 Ga0373956_0097672 3300035119 Bacteria 1360
197 Ga0373943_0000925 3300035170 Bacteria 12925
198 Ga0373943_0011428 3300035170 Bacteria 3995
199 Ga0373946_0039567 3300035171 Bacteria 1925
200 Ga0373946_0269215 3300035171 Unclassified 835
201 Ga0373955_0082248 3300035172 Bacteria 1822
202 Ga0373924_0058158 3300035410 Unclassified 1614
203 Ga0373924_0088641 3300035410 Bacteria 1322
204 Ga0373931_0037715 3300035691 Bacteria 2524
205 Ga0373935_0014242 3300035692 Bacteria 4800
206 Ga0373927_0070784 3300035695 Bacteria 2257
207 Ga0373933_0321189 3300035724 Bacteria 1004
208 Ga0373947_0002909 3300035725 Bacteria 10218
209 Ga0373937_0003744 3300036401 Bacteria 12853
210 Ga0373937_0078910 3300036401 Bacteria 3043
211 Ga0373937_0184320 3300036401 Bacteria 1960
212 Ga0373937_0451335 3300036401 Bacteria 1221
213 Ga0373937_1042662 3300036401 Bacteria 766
214 Ga0373925_0002949 3300037068 Bacteria 13431
215 Ga0395899_0433849 3300037312 Bacteria 863
216 Ga0395900_0001510 3300037418 Bacteria 27641
217 Ga0395900_0006843 3300037418 Bacteria 11828
218 Ga0395900_0026078 3300037418 Bacteria 5984
219 Ga0395900_0080499 3300037418 Bacteria 3347
220 Ga0395898_0003922 3300037466 Bacteria 16418
221 Ga0395898_0004808 3300037466 Bacteria 14701
222 Ga0395898_0006939 3300037466 Bacteria 12040
223 Ga0395898_0058964 3300037466 Bacteria 3736
224 Ga0395898_0080416 3300037466 Bacteria 3143
225 Ga0395898_0398081 3300037466 Unclassified 1313
226 Ga0395905_0001678 3300037471 Bacteria 26104
227 Ga0395905_0089002 3300037471 Bacteria 2893
228 Ga0395905_0270122 3300037471 Bacteria 1586
229 Ga0395905_0359270 3300037471 Unclassified 1349
230 Ga0395905_0458923 3300037471 Bacteria 1172
231 Ga0395901_0003395 3300038443 Bacteria 16041
232 Ga0395901_0004972 3300038443 Bacteria 13414
233 Ga0395901_0055982 3300038443 Bacteria 4102
234 Ga0395901_0276910 3300038443 Bacteria 1744
235 Ga0395901_0667511 3300038443 Bacteria 1041
236 Ga0395901_0850848 3300038443 Bacteria 897
237 Ga0436360_0135256 3300039438 Bacteria 6477
238 Ga0439453_0007585 3300041408 Bacteria 1726
239 Ga0451797_0771178 3300041453 Bacteria 733
240 Ga0439431_0036060 3300041997 Bacteria 1244
241 Ga0439433_0003746 3300041999 Bacteria 3266
242 Ga0439442_004946 3300042002 Bacteria 2657
243 Ga0439445_0022687 3300042004 Bacteria 1585
244 Ga0439448_0000320 3300042005 Bacteria 10629
245 Ga0450900_000091 3300042136 Bacteria 4863
246 Ga0439446_0017414 3300042156 Bacteria 2008
247 Ga0439434_0003566 3300042435 Bacteria 4543
248 Ga0439460_0002740 3300042461 Bacteria 4246
249 Ga0466969_0041058 3300044656 Bacteria 2316
250 Ga0466965_0088939 3300044683 Bacteria 1569
251 Ga0466966_0036173 3300044684 Bacteria 3189
252 Ga0466963_0001734 3300044694 Bacteria 11873
253 Ga0466963_0003784 3300044694 Bacteria 8722
254 Ga0466963_0004956 3300044694 Bacteria 7763
255 Ga0466963_0009337 3300044694 Bacteria 5904
256 Ga0466963_0014973 3300044694 Bacteria 4792
257 Ga0466963_0018403 3300044694 Bacteria 4367
258 Ga0466963_0088074 3300044694 Bacteria 2111
259 Ga0466964_0001680 3300044706 Bacteria 7642
260 Ga0466964_0001976 3300044706 Bacteria 7194
261 Ga0466964_0022864 3300044706 Bacteria 2428
262 Ga0466964_0024426 3300044706 Bacteria 2355
263 Ga0466964_0262963 3300044706 Bacteria 855
264 Ga0466971_0004164 3300044719 Bacteria 6233
265 Ga0466971_0042925 3300044719 Bacteria 2032
266 Ga0466971_0184332 3300044719 Bacteria 982
267 Ga0466968_0001841 3300044735 Bacteria 7657
268 Ga0466968_0048223 3300044735 Bacteria 1812
269 Ga0466968_0063899 3300044735 Bacteria 1591
270 Ga0466970_0261757 3300044765 Bacteria 970
271 Ga0466957_0000839 3300044842 Bacteria 15709
272 Ga0466957_0005089 3300044842 Bacteria 7355
273 Ga0466957_0005602 3300044842 Bacteria 7057
274 Ga0466957_0010143 3300044842 Bacteria 5391
275 Ga0466957_0011876 3300044842 Bacteria 5034
276 Ga0466957_0014602 3300044842 Bacteria 4576
277 Ga0466957_0016238 3300044842 Bacteria 4354
278 Ga0466957_0021347 3300044842 Bacteria 3815
279 Ga0466957_0186591 3300044842 Bacteria 1356
