F463910

General Info

Members Datasets Scaffolds Average Seq Length
562 282 1116 253

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001348|Ga0081455_100013488
Length 313
Sequence MRCCSARSLACENHLVSFAVAADSYDRFMGRYSVRLAPSFADFAGVPRASVSRAEDRRNDEGAMRPEGFARARVRVPERDPRAGQDLALGNRVLDVGCGPGALTTELVQRLGPSTVVAVDPSEQFVAAARDRHPGVDVRVAAAEELPFADAEFDATLAQLVVHFMNDPVRGLAEMARVACNGGVVAACVWDHAGGKTPLAPFWDAVHELDPGASDESRMAGGHEGHLTELCTKAGLRDVEETALPVSVEHLTFGDWWEPFTLGVGPAGGYVASLDSARQTQLRERCNERLGAGPFAIESRAWAARGYSRSRAI

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
195 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 10.32
Rhizosphere 88.43
Stem 0
Stem Tuber 0
Unclassified 6.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001348 3300005937 Bacteria 30413
2 Ga0070690_100052613 3300005330 Bacteria 2603
3 Ga0070666_10072687 3300005335 Unclassified 2342
4 Ga0070682_100221044 3300005337 Bacteria 1348
5 Ga0068868_100010633 3300005338 Bacteria 6669
6 Ga0070691_10028429 3300005341 Bacteria 2612
7 Ga0070691_10165032 3300005341 Bacteria 1144
8 Ga0070687_100042816 3300005343 Bacteria 2297
9 Ga0070661_100083261 3300005344 Bacteria 2363
10 Ga0070692_10113578 3300005345 Bacteria 1501
11 Ga0070669_100207083 3300005353 Bacteria 1546
12 Ga0070675_100240570 3300005354 Bacteria 1581
13 Ga0070674_100001900 3300005356 Bacteria 11357
14 Ga0070674_100008677 3300005356 Bacteria 6059
15 Ga0070673_100544680 3300005364 Bacteria 1054
16 Ga0070688_100029478 3300005365 Bacteria 3286
17 Ga0070688_100055829 3300005365 Unclassified 2478
18 Ga0070659_100034767 3300005366 Bacteria 3921
19 Ga0070659_100085240 3300005366 Unclassified 2527
20 Ga0070709_10202573 3300005434 Bacteria 1406
21 Ga0070713_100049167 3300005436 Bacteria 3477
22 Ga0070701_10004608 3300005438 Bacteria 5608
23 Ga0070694_100021031 3300005444 Unclassified 4165
24 Ga0070663_100025878 3300005455 Bacteria 3966
25 Ga0070678_100004123 3300005456 Bacteria 8189
26 Ga0070678_100073762 3300005456 Bacteria 2562
27 Ga0070678_100461418 3300005456 Bacteria 1114
28 Ga0070662_100070613 3300005457 Bacteria 2573
29 Ga0070681_10014490 3300005458 Bacteria 7845
30 Ga0070681_10157834 3300005458 Bacteria 2192
31 Ga0070681_10196898 3300005458 Unclassified 1934
32 Ga0068867_100001250 3300005459 Bacteria 17499
33 Ga0068867_100203654 3300005459 Bacteria 1585
34 Ga0070706_100006568 3300005467 Bacteria 10972
35 Ga0070706_100121488 3300005467 Bacteria 2435
36 Ga0070706_100123234 3300005467 Bacteria 2417
37 Ga0070698_100010791 3300005471 Bacteria 9720
38 Ga0070698_100185943 3300005471 Bacteria 2015
39 Ga0070698_100259983 3300005471 Bacteria 1668
40 Ga0070699_100002316 3300005518 Bacteria 17132
41 Ga0070679_100563793 3300005530 Bacteria 1082
42 Ga0070684_100161899 3300005535 Bacteria 2030
43 Ga0070684_100335611 3300005535 Bacteria 1389
44 Ga0070684_100542766 3300005535 Bacteria 1078
45 Ga0070697_100067010 3300005536 Bacteria 2936
46 Ga0070697_100253350 3300005536 Bacteria 1506
47 Ga0070686_100053943 3300005544 Unclassified 2570
48 Ga0070686_100121578 3300005544 Bacteria 1793
49 Ga0070686_100201768 3300005544 Bacteria 1426
50 Ga0070695_100016191 3300005545 Bacteria 4511
51 Ga0070695_100034522 3300005545 Unclassified 3172
52 Ga0070695_100390372 3300005545 Bacteria 1053
53 Ga0070696_100002047 3300005546 Bacteria 13218
54 Ga0070696_100163650 3300005546 Unclassified 1640