280 Ga0466957_0304985 3300044842 Bacteria 1071
281 Ga0466960_0038468 3300044901 Bacteria 2250
282 Ga0466959_0002503 3300045049 Bacteria 11770
283 Ga0466959_0133999 3300045049 Bacteria 1755
284 Ga0466958_0001766 3300045836 Bacteria 10466
285 Ga0466958_0004935 3300045836 Bacteria 7113
286 Ga0466958_0006747 3300045836 Bacteria 6268
287 Ga0466958_0028945 3300045836 Bacteria 3286
288 Ga0466958_0036350 3300045836 Bacteria 2947
289 Ga0466958_0099554 3300045836 Bacteria 1806
290 Ga0466958_0118946 3300045836 Unclassified 1653
291 Ga0466958_0220295 3300045836 Bacteria 1210
292 Ga0466967_0002062 3300045976 Bacteria 12283
293 Ga0466967_0005328 3300045976 Bacteria 8886
294 Ga0466967_0005346 3300045976 Bacteria 8876
295 Ga0466967_0007439 3300045976 Bacteria 7899
296 Ga0466967_0008127 3300045976 Bacteria 7657
297 Ga0466967_0018105 3300045976 Bacteria 5620
298 Ga0466967_0026573 3300045976 Bacteria 4796
299 Ga0466967_0034363 3300045976 Bacteria 4302
300 Ga0466967_0034548 3300045976 Bacteria 4293
301 Ga0466967_0047556 3300045976 Bacteria 3740
302 Ga0466967_0057450 3300045976 Bacteria 3435
303 Ga0466967_0088241 3300045976 Bacteria 2814
304 Ga0466967_0183720 3300045976 Bacteria 1973
305 Ga0466967_0189422 3300045976 Bacteria 1943
306 Ga0466967_0219569 3300045976 Bacteria 1806
307 Ga0466967_0378450 3300045976 Bacteria 1374
308 Ga0466967_0406344 3300045976 Unclassified 1325
309 Ga0466967_0551557 3300045976 Bacteria 1134
310 Ga0495592_0000716 3300046454 Bacteria 23196
311 Ga0495592_0006583 3300046454 Bacteria 8656
312 Ga0495592_0046840 3300046454 Bacteria 3222
313 Ga0495592_0133518 3300046454 Bacteria 1733
314 Ga0495603_0233814 3300046455 Bacteria 1059
315 Ga0495629_0019911 3300046459 Bacteria 4788
316 Ga0495629_0023550 3300046459 Bacteria 4386
317 Ga0495641_0013879 3300046461 Bacteria 4391
318 Ga0495641_0132352 3300046461 Bacteria 1113
319 Ga0495651_0000001 3300046462 Bacteria 210544
320 Ga0495651_0002853 3300046462 Bacteria 13391
321 Ga0495651_0102021 3300046462 Bacteria 2134
322 Ga0495651_0121844 3300046462 Bacteria 1915
323 Ga0495651_0220658 3300046462 Bacteria 1312
324 Ga0495651_0405217 3300046462 Bacteria 889
325 Ga0495653_0002945 3300046463 Bacteria 13629
326 Ga0495653_0053390 3300046463 Bacteria 3092
327 Ga0495653_0059110 3300046463 Bacteria 2911
328 Ga0495653_0130896 3300046463 Bacteria 1776
329 Ga0495580_0060943 3300046472 Bacteria 2650
330 Ga0495580_0070766 3300046472 Bacteria 2437
331 Ga0495580_0291612 3300046472 Bacteria 1112
332 Ga0495582_0000805 3300046473 Bacteria 17419
333 Ga0495639_0002102 3300046475 Bacteria 8795
334 Ga0495662_0003155 3300046476 Bacteria 8317
335 Ga0495662_0016626 3300046476 Bacteria 3565
336 Ga0495662_0133098 3300046476 Bacteria 1223
337 Ga0495664_0159264 3300046477 Bacteria 1369
338 Ga0495584_0148316 3300046491 Bacteria 1192
339 Ga0495594_0239827 3300046499 Bacteria 1033
340 Ga0495608_0000448 3300046511 Bacteria 28730
341 Ga0495608_0033438 3300046511 Bacteria 3475
342 Ga0495608_0038599 3300046511 Bacteria 3206
343 Ga0495608_0134585 3300046511 Bacteria 1580
344 Ga0495618_0003288 3300046514 Bacteria 10120
345 Ga0495618_0036945 3300046514 Bacteria 3065
346 Ga0495618_0081289 3300046514 Unclassified 2069
347 Ga0495628_0000500 3300046516 Bacteria 35932
348 Ga0495628_0007520 3300046516 Bacteria 9426
349 Ga0495628_0026416 3300046516 Bacteria 4734
350 Ga0495630_0076741 3300046517 Bacteria 2518
351 Ga0495630_0137962 3300046517 Bacteria 1853
352 Ga0495644_0117880 3300046523 Bacteria 1009
353 Ga0495666_0001439 3300046526 Bacteria 11572
354 Ga0495666_0041331 3300046526 Bacteria 2233
355 Ga0495652_0000015 3300046529 Bacteria 222624
356 Ga0495652_0036455 3300046529 Bacteria 4276
357 Ga0495652_0109559 3300046529 Bacteria 2223
358 Ga0495652_0182921 3300046529 Bacteria 1606
359 Ga0495652_0203086 3300046529 Bacteria 1503
360 Ga0495652_0292041 3300046529 Bacteria 1189
361 Ga0495665_0001480 3300046531 Bacteria 12592
362 Ga0495665_0027373 3300046531 Bacteria 3059