55 Ga0070696_100370640 3300005546 Bacteria 1114
56 Ga0070693_100139817 3300005547 Bacteria 1523
57 Ga0070665_100009478 3300005548 Bacteria 9852
58 Ga0070665_100045409 3300005548 Bacteria 4412
59 Ga0070704_100503600 3300005549 Unclassified 1051
60 Ga0068855_100037829 3300005563 Bacteria 5734
61 Ga0070664_100012075 3300005564 Bacteria 7019
62 Ga0070664_100207890 3300005564 Bacteria 1748
63 Ga0068857_100589455 3300005577 Bacteria 1050
64 Ga0068854_100019584 3300005578 Bacteria 4564
65 Ga0068854_100217001 3300005578 Bacteria 1511
66 Ga0068856_100010139 3300005614 Bacteria 9157
67 Ga0068856_100043626 3300005614 Bacteria 4412
68 Ga0068856_100103352 3300005614 Bacteria 2843
69 Ga0068856_100359102 3300005614 Bacteria 1475
70 Ga0068852_100483023 3300005616 Bacteria 1231
71 Ga0068866_10001584 3300005718 Bacteria 9650
72 Ga0068866_10011042 3300005718 Bacteria 3893
73 Ga0068866_10038633 3300005718 Bacteria 2352
74 Ga0068861_100017448 3300005719 Bacteria 5098
75 Ga0068851_10004639 3300005834 Bacteria 6204
76 Ga0068870_10067997 3300005840 Bacteria 1934
77 Ga0068860_100024483 3300005843 Bacteria 5832
78 Ga0081455_10002471 3300005937 Bacteria 21977
79 Ga0081455_10058421 3300005937 Bacteria 3264
80 Ga0070715_10043299 3300006163 Bacteria 1897
81 Ga0070716_100041122 3300006173 Bacteria 2574
82 Ga0070712_100041205 3300006175 Bacteria 3170
83 Ga0070712_100053299 3300006175 Unclassified 2824
84 Ga0097621_100031986 3300006237 Unclassified 4179
85 Ga0097621_100374946 3300006237 Bacteria 1270
86 Ga0068871_100176237 3300006358 Bacteria 1835
87 Ga0075428_100000605 3300006844 Bacteria 36581
88 Ga0075431_100084047 3300006847 Bacteria 3286
89 Ga0075433_10020253 3300006852 Bacteria 5559
90 Ga0075433_10087259 3300006852 Bacteria 2755
91 Ga0075434_100129247 3300006871 Bacteria 2544
92 Ga0075434_100169228 3300006871 Bacteria 2205
93 Ga0075434_100353041 3300006871 Bacteria 1491
94 Ga0068865_100001383 3300006881 Bacteria 14117
95 Ga0068865_100066737 3300006881 Bacteria 2539
96 Ga0075436_100317916 3300006914 Bacteria 1118
97 Ga0075435_100004907 3300007076 Bacteria 9270
98 Ga0075435_100208385 3300007076 Bacteria 1657
99 Ga0075435_100315401 3300007076 Bacteria 1338
100 Ga0075435_100445085 3300007076 Bacteria 1117
101 Ga0111539_10045988 3300009094 Bacteria 5223
102 Ga0111539_10070924 3300009094 Bacteria 4112
103 Ga0105245_10006850 3300009098 Bacteria 9994
104 Ga0105245_10109436 3300009098 Bacteria 2568
105 Ga0105245_10449172 3300009098 Bacteria 1297
106 Ga0114129_10000929 3300009147 Bacteria 38252
107 Ga0114129_10040750 3300009147 Bacteria 6547
108 Ga0114129_10428037 3300009147 Bacteria 1739
109 Ga0105243_10005614 3300009148 Bacteria 9773
110 Ga0105243_10035522 3300009148 Bacteria 3864
111 Ga0105243_10182549 3300009148 Bacteria 1826
112 Ga0105243_10202604 3300009148 Bacteria 1741
113 Ga0105241_10085677 3300009174 Bacteria 2476
114 Ga0105242_10020006 3300009176 Bacteria 5245
115 Ga0105242_10282137 3300009176 Bacteria 1509
116 Ga0105248_10225899 3300009177 Bacteria 2107
117 Ga0105238_10046555 3300009551 Bacteria 4376
118 Ga0105238_10373446 3300009551 Bacteria 1416
119 Ga0105239_10656685 3300010375 Bacteria 1198
120 Ga0105239_10688537 3300010375 Bacteria 1169
121 Ga0105246_10122068 3300011119 Unclassified 1932
122 Ga0157370_10366512 3300013104 Bacteria 1328
123 Ga0157369_10020223 3300013105 Bacteria 7442
124 Ga0157374_10212477 3300013296 Bacteria 1897
125 Ga0157378_10012688 3300013297 Bacteria 7372
126 Ga0163162_10261896 3300013306 Bacteria 1861
127 Ga0157372_10013152 3300013307 Bacteria 8830
128 Ga0157372_10042596 3300013307 Bacteria 5023
129 Ga0157372_10170135 3300013307 Bacteria 2521
130 Ga0157372_10350620 3300013307 Bacteria 1720
131 Ga0157375_10026621 3300013308 Bacteria 5394
132 Ga0157375_10027860 3300013308 Bacteria 5286
133 Ga0157375_10059165 3300013308 Bacteria 3795
134 Ga0157375_10077488 3300013308 Bacteria 3354
135 Ga0157375_10085928 3300013308 Bacteria 3196
136 Ga0157375_10344611 3300013308 Bacteria 1655
137 Ga0163163_10115757 3300014325 Bacteria 2712
138 Ga0157380_10498217 3300014326 Bacteria 1182
139 Ga0157377_10103111 3300014745 Bacteria 1703
140 Ga0157379_10016232 3300014968 Bacteria 6552
141 Ga0157379_10111031 3300014968 Unclassified 2462
142 Ga0157376_10082002 3300014969 Bacteria 2770
143 Ga0157376_10103001 3300014969 Bacteria 2498
144 Ga0157376_10246437 3300014969 Unclassified 1667
145 Ga0163161_10125794 3300017792 Bacteria 1930
146 Ga0207692_10081178 3300025898 Bacteria 1735
147 Ga0207642_10000996 3300025899 Bacteria 8856
148 Ga0207710_10163370 3300025900 Bacteria 1086
149 Ga0207688_10030760 3300025901 Bacteria 2961
150 Ga0207688_10076841 3300025901 Bacteria 1902
151 Ga0207688_10089472 3300025901 Bacteria 1766
152 Ga0207688_10170627 3300025901 Unclassified 1293
153 Ga0207645_10092788 3300025907 Bacteria 1942
154 Ga0207643_10074066 3300025908 Bacteria 1963
155 Ga0207643_10076368 3300025908 Bacteria 1935
156 Ga0207684_10000136 3300025910 Bacteria 133236
157 Ga0207684_10259143 3300025910 Unclassified 1500
158 Ga0207707_10157657 3300025912 Bacteria 1985
159 Ga0207693_10015127 3300025915 Bacteria 6193
160 Ga0207693_10022087 3300025915 Bacteria 5060
161 Ga0207693_10068432 3300025915 Bacteria 2779
162 Ga0207660_10043989 3300025917 Bacteria 3140
163 Ga0207660_10116295 3300025917 Bacteria 2020
164 Ga0207662_10003110 3300025918 Bacteria 8470
165 Ga0207662_10118313 3300025918 Bacteria 1659
166 Ga0207657_10001010 3300025919 Bacteria 29952
167 Ga0207657_10122214 3300025919 Bacteria 2142
168 Ga0207657_10156214 3300025919 Bacteria 1855
169 Ga0207649_10060697 3300025920 Bacteria 2377
170 Ga0207649_10164801 3300025920 Bacteria 1539
171 Ga0207652_10686543 3300025921 Bacteria 914
172 Ga0207681_10111990 3300025923 Bacteria 1987
173 Ga0207687_10193760 3300025927 Bacteria 1584
174 Ga0207644_10388022 3300025931 Bacteria 1140
175 Ga0207690_10009393 3300025932 Bacteria 5808
176 Ga0207690_10402724 3300025932 Bacteria 1091
177 Ga0207706_10003053 3300025933 Bacteria 16118
178 Ga0207706_10235749 3300025933 Bacteria 1600
179 Ga0207686_10000748 3300025934 Bacteria 20052
180 Ga0207686_10300290 3300025934 Bacteria 1192
181 Ga0207709_10000475 3300025935 Bacteria 36832
182 Ga0207709_10084447 3300025935 Bacteria 2056
183 Ga0207709_10112692 3300025935 Bacteria 1822
184 Ga0207709_10130969 3300025935 Bacteria 1710
185 Ga0207709_10460126 3300025935 Bacteria 985
186 Ga0207670_10037994 3300025936 Bacteria 3141
187 Ga0207665_10048607 3300025939 Bacteria 2848
188 Ga0207691_10014839 3300025940 Bacteria 7426
189 Ga0207691_10035180 3300025940 Bacteria 4653
190 Ga0207691_10273012 3300025940 Bacteria 1456