363 Ga0495640_0016020 3300046533 Bacteria 5621
364 Ga0495640_0065435 3300046533 Bacteria 2454
365 Ga0495640_0109285 3300046533 Bacteria 1808
366 Ga0495586_0002164 3300046535 Bacteria 10681
367 Ga0495586_0055562 3300046535 Bacteria 2145
368 Ga0495587_0000036 3300046536 Bacteria 117570
369 Ga0495587_0094377 3300046536 Bacteria 1727
370 Ga0495587_0184889 3300046536 Bacteria 1181
371 Ga0495645_0000039 3300046543 Bacteria 94569
372 Ga0495645_0026226 3300046543 Bacteria 4229
373 Ga0495645_0130879 3300046543 Bacteria 1758
374 Ga0495645_0299006 3300046543 Bacteria 1052
375 Ga0495667_0030520 3300046559 Bacteria 3621
376 Ga0495667_0140996 3300046559 Bacteria 1553
377 Ga0495667_0269835 3300046559 Bacteria 1081
378 Ga0495656_0044998 3300046615 Bacteria 1861
379 Ga0495656_0057597 3300046615 Bacteria 1683
380 Ga0495656_0239729 3300046615 Bacteria 913
381 Ga0495634_0005773 3300046642 Bacteria 9452
382 Ga0495634_0015248 3300046642 Bacteria 5526
383 Ga0495634_0277853 3300046642 Bacteria 1018
384 Ga0495611_0157099 3300046648 Bacteria 1062
385 Ga0495611_0183640 3300046648 Bacteria 977
386 Ga0495635_0062502 3300046663 Bacteria 2557
387 Ga0495659_0060222 3300046664 Bacteria 1400
388 Ga0495588_0027199 3300046674 Bacteria 2858
389 Ga0495657_0028255 3300046675 Bacteria 3948
390 Ga0495657_0057531 3300046675 Bacteria 2585
391 Ga0495657_0325385 3300046675 Unclassified 913
392 Ga0495599_0000055 3300046678 Bacteria 79065
393 Ga0495599_0000409 3300046678 Bacteria 24585
394 Ga0495599_0163509 3300046678 Bacteria 1375
395 Ga0495623_0000445 3300046679 Bacteria 27187
396 Ga0495623_0181194 3300046679 Bacteria 1224
397 Ga0495646_0031152 3300046680 Bacteria 3326
398 Ga0495647_0001179 3300046681 Bacteria 8036
399 Ga0495658_0004116 3300046683 Bacteria 7163
400 Ga0495613_0034278 3300046689 Bacteria 3770
401 Ga0495613_0143402 3300046689 Bacteria 1705
402 Ga0495613_0204555 3300046689 Unclassified 1391
403 Ga0495624_0043442 3300046690 Bacteria 2867
404 Ga0495589_0149701 3300046794 Bacteria 1115
405 Ga0495589_0202357 3300046794 Bacteria 937
406 Ga0495600_0024976 3300046809 Bacteria 3848
407 Ga0495600_0032611 3300046809 Bacteria 3381
408 Ga0495600_0090653 3300046809 Bacteria 1994
409 Ga0495600_0198933 3300046809 Bacteria 1287
410 Ga0495600_0212976 3300046809 Bacteria 1238
411 Ga0495581_0013174 3300047315 Bacteria 4794
412 Ga0495581_0016709 3300047315 Bacteria 4265
413 Ga0495604_0000004 3300047317 Bacteria 456385
414 Ga0495604_0099616 3300047317 Bacteria 2138
415 Ga0495604_0169862 3300047317 Bacteria 1535
416 Ga0495604_0295555 3300047317 Bacteria 1089
417 Ga0495604_0344348 3300047317 Bacteria 992
418 Ga0495674_0042802 3300047319 Bacteria 4036
419 Ga0495674_0224375 3300047319 Bacteria 1552
420 Ga0495676_0004734 3300047321 Bacteria 12459
421 Ga0495676_0036226 3300047321 Bacteria 4122
422 Ga0495676_0307846 3300047321 Bacteria 1067
423 Ga0495680_0013749 3300047322 Bacteria 7044
424 Ga0495680_0048360 3300047322 Bacteria 3340
425 Ga0495680_0093782 3300047322 Bacteria 2247
426 Ga0495680_0197762 3300047322 Bacteria 1443
427 Ga0495675_0000250 3300047444 Bacteria 38818
428 Ga0495675_0313430 3300047444 Bacteria 929
429 Ga0495675_0353073 3300047444 Bacteria 864
430 Ga0495684_0017002 3300047471 Bacteria 5604
431 Ga0495684_0020148 3300047471 Bacteria 5136
432 Ga0495684_0020962 3300047471 Bacteria 5034
433 Ga0495684_0097766 3300047471 Bacteria 2220
434 Ga0495684_0103387 3300047471 Bacteria 2153
435 Ga0495684_0219032 3300047471 Unclassified 1396
436 Ga0495684_0249750 3300047471 Bacteria 1291
437 Ga0495593_0002267 3300047673 Bacteria 11530
438 Ga0495593_0041653 3300047673 Bacteria 2468
439 Ga0495602_0000235 3300048088 Bacteria 51786
440 Ga0495602_0007762 3300048088 Bacteria 11216
441 Ga0495602_0171549 3300048088 Bacteria 1683
442 Ga0495602_0239467 3300048088 Bacteria 1358
443 Ga0495602_0248059 3300048088 Bacteria 1328
444 Ga0495614_0000112 3300048089 Bacteria 27892
445 Ga0496100_0012368 3300048903 Bacteria 4890
446 Ga0496100_0057261 3300048903 Bacteria 2552
447 Ga0496100_0229156 3300048903 Bacteria 1366
448 Ga0496100_0351579 3300048903 Bacteria 1113
449 Ga0496101_0009414 3300048904 Bacteria 6420
450 Ga0496101_0053189 3300048904 Bacteria 2920
451 Ga0496101_0149360 3300048904 Unclassified 1786
452 Ga0496101_0174367 3300048904 Bacteria 1653
453 Ga0496102_0032716 3300048905 Bacteria 4673
454 Ga0496102_0049063 3300048905 Bacteria 3839
455 Ga0496102_0152466 3300048905 Bacteria 2172
456 Ga0496102_0988074 3300048905 Bacteria 762
457 Ga0496103_0066378 3300048906 Bacteria 2252
458 Ga0496103_0156432 3300048906 Unclassified 1461
459 Ga0496104_0029020 3300048907 Bacteria 5129
460 Ga0496104_0156978 3300048907 Bacteria 2183
461 Ga0496104_0230292 3300048907 Bacteria 1765
462 Ga0496104_0497929 3300048907 Bacteria 1129
463 Ga0496105_0017975 3300048908 Bacteria 5674
464 Ga0496105_0043165 3300048908 Bacteria 3718
465 Ga0496105_0057053 3300048908 Bacteria 3224
466 Ga0496105_0251061 3300048908 Bacteria 1433
467 Ga0496105_0422377 3300048908 Bacteria 1055
468 Ga0496106_0008840 3300048909 Bacteria 7444
469 Ga0496106_0030374 3300048909 Bacteria 4030
470 Ga0496106_0031770 3300048909 Bacteria 3934
471 Ga0496107_0009407 3300048910 Bacteria 6780
472 Ga0496107_0059855 3300048910 Bacteria 2756
473 Ga0496108_0008091 3300048911 Bacteria 8529
474 Ga0496108_0023961 3300048911 Bacteria 5024
475 Ga0496108_0031623 3300048911 Bacteria 4392
476 Ga0496108_0034350 3300048911 Bacteria 4213
477 Ga0496108_0084150 3300048911 Bacteria 2699
478 Ga0496108_0198694 3300048911 Bacteria 1740
479 Ga0496109_0006728 3300048912 Bacteria 9680
480 Ga0496109_0053696 3300048912 Bacteria 3675
481 Ga0496109_0107411 3300048912 Bacteria 2592
482 Ga0496109_0375630 3300048912 Bacteria 1343
483 Ga0496109_0397239 3300048912 Bacteria 1302
484 Ga0496110_0038024 3300048913 Bacteria 4185
485 Ga0496110_0097343 3300048913 Bacteria 2636
486 Ga0496110_0959914 3300048913 Bacteria 762
487 Ga0496111_0002503 3300048914 Bacteria 11081
488 Ga0496111_0021414 3300048914 Bacteria 4514
489 Ga0496111_0072549 3300048914 Bacteria 2506
490 Ga0496111_0355289 3300048914 Bacteria 1085
491 Ga0496112_0003774 3300048915 Bacteria 12646
492 Ga0496112_0190526 3300048915 Bacteria 2013
493 Ga0496112_0472137 3300048915 Bacteria 1191
494 Ga0496113_0006507 3300048916 Bacteria 7415
495 Ga0496113_0040740 3300048916 Bacteria 3424
496 Ga0496114_0023811 3300048917 Bacteria 4997
497 Ga0496114_0068218 3300048917 Bacteria 2985
498 Ga0496114_0091189 3300048917 Bacteria 2588
499 Ga0496114_0163235 3300048917 Unclassified 1938
500 Ga0496114_0238248 3300048917 Unclassified 1599
501 Ga0496114_0276690 3300048917 Unclassified 1479
502 Ga0496114_0530916 3300048917 Bacteria 1040
503 Ga0496115_0001171 3300048918 Bacteria 18799
504 Ga0496115_0088491 3300048918 Bacteria 2528
505 Ga0496115_0096138 3300048918 Bacteria 2425
506 Ga0496115_0121200 3300048918 Bacteria 2152
507 Ga0496115_0299613 3300048918 Bacteria 1317
508 Ga0496115_0588795 3300048918 Bacteria 885
509 Ga0496115_0665444 3300048918 Bacteria 822
510 Ga0501034_0004154 3300049571 Bacteria 16214
511 Ga0501042_0014784 3300049578 Bacteria 5330
512 Ga0501043_0165008 3300049579 Bacteria 1730
513 Ga0501046_0442826 3300049580 Bacteria 935
514 Ga0501047_0099637 3300049581 Bacteria 2785
515 Ga0501068_0384778 3300049584 Bacteria 904
516 Ga0501069_0130613 3300049585 Bacteria 1438
517 Ga0501072_0015504 3300049588 Bacteria 5841
518 Ga0501074_0010895 3300049590 Bacteria 6600
519 Ga0501074_0029258 3300049590 Bacteria 3990
520 Ga0501079_0369025 3300049741 Bacteria 1125
521 Ga0501080_0002096 3300049742 Bacteria 17315
522 Ga0501081_0222002 3300049743 Unclassified 1374
523 Ga0501081_0662213 3300049743 Bacteria 783
524 Ga0501083_0009464 3300049744 Bacteria 6883
525 nmdc:mga05p37_234556_c1 3300050507 Bacteria 2209
526 nmdc:mga05p37_368750_c1 3300050507 Bacteria 1686
527 nmdc:mga05p37_516388_c1 3300050507 Bacteria 1367
528 nmdc:mga09592_513159_c1 3300050508 Unclassified 1031
529 nmdc:mga08y16_803005_c1 3300050511 Bacteria 934