191 Ga0207711_10074939 3300025941 Bacteria 2944
192 Ga0207689_10039198 3300025942 Bacteria 3922
193 Ga0207689_10054291 3300025942 Bacteria 3300
194 Ga0207661_10010231 3300025944 Bacteria 6745
195 Ga0207661_10166955 3300025944 Bacteria 1913
196 Ga0207679_10408539 3300025945 Bacteria 1196
197 Ga0207667_10222979 3300025949 Bacteria 1931
198 Ga0207651_10123356 3300025960 Bacteria 1969
199 Ga0207640_10217369 3300025981 Bacteria 1461
200 Ga0207658_10006892 3300025986 Bacteria 7735
201 Ga0207677_10044212 3300026023 Unclassified 2965
202 Ga0207677_10604725 3300026023 Unclassified 962
203 Ga0207678_10034547 3300026067 Bacteria 4403
204 Ga0207678_10439771 3300026067 Bacteria 1132
205 Ga0207708_10122915 3300026075 Bacteria 2023
206 Ga0207708_10337299 3300026075 Bacteria 1234
207 Ga0207702_10009611 3300026078 Bacteria 8116
208 Ga0207702_10498561 3300026078 Bacteria 1187
209 Ga0207641_10447839 3300026088 Bacteria 1247
210 Ga0207648_10002594 3300026089 Bacteria 19351
211 Ga0207648_10022186 3300026089 Bacteria 5703
212 Ga0207648_10158760 3300026089 Bacteria 1997
213 Ga0207676_10038585 3300026095 Bacteria 3647
214 Ga0207674_10096367 3300026116 Bacteria 2943
215 Ga0207674_10598349 3300026116 Bacteria 1065
216 Ga0207675_100028603 3300026118 Bacteria 5191
217 Ga0207675_100080743 3300026118 Bacteria 3049
218 Ga0207675_100181202 3300026118 Bacteria 2017
219 Ga0207683_10120234 3300026121 Bacteria 2357
220 Ga0207683_10449285 3300026121 Bacteria 1188
221 Ga0207683_10519380 3300026121 Bacteria 1100
222 Ga0207698_10141993 3300026142 Bacteria 2070
223 Ga0207698_10315561 3300026142 Bacteria 1462
224 Ga0268265_10306604 3300028380 Bacteria 1432
225 Ga0268264_10265903 3300028381 Bacteria 1600
226 Ga0265319_1020275 3300028563 Bacteria 2468
227 Ga0265319_1042157 3300028563 Bacteria 1536
228 Ga0265318_10046220 3300028577 Bacteria 1644
229 Ga0265318_10072220 3300028577 Bacteria 1279
230 Ga0265323_10022679 3300028653 Bacteria 2399
231 Ga0265336_10022978 3300028666 Bacteria 1982
232 Ga0265339_10157350 3300031249 Bacteria 1145
233 Ga0265316_10053334 3300031344 Bacteria 3168
234 Ga0307513_10000198 3300031456 Bacteria 86436
235 Ga0307408_100036817 3300031548 Bacteria 3442
236 Ga0307408_100077155 3300031548 Bacteria 2481
237 Ga0265313_10006517 3300031595 Bacteria 8247
238 Ga0307405_10021066 3300031731 Bacteria 3658
239 Ga0307405_10505136 3300031731 Bacteria 970
240 Ga0307405_10509083 3300031731 Bacteria 966
241 Ga0307413_10078132 3300031824 Bacteria 2110
242 Ga0307410_10006367 3300031852 Bacteria 6368
243 Ga0307410_10130361 3300031852 Bacteria 1846
244 Ga0307406_10009294 3300031901 Bacteria 5507
245 Ga0307406_10021224 3300031901 Bacteria 3838
246 Ga0307407_10077794 3300031903 Bacteria 1996
247 Ga0307412_10009248 3300031911 Bacteria 5649
248 Ga0307412_10191279 3300031911 Bacteria 1547
249 Ga0307409_100072393 3300031995 Bacteria 2744
250 Ga0307409_100139095 3300031995 Bacteria 2089
251 Ga0307409_100912352 3300031995 Bacteria 893
252 Ga0307416_100031353 3300032002 Bacteria 4001
253 Ga0307416_100058013 3300032002 Bacteria 3136
254 Ga0307416_100064011 3300032002 Bacteria 3015
255 Ga0307416_100112321 3300032002 Bacteria 2404
256 Ga0307416_100393704 3300032002 Bacteria 1420
257 Ga0307416_100417879 3300032002 Bacteria 1384
258 Ga0307414_10170313 3300032004 Bacteria 1740
259 Ga0307414_10266732 3300032004 Bacteria 1432