530 nmdc:mga0n895_19432_c1 3300050512 Bacteria 6316
531 nmdc:mga0n895_20742_c1 3300050512 Bacteria 6135
532 nmdc:mga0n895_468911_c1 3300050512 Bacteria 1270
533 nmdc:mga0n895_5602_c1 3300050512 Bacteria 10514
534 nmdc:mga0rr50_124002_c1 3300050513 Bacteria 2060
535 nmdc:mga0rr50_20108_c1 3300050513 Bacteria 4524
536 nmdc:mga0rr50_52507_c1 3300050513 Bacteria 3030
537 nmdc:mga08x19_163031_c1 3300050514 Bacteria 1515
538 nmdc:mga08x19_87079_c1 3300050514 Bacteria 2057
539 Ga0495601_0000553 3300053077 Bacteria 19807
540 Ga0495601_0010794 3300053077 Bacteria 5451
541 Ga0495612_0002155 3300053078 Bacteria 8097
542 Ga0495612_0019744 3300053078 Bacteria 2700
543 Ga0495612_0031034 3300053078 Bacteria 2154
544 Ga0495612_0034904 3300053078 Bacteria 2037
545 Ga0495655_0069730 3300053083 Bacteria 980
546 Ga0495595_0005478 3300053084 Bacteria 5141
547 Ga0495595_0014414 3300053084 Bacteria 3354
548 Ga0495595_0020515 3300053084 Bacteria 2877
549 Ga0495595_0039072 3300053084 Bacteria 2164
550 Ga0495595_0076530 3300053084 Bacteria 1588
551 Ga0495619_0007907 3300053085 Bacteria 6727
552 Ga0495619_0085936 3300053085 Bacteria 2125
553 Ga0495619_0089025 3300053085 Bacteria 2088
554 Ga0495619_0129982 3300053085 Unclassified 1730
555 Ga0495619_0141482 3300053085 Bacteria 1657
556 Ga0495619_0145665 3300053085 Bacteria 1633
557 Ga0495619_0267577 3300053085 Bacteria 1184
558 Ga0500566_0295248 3300053094 Bacteria 765
559 Ga0500657_088586 3300053728 Bacteria 1310
560 Ga0501082_0098702 3300060353 Bacteria 2525
561 Ga0466962_0002540 3300061719 Bacteria 8660
562 Ga0530510_0015321 3300061734 Bacteria 5416
563 Ga0197907_10896267
564 Ga0070658_10280594
565 Ga0070683_100196505
566 Ga0070680_100047923
567 Ga0070680_100339421
568 Ga0070660_100684499
569 Ga0070668_100281307
570 Ga0070675_100156643
571 Ga0070671_100020561
572 Ga0070671_100202953
573 Ga0070671_100511910
574 Ga0070674_100015813
575 Ga0070714_100106907
576 Ga0070714_100172277
577 Ga0070713_100311538
578 Ga0070710_10007726
579 Ga0070711_100031534
580 Ga0070678_100133436
581 Ga0070681_10026566
582 Ga0068867_100088176
583 Ga0070706_100091840
584 Ga0070706_100100555
585 Ga0070706_100298694
586 Ga0070706_100311054
587 Ga0070707_100000459
588 Ga0070707_100007106
589 Ga0070707_100043066
590 Ga0070707_100064532
591 Ga0070707_100113299
592 Ga0070707_100259614
593 Ga0070698_100001624
594 Ga0070698_100062718
595 Ga0070698_100771835
596 Ga0070699_100190872
597 Ga0070699_100732652
598 Ga0070679_100103420
599 Ga0070679_100151473
600 Ga0070684_100074215
601 Ga0070684_100213157
602 Ga0070686_100057693
603 Ga0070686_100098803
604 Ga0070704_100341599
605 Ga0070664_100093886
606 Ga0068857_100173306
607 Ga0068856_100324272
608 Ga0068856_100415955
609 Ga0070702_100203703
610 Ga0068852_100249226
611 Ga0068852_100332805
612 Ga0068866_10193579
613 Ga0068870_10050347
614 Ga0068863_100224208
615 Ga0070717_10026487
616 Ga0070717_10028548
617 Ga0070717_10032677
618 Ga0070717_10036084
619 Ga0070715_10052072
620 Ga0070716_100346066
621 Ga0070712_100013729
622 Ga0070712_100637078
623 Ga0068871_100089156
624 Ga0068871_100212098
625 Ga0075431_100012316
626 Ga0075433_10004670
627 Ga0075434_100001312
628 Ga0068865_100029581
629 Ga0068865_100104916
630 Ga0075436_100055958
631 Ga0075435_100133816
632 Ga0105250_10109416
633 Ga0105240_10237564
634 Ga0105240_10423414
635 Ga0105240_10636887
636 Ga0105240_10753539
637 Ga0105240_10898312
638 Ga0111539_11296795
639 Ga0105245_10085151
640 Ga0105245_10185989
641 Ga0105245_10194644
642 Ga0105245_10212951
643 Ga0105247_10110958
644 Ga0114129_10021487
645 Ga0105243_10050032
646 Ga0105242_10055936
647 Ga0105242_10118033
648 Ga0105242_10132871
649 Ga0105242_10175069
650 Ga0105248_10671645
651 Ga0105237_10139610
652 Ga0105238_10002351
653 Ga0105249_10116372
654 Ga0105249_10421723
655 Ga0105249_10647489
656 Ga0105239_10204410
657 Ga0105239_10733806
658 Ga0105246_10019323
659 Ga0157373_10468587
660 Ga0157370_10471103
661 Ga0157369_10229946
662 Ga0157374_10011139
663 Ga0157374_10030374
664 Ga0157378_10272924
665 Ga0157378_10482070
666 Ga0163162_10063209
667 Ga0163162_10150799
668 Ga0163162_10248097
669 Ga0157372_10357775
670 Ga0157375_10760938
671 Ga0163163_10101520
672 Ga0157380_10053568
673 Ga0157380_10139872
674 Ga0157377_10025073
675 Ga0157376_10072300
676 Ga0157376_10073327
677 Ga0157376_10681308
678 Ga0163161_10060869
679 Ga0163161_10398243
680 Ga0206356_10776365
681 Ga0206353_10017238
682 Ga0206353_11127049
683 Ga0224712_10048454
684 Ga0207688_10020358
685 Ga0207688_10111628
686 Ga0207699_10069640
687 Ga0207643_10180683
688 Ga0207705_10012826
689 Ga0207684_10006591
690 Ga0207684_10010423
691 Ga0207684_10053364
692 Ga0207684_10299771
693 Ga0207707_10298458
694 Ga0207707_10615366
695 Ga0207695_10061423
696 Ga0207695_10510580
697 Ga0207693_10000964
698 Ga0207693_10014926
699 Ga0207693_10154780
700 Ga0207663_10030999
701 Ga0207660_10305517
702 Ga0207657_10073875
703 Ga0207657_10517446
704 Ga0207652_10170617
705 Ga0207646_10009128
706 Ga0207646_10010128
707 Ga0207646_10278416
708 Ga0207646_10487274
709 Ga0207646_10492898
710 Ga0207646_10680904
711 Ga0207659_10408069
712 Ga0207659_10428468
713 Ga0207687_10312285
714 Ga0207700_10008053
715 Ga0207664_10005790
716 Ga0207664_10024691
717 Ga0207664_10160620
718 Ga0207706_10032145
719 Ga0207686_10440501
720 Ga0207669_10027602
721 Ga0207669_10155812
722 Ga0207704_10311589
723 Ga0207665_10013449
724 Ga0207665_10086195
725 Ga0207711_10361943
726 Ga0207689_10228452
727 Ga0207667_10567586
728 Ga0207712_10039159
729 Ga0207677_10091568
730 Ga0207702_10046515
731 Ga0207702_10066214
732 Ga0207648_10081072
733 Ga0207675_100005163
734 Ga0207675_100762598
735 Ga0207683_10066865
736 Ga0207698_11108841
737 Ga0207428_10136165
738 Ga0207428_10165518
739 Ga0268265_10209152
740 Ga0265319_1031087
741 Ga0265319_1041820
742 Ga0265318_10005350
743 Ga0265336_10001570
744 Ga0265336_10022541
745 Ga0265336_10029650
746 Ga0265338_10016515
747 Ga0265338_10026870
748 Ga0265338_10212468
749 Ga0265338_10213717
750 Ga0265327_10010269
751 Ga0307414_10180782
752 Ga0373926_0076531
753 Ga0373940_0116355
754 Ga0373944_0048220
755 Ga0373951_0035178
756 Ga0373954_0066752
757 Ga0373954_0127199
758 Ga0373956_0097672
759 Ga0373943_0000925
760 Ga0373943_0011428
761 Ga0373946_0039567
762 Ga0373946_0269215
763 Ga0373955_0082248
764 Ga0373924_0058158
765 Ga0373924_0088641
766 Ga0373931_0037715
767 Ga0373935_0014242
768 Ga0373927_0070784
769 Ga0373933_0321189
770 Ga0373947_0002909
771 Ga0373937_0003744
772 Ga0373937_0078910
773 Ga0373937_0184320
774 Ga0373937_0451335
775 Ga0373937_1042662
776 Ga0373925_0002949
777 Ga0395899_0433849
778 Ga0395900_0001510
779 Ga0395900_0006843
780 Ga0395900_0026078
781 Ga0395900_0080499
782 Ga0395898_0003922
783 Ga0395898_0004808
784 Ga0395898_0006939
785 Ga0395898_0058964
786 Ga0395898_0080416
787 Ga0395898_0398081
788 Ga0395905_0001678
789 Ga0395905_0089002
790 Ga0395905_0270122
791 Ga0395905_0359270
792 Ga0395905_0458923
793 Ga0395901_0003395
794 Ga0395901_0004972
795 Ga0395901_0055982
796 Ga0395901_0276910
797 Ga0395901_0667511
798 Ga0395901_0850848
799 Ga0436360_0135256
800 Ga0439453_0007585
801 Ga0451797_0771178
802 Ga0439431_0036060
803 Ga0439433_0003746
804 Ga0439442_004946
805 Ga0439445_0022687
806 Ga0439448_0000320
807 Ga0450900_000091
808 Ga0439446_0017414
809 Ga0439434_0003566
810 Ga0439460_0002740
811 Ga0466969_0041058
812 Ga0466965_0088939
813 Ga0466966_0036173
814 Ga0466963_0001734
815 Ga0466963_0003784
816 Ga0466963_0004956
817 Ga0466963_0009337
818 Ga0466963_0014973
819 Ga0466963_0018403
820 Ga0466963_0088074
821 Ga0466964_0001680
822 Ga0466964_0001976
823 Ga0466964_0022864
824 Ga0466964_0024426
825 Ga0466964_0262963
826 Ga0466971_0004164
827 Ga0466971_0042925
828 Ga0466971_0184332
829 Ga0466968_0001841
830 Ga0466968_0048223
831 Ga0466968_0063899
832 Ga0466970_0261757
833 Ga0466957_0000839
834 Ga0466957_0005089
835 Ga0466957_0005602
836 Ga0466957_0010143
837 Ga0466957_0011876