260 Ga0307411_10259858 3300032005 Bacteria 1370
261 Ga0307411_10320285 3300032005 Bacteria 1252
262 Ga0307415_100021927 3300032126 Bacteria 3934
263 Ga0307415_100022290 3300032126 Bacteria 3905
264 Ga0307415_100026011 3300032126 Bacteria 3684
265 Ga0307415_100123730 3300032126 Bacteria 1945
266 Ga0307415_100413078 3300032126 Bacteria 1156
267 Ga0373944_0033171 3300035089 Unclassified 1563
268 Ga0373952_0039839 3300035092 Bacteria 1081
269 Ga0373941_0038597 3300035115 Bacteria 1463
270 Ga0373941_0095900 3300035115 Bacteria 1025
271 Ga0373946_0002532 3300035171 Bacteria 6458
272 Ga0373946_0107797 3300035171 Bacteria 1257
273 Ga0373962_0018740 3300035242 Bacteria 1805
274 Ga0373931_0073570 3300035691 Bacteria 1870
275 Ga0373931_0297711 3300035691 Bacteria 995
276 Ga0373935_0015546 3300035692 Bacteria 4602
277 Ga0373927_0203228 3300035695 Unclassified 1301
278 Ga0373947_0000920 3300035725 Bacteria 17863
279 Ga0373925_0030282 3300037068 Bacteria 3972
280 Ga0395899_0000942 3300037312 Bacteria 27353
281 Ga0395900_0004057 3300037418 Bacteria 15613
282 Ga0395900_0004348 3300037418 Bacteria 15032
283 Ga0395900_0004909 3300037418 Bacteria 14083
284 Ga0395900_0035328 3300037418 Bacteria 5148
285 Ga0395900_0074206 3300037418 Bacteria 3498
286 Ga0395900_0094485 3300037418 Bacteria 3071
287 Ga0395900_0154798 3300037418 Bacteria 2341
288 Ga0395900_0356393 3300037418 Bacteria 1435
289 Ga0395900_0418874 3300037418 Bacteria 1300
290 Ga0395898_0002986 3300037466 Bacteria 19215
291 Ga0395898_0010247 3300037466 Bacteria 9813
292 Ga0395898_0018806 3300037466 Bacteria 7039
293 Ga0395898_0158403 3300037466 Bacteria 2165
294 Ga0395898_0167975 3300037466 Bacteria 2097
295 Ga0395905_0001431 3300037471 Bacteria 28731
296 Ga0395905_0004185 3300037471 Bacteria 15093
297 Ga0395905_0009968 3300037471 Bacteria 9258
298 Ga0395905_0023473 3300037471 Bacteria 5827
299 Ga0395905_0029441 3300037471 Bacteria 5173
300 Ga0395905_0079171 3300037471 Bacteria 3080
301 Ga0436364_0919138 3300037853 Bacteria 7564
302 Ga0395901_0004768 3300038443 Bacteria 13683
303 Ga0395901_0005545 3300038443 Bacteria 12777
304 Ga0395901_0008409 3300038443 Bacteria 10429
305 Ga0395901_0015002 3300038443 Bacteria 7876
306 Ga0395901_0016806 3300038443 Bacteria 7456
307 Ga0395901_0032713 3300038443 Bacteria 5365
308 Ga0395901_0043967 3300038443 Bacteria 4632
309 Ga0395901_0045637 3300038443 Bacteria 4549
310 Ga0395901_0125595 3300038443 Bacteria 2696
311 Ga0395901_0182618 3300038443 Bacteria 2200
312 Ga0395901_0277486 3300038443 Unclassified 1742
313 Ga0439453_0017553 3300041408 Bacteria 1258
314 Ga0439466_0069442 3300041411 Bacteria 1124
315 Ga0451853_1371537 3300041512 Bacteria 1808
316 Ga0451853_3283519 3300041512 Bacteria 2363
317 Ga0439448_0153319 3300042005 Bacteria 800
318 Ga0439460_0117717 3300042461 Bacteria 867
319 Ga0451577_0353217 3300042876 Bacteria 1334
320 Ga0466965_0072242 3300044683 Bacteria 1736
321 Ga0466957_0064596 3300044842 Unclassified 2252
322 Ga0466957_0192732 3300044842 Bacteria 1336
323 Ga0466960_0132395 3300044901 Bacteria 1317
324 Ga0466959_0012081 3300045049 Bacteria 6231
325 Ga0466959_0072276 3300045049 Bacteria 2497
326 Ga0466967_0015382 3300045976 Bacteria 5995
327 Ga0495617_036535 3300046452 Bacteria 1647
328 Ga0495592_0029017 3300046454 Bacteria 4189