838 Ga0466957_0014602
839 Ga0466957_0016238
840 Ga0466957_0021347
841 Ga0466957_0186591
842 Ga0466957_0304985
843 Ga0466960_0038468
844 Ga0466959_0002503
845 Ga0466959_0133999
846 Ga0466958_0001766
847 Ga0466958_0004935
848 Ga0466958_0006747
849 Ga0466958_0028945
850 Ga0466958_0036350
851 Ga0466958_0099554
852 Ga0466958_0118946
853 Ga0466958_0220295
854 Ga0466967_0002062
855 Ga0466967_0005328
856 Ga0466967_0005346
857 Ga0466967_0007439
858 Ga0466967_0008127
859 Ga0466967_0018105
860 Ga0466967_0026573
861 Ga0466967_0034363
862 Ga0466967_0034548
863 Ga0466967_0047556
864 Ga0466967_0057450
865 Ga0466967_0088241
866 Ga0466967_0183720
867 Ga0466967_0189422
868 Ga0466967_0219569
869 Ga0466967_0378450
870 Ga0466967_0406344
871 Ga0466967_0551557
872 Ga0495592_0000716
873 Ga0495592_0006583
874 Ga0495592_0046840
875 Ga0495592_0133518
876 Ga0495603_0233814
877 Ga0495629_0019911
878 Ga0495629_0023550
879 Ga0495641_0013879
880 Ga0495641_0132352
881 Ga0495651_0000001
882 Ga0495651_0002853
883 Ga0495651_0102021
884 Ga0495651_0121844
885 Ga0495651_0220658
886 Ga0495651_0405217
887 Ga0495653_0002945
888 Ga0495653_0053390
889 Ga0495653_0059110
890 Ga0495653_0130896
891 Ga0495580_0060943
892 Ga0495580_0070766
893 Ga0495580_0291612
894 Ga0495582_0000805
895 Ga0495639_0002102
896 Ga0495662_0003155
897 Ga0495662_0016626
898 Ga0495662_0133098
899 Ga0495664_0159264
900 Ga0495584_0148316
901 Ga0495594_0239827
902 Ga0495608_0000448
903 Ga0495608_0033438
904 Ga0495608_0038599
905 Ga0495608_0134585
906 Ga0495618_0003288
907 Ga0495618_0036945
908 Ga0495618_0081289
909 Ga0495628_0000500
910 Ga0495628_0007520
911 Ga0495628_0026416
912 Ga0495630_0076741
913 Ga0495630_0137962
914 Ga0495644_0117880
915 Ga0495666_0001439
916 Ga0495666_0041331
917 Ga0495652_0000015
918 Ga0495652_0036455
919 Ga0495652_0109559
920 Ga0495652_0182921
921 Ga0495652_0203086
922 Ga0495652_0292041
923 Ga0495665_0001480
924 Ga0495665_0027373
925 Ga0495640_0016020
926 Ga0495640_0065435
927 Ga0495640_0109285
928 Ga0495586_0002164
929 Ga0495586_0055562
930 Ga0495587_0000036
931 Ga0495587_0094377
932 Ga0495587_0184889
933 Ga0495645_0000039
934 Ga0495645_0026226
935 Ga0495645_0130879
936 Ga0495645_0299006
937 Ga0495667_0030520
938 Ga0495667_0140996
939 Ga0495667_0269835
940 Ga0495656_0044998
941 Ga0495656_0057597
942 Ga0495656_0239729
943 Ga0495634_0005773
944 Ga0495634_0015248
945 Ga0495634_0277853
946 Ga0495611_0157099
947 Ga0495611_0183640
948 Ga0495635_0062502
949 Ga0495659_0060222
950 Ga0495588_0027199
951 Ga0495657_0028255
952 Ga0495657_0057531
953 Ga0495657_0325385
954 Ga0495599_0000055
955 Ga0495599_0000409
956 Ga0495599_0163509
957 Ga0495623_0000445
958 Ga0495623_0181194
959 Ga0495646_0031152
960 Ga0495647_0001179
961 Ga0495658_0004116
962 Ga0495613_0034278
963 Ga0495613_0143402
964 Ga0495613_0204555
965 Ga0495624_0043442
966 Ga0495589_0149701
967 Ga0495589_0202357
968 Ga0495600_0024976
969 Ga0495600_0032611
970 Ga0495600_0090653
971 Ga0495600_0198933
972 Ga0495600_0212976
973 Ga0495581_0013174
974 Ga0495581_0016709
975 Ga0495604_0000004
976 Ga0495604_0099616
977 Ga0495604_0169862
978 Ga0495604_0295555
979 Ga0495604_0344348
980 Ga0495674_0042802
981 Ga0495674_0224375
982 Ga0495676_0004734
983 Ga0495676_0036226
984 Ga0495676_0307846
985 Ga0495680_0013749
986 Ga0495680_0048360
987 Ga0495680_0093782
988 Ga0495680_0197762
989 Ga0495675_0000250
990 Ga0495675_0313430
991 Ga0495675_0353073
992 Ga0495684_0017002
993 Ga0495684_0020148
994 Ga0495684_0020962
995 Ga0495684_0097766
996 Ga0495684_0103387
997 Ga0495684_0219032
998 Ga0495684_0249750
999 Ga0495593_0002267
1000 Ga0495593_0041653
1001 Ga0495602_0000235
1002 Ga0495602_0007762
1003 Ga0495602_0171549
1004 Ga0495602_0239467
1005 Ga0495602_0248059
1006 Ga0495614_0000112
1007 Ga0496100_0012368
1008 Ga0496100_0057261
1009 Ga0496100_0229156
1010 Ga0496100_0351579
1011 Ga0496101_0009414
1012 Ga0496101_0053189
1013 Ga0496101_0149360
1014 Ga0496101_0174367
1015 Ga0496102_0032716
1016 Ga0496102_0049063
1017 Ga0496102_0152466
1018 Ga0496102_0988074
1019 Ga0496103_0066378
1020 Ga0496103_0156432
1021 Ga0496104_0029020
1022 Ga0496104_0156978
1023 Ga0496104_0230292
1024 Ga0496104_0497929
1025 Ga0496105_0017975
1026 Ga0496105_0043165
1027 Ga0496105_0057053
1028 Ga0496105_0251061
1029 Ga0496105_0422377
1030 Ga0496106_0008840
1031 Ga0496106_0030374
1032 Ga0496106_0031770
1033 Ga0496107_0009407
1034 Ga0496107_0059855
1035 Ga0496108_0008091
1036 Ga0496108_0023961
1037 Ga0496108_0031623
1038 Ga0496108_0034350
1039 Ga0496108_0084150
1040 Ga0496108_0198694
1041 Ga0496109_0006728
1042 Ga0496109_0053696
1043 Ga0496109_0107411
1044 Ga0496109_0375630
1045 Ga0496109_0397239
1046 Ga0496110_0038024
1047 Ga0496110_0097343
1048 Ga0496110_0959914
1049 Ga0496111_0002503
1050 Ga0496111_0021414
1051 Ga0496111_0072549
1052 Ga0496111_0355289
1053 Ga0496112_0003774
1054 Ga0496112_0190526
1055 Ga0496112_0472137
1056 Ga0496113_0006507
1057 Ga0496113_0040740
1058 Ga0496114_0023811
1059 Ga0496114_0068218
1060 Ga0496114_0091189
1061 Ga0496114_0163235
1062 Ga0496114_0238248
1063 Ga0496114_0276690
1064 Ga0496114_0530916
1065 Ga0496115_0001171
1066 Ga0496115_0088491
1067 Ga0496115_0096138
1068 Ga0496115_0121200
1069 Ga0496115_0299613
1070 Ga0496115_0588795
1071 Ga0496115_0665444
1072 Ga0501034_0004154
1073 Ga0501042_0014784
1074 Ga0501043_0165008
1075 Ga0501046_0442826
1076 Ga0501047_0099637
1077 Ga0501068_0384778
1078 Ga0501069_0130613
1079 Ga0501072_0015504
1080 Ga0501074_0010895
1081 Ga0501074_0029258
1082 Ga0501079_0369025
1083 Ga0501080_0002096
1084 Ga0501081_0222002
1085 Ga0501081_0662213
1086 Ga0501083_0009464
1087 nmdc:mga05p37_234556_c1
1088 nmdc:mga05p37_368750_c1
1089 nmdc:mga05p37_516388_c1
1090 nmdc:mga09592_513159_c1
1091 nmdc:mga08y16_803005_c1
1092 nmdc:mga0n895_19432_c1
1093 nmdc:mga0n895_20742_c1
1094 nmdc:mga0n895_468911_c1
1095 nmdc:mga0n895_5602_c1
1096 nmdc:mga0rr50_124002_c1
1097 nmdc:mga0rr50_20108_c1
1098 nmdc:mga0rr50_52507_c1
1099 nmdc:mga08x19_163031_c1
1100 nmdc:mga08x19_87079_c1
1101 Ga0495601_0000553
1102 Ga0495601_0010794
1103 Ga0495612_0002155
1104 Ga0495612_0019744
1105 Ga0495612_0031034
1106 Ga0495612_0034904
1107 Ga0495655_0069730
1108 Ga0495595_0005478
1109 Ga0495595_0014414
1110 Ga0495595_0020515
1111 Ga0495595_0039072
1112 Ga0495595_0076530
1113 Ga0495619_0007907
1114 Ga0495619_0085936
1115 Ga0495619_0089025
1116 Ga0495619_0129982
1117 Ga0495619_0141482
1118 Ga0495619_0145665
1119 Ga0495619_0267577
1120 Ga0500566_0295248
1121 Ga0500657_088586
1122 Ga0501082_0098702
1123 Ga0466962_0002540
1124 Ga0530510_0015321

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

55

206

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.9481 12 192
8iiq-assembly1.cif.gz_A msmudgx h109s/e52n double mutant 0.916 12 185
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.9081 8 184
8iie-assembly1.cif.gz_A complex form of msmudgx and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx 0.8987 12 185
8iir-assembly1.cif.gz_A msmudgx h109s/q53a double mutant 0.8984 12 185
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9481 12 192 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9027 12 193 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8909 12 192 3.40.470.10
1ui0A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.853 12 193 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.7621 27 193 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A538JZS6-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9821 1 195 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A538JZS6-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9772 1 195 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-A0A7T9F4L6-F1-model_v4 deleted 0.9763 24 193
AF-A0A7J2NKB8-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9754 20 187 GO:0004844
GO:0006281
GO:0046872
GO:0051539
AF-X1CDQ8-F1-model_v4 Type-4 uracil-DNA glycosylase (EC 3.2.2.27) 0.9731 12 188 GO:0004844
GO:0006281
GO:0046872
GO:0051539

Map