329 Ga0495603_0139232 3300046455 Bacteria 1412
330 Ga0495603_0154863 3300046455 Unclassified 1330
331 Ga0495629_0005758 3300046459 Bacteria 9250
332 Ga0495629_0501925 3300046459 Bacteria 818
333 Ga0495641_0001250 3300046461 Bacteria 21835
334 Ga0495651_0025208 3300046462 Bacteria 4628
335 Ga0495651_0131519 3300046462 Bacteria 1826
336 Ga0495651_0331132 3300046462 Unclassified 1012
337 Ga0495653_0056435 3300046463 Bacteria 2994
338 Ga0495653_0113952 3300046463 Bacteria 1938
339 Ga0495582_0000397 3300046473 Bacteria 23729
340 Ga0495582_0011515 3300046473 Bacteria 4875
341 Ga0495582_0023948 3300046473 Bacteria 3338
342 Ga0495605_0076048 3300046474 Bacteria 1578
343 Ga0495639_0012532 3300046475 Bacteria 3657
344 Ga0495662_0001952 3300046476 Bacteria 10356
345 Ga0495662_0119016 3300046476 Bacteria 1296
346 Ga0495584_0072319 3300046491 Bacteria 1733
347 Ga0495585_0117414 3300046492 Bacteria 1410
348 Ga0495594_0023204 3300046499 Bacteria 3323
349 Ga0495594_0086752 3300046499 Unclassified 1751
350 Ga0495607_0170311 3300046501 Bacteria 1100
351 Ga0495608_0020534 3300046511 Bacteria 4541
352 Ga0495608_0073888 3300046511 Bacteria 2222
353 Ga0495620_0033497 3300046515 Bacteria 2332
354 Ga0495628_0075051 3300046516 Bacteria 2633
355 Ga0495630_0009259 3300046517 Bacteria 7081
356 Ga0495630_0013130 3300046517 Bacteria 6022
357 Ga0495630_0240724 3300046517 Unclassified 1383
358 Ga0495631_0066607 3300046518 Bacteria 1558
359 Ga0495644_0085517 3300046523 Bacteria 1189
360 Ga0495663_0042891 3300046525 Bacteria 1380
361 Ga0495665_0000713 3300046531 Bacteria 17149
362 Ga0495640_0018759 3300046533 Bacteria 5120
363 Ga0495640_0169541 3300046533 Bacteria 1395
364 Ga0495598_0000333 3300046537 Bacteria 8405
365 Ga0495609_0037482 3300046538 Bacteria 2187
366 Ga0495621_0076402 3300046539 Bacteria 1242
367 Ga0495645_0109353 3300046543 Bacteria 1957
368 Ga0495645_0143455 3300046543 Bacteria 1664
369 Ga0495667_0025938 3300046559 Bacteria 3947
370 Ga0495667_0079469 3300046559 Bacteria 2132
371 Ga0495667_0085976 3300046559 Bacteria 2040
372 Ga0495656_0029604 3300046615 Bacteria 2205
373 Ga0495656_0084783 3300046615 Bacteria 1438
374 Ga0495656_0125618 3300046615 Bacteria 1216
375 Ga0495656_0160734 3300046615 Bacteria 1092
376 Ga0495634_0034885 3300046642 Bacteria 3449
377 Ga0495635_0043614 3300046663 Bacteria 3095
378 Ga0495635_0054553 3300046663 Bacteria 2753
379 Ga0495635_0105594 3300046663 Bacteria 1924
380 Ga0495659_0002162 3300046664 Bacteria 6404
381 Ga0495588_0035429 3300046674 Bacteria 2529
382 Ga0495588_0086354 3300046674 Bacteria 1641
383 Ga0495588_0091750 3300046674 Bacteria 1592
384 Ga0495646_0126791 3300046680 Bacteria 1440
385 Ga0495647_0007442 3300046681 Bacteria 3668
386 Ga0495647_0049368 3300046681 Bacteria 1630
387 Ga0495647_0094388 3300046681 Unclassified 1231
388 Ga0495658_0003336 3300046683 Bacteria 7963
389 Ga0495658_0085187 3300046683 Bacteria 1862
390 Ga0495613_0003522 3300046689 Bacteria 11722
391 Ga0495624_0007594 3300046690 Bacteria 7612
392 Ga0495670_0014569 3300046691 Bacteria 3866
393 Ga0495670_0207119 3300046691 Bacteria 1040
394 Ga0495589_0008588 3300046794 Bacteria 5325
395 Ga0495600_0019247 3300046809 Bacteria 4358
396 Ga0495581_0003082 3300047315 Bacteria 9531
397 Ga0495581_0010501 3300047315 Bacteria 5352
398 Ga0495674_0049170 3300047319 Bacteria 3727
399 Ga0495674_0259584 3300047319 Bacteria 1428
400 Ga0495674_0373534 3300047319 Unclassified 1154
401 Ga0495676_0006933 3300047321 Bacteria 10407
402 Ga0495676_0039297 3300047321 Bacteria 3920
403 Ga0495680_0001890 3300047322 Bacteria 21976
404 Ga0495680_0010034 3300047322 Bacteria 8471
405 Ga0495680_0017518 3300047322 Bacteria 6113
406 Ga0495680_0029105 3300047322 Bacteria 4525
407 Ga0495684_0002909 3300047471 Bacteria 13482
408 Ga0495684_0029569 3300047471 Bacteria 4206
409 Ga0495593_0063802 3300047673 Unclassified 1923
410 Ga0495602_0152267 3300048088 Bacteria 1816
411 Ga0495614_0002329 3300048089 Bacteria 8449
412 Ga0496100_0043340 3300048903 Bacteria 2877
413 Ga0496100_0114420 3300048903 Bacteria 1879
414 Ga0496101_0007164 3300048904 Bacteria 7211
415 Ga0496101_0018462 3300048904 Bacteria 4743
416 Ga0496101_0040541 3300048904 Bacteria 3316
417 Ga0496101_0125160 3300048904 Bacteria 1947
418 Ga0496102_0038734 3300048905 Bacteria 4304
419 Ga0496102_0053024 3300048905 Bacteria 3697
420 Ga0496102_0176892 3300048905 Bacteria 2010
421 Ga0496102_0218742 3300048905 Bacteria 1795
422 Ga0496103_0132169 3300048906 Bacteria 1594
423 Ga0496104_0016972 3300048907 Bacteria 6623
424 Ga0496104_0082316 3300048907 Bacteria 3069
425 Ga0496104_0157800 3300048907 Bacteria 2177
426 Ga0496104_0175772 3300048907 Bacteria 2052
427 Ga0496104_0581211 3300048907 Unclassified 1031
428 Ga0496105_0013100 3300048908 Bacteria 6576
429 Ga0496105_0068806 3300048908 Bacteria 2925
430 Ga0496105_0081251 3300048908 Bacteria 2677
431 Ga0496105_0479648 3300048908 Bacteria 978
432 Ga0496106_0138204 3300048909 Bacteria 1915
433 Ga0496106_0476423 3300048909 Bacteria 1003
434 Ga0496106_0583807 3300048909 Bacteria 896
435 Ga0496107_0057886 3300048910 Bacteria 2802
436 Ga0496107_0130684 3300048910 Unclassified 1854
437 Ga0496107_0440262 3300048910 Bacteria 969
438 Ga0496108_0018273 3300048911 Bacteria 5741
439 Ga0496108_0106219 3300048911 Bacteria 2397
440 Ga0496109_0012226 3300048912 Bacteria 7406
441 Ga0496109_0017633 3300048912 Bacteria 6261
442 Ga0496109_0019529 3300048912 Bacteria 5979
443 Ga0496109_0041338 3300048912 Bacteria 4176
444 Ga0496109_0157389 3300048912 Bacteria 2128
445 Ga0496109_0200436 3300048912 Bacteria 1876
446 Ga0496109_0629560 3300048912 Bacteria 1009
447 Ga0496110_0070774 3300048913 Bacteria 3091
448 Ga0496110_0213036 3300048913 Bacteria 1756
449 Ga0496110_0521838 3300048913 Bacteria 1080
450 Ga0496111_0007438 3300048914 Bacteria 7178
451 Ga0496111_0035161 3300048914 Bacteria 3579
452 Ga0496111_0083692 3300048914 Bacteria 2331
453 Ga0496111_0128013 3300048914 Bacteria 1878
454 Ga0496111_0423576 3300048914 Bacteria 983
455 Ga0496113_0076238 3300048916 Bacteria 2561
456 Ga0496113_0127938 3300048916 Bacteria 1991
457 Ga0496113_0392475 3300048916 Unclassified 1114
458 Ga0496114_0015831 3300048917 Bacteria 6068
459 Ga0496114_0026052 3300048917 Bacteria 4785
460 Ga0496114_0036293 3300048917 Bacteria 4074
461 Ga0496114_0049363 3300048917 Bacteria 3501
462 Ga0496114_0204281 3300048917 Bacteria 1731
463 Ga0496114_0218899 3300048917 Bacteria 1671
464 Ga0496114_0329130 3300048917 Bacteria 1350
465 Ga0496115_0005261 3300048918 Bacteria 9404
466 Ga0496115_0203381 3300048918 Bacteria 1636
467 Ga0496115_0278373 3300048918 Unclassified 1374
468 Ga0501291_024775 3300049514 Bacteria 978
469 Ga0501031_0000740 3300049568 Bacteria 19598
470 Ga0501032_0056027 3300049569 Bacteria 2651
471 Ga0501033_0047771 3300049570 Bacteria 3182
472 Ga0501036_0018233 3300049572 Bacteria 5878
473 Ga0501038_0035659 3300049574 Bacteria 4367
474 Ga0501038_0143255 3300049574 Bacteria 1953
475 Ga0501038_0235986 3300049574 Bacteria 1454
476 Ga0501039_0002692 3300049575 Bacteria 13259
477 Ga0501039_0053643 3300049575 Unclassified 3120
478 Ga0501039_0114819 3300049575 Bacteria 2107
479 Ga0501040_0002290 3300049576 Bacteria 12301
480 Ga0501041_0002947 3300049577 Bacteria 9757
481 Ga0501041_0083223 3300049577 Bacteria 1972
482 Ga0501042_0000668 3300049578 Bacteria 18449
483 Ga0501042_0071668 3300049578 Bacteria 2479
484 Ga0501043_0062436 3300049579 Bacteria 2925
485 Ga0501046_0012467 3300049580 Bacteria 7236
486 Ga0501048_0002010 3300049582 Bacteria 15453
487 Ga0501048_0097519 3300049582 Bacteria 2074
488 Ga0501048_0396994 3300049582 Bacteria 986
489 Ga0501067_0194410 3300049583 Unclassified 1130
490 Ga0501068_0041251 3300049584 Bacteria 2773
491 Ga0501069_0037508 3300049585 Bacteria 2675
492 Ga0501070_0015940 3300049586 Bacteria 6318
493 Ga0501071_0017981 3300049587 Bacteria 4888
494 Ga0501071_0144406 3300049587 Bacteria 1773
495 Ga0501071_0298306 3300049587 Bacteria 1221
496 Ga0501072_0000221 3300049588 Bacteria 41756
497 Ga0501072_0015467 3300049588 Bacteria 5849
498 Ga0501072_0020397 3300049588 Bacteria 5135
499 Ga0501072_0298496 3300049588 Bacteria 1281
500 Ga0501074_0120735 3300049590 Bacteria 1874
501 Ga0501074_0178321 3300049590 Bacteria 1516
502 Ga0501074_0221548 3300049590 Bacteria 1347
503 Ga0501074_0286788 3300049590 Bacteria 1170
504 Ga0501074_0320705 3300049590 Bacteria 1100
505 Ga0501074_0427444 3300049590 Bacteria 939
506 Ga0501075_0002018 3300049591 Bacteria 13415
507 Ga0501075_0003439 3300049591 Bacteria 10592
508 Ga0501076_0001572 3300049592 Bacteria 15325
509 Ga0501076_0185408 3300049592 Bacteria 1697
510 Ga0501076_0310956 3300049592 Bacteria 1292
511 Ga0501077_0007093 3300049593 Bacteria 6910
512 Ga0501079_0004053 3300049741 Bacteria 10840
513 Ga0501079_0018830 3300049741 Bacteria 5276
514 Ga0501079_0204727 3300049741 Bacteria 1541
515 Ga0501080_0002437 3300049742 Bacteria 16255
516 Ga0501080_0693989 3300049742 Bacteria 898
517 Ga0501081_0001276 3300049743 Bacteria 15307
518 Ga0501083_0017802 3300049744 Bacteria 4957
519 Ga0501035_0020329 3300049822 Bacteria 6096
520 Ga0501035_0190741 3300049822 Bacteria 1762
521 Ga0501035_0656704 3300049822 Bacteria 850
522 Ga0501045_0001352 3300049824 Bacteria 16279
523 Ga0501045_0025808 3300049824 Unclassified 4225
524 Ga0501045_0389419 3300049824 Bacteria 1037
525 nmdc:mga00v17_123443_c1 3300050491 Bacteria 1651
526 nmdc:mga00v17_97030_c1 3300050491 Bacteria 1857
527 nmdc:mga0yw44_101935_c1 3300050492 Bacteria 1829
528 nmdc:mga05p37_13_c1 3300050507 Bacteria 139062
529 nmdc:mga05p37_54989_c1 3300050507 Bacteria 4897
530 nmdc:mga09592_64536_c1 3300050508 Bacteria 3100
531 nmdc:mga08y16_96769_c1 3300050511 Bacteria 3074
532 nmdc:mga0n895_134105_c1 3300050512 Bacteria 2502
533 nmdc:mga0n895_205767_c1 3300050512 Bacteria 1999
534 nmdc:mga0n895_475082_c1 3300050512 Bacteria 1261
535 nmdc:mga0n895_843855_c1 3300050512 Bacteria 904
536 nmdc:mga0rr50_100215_c1 3300050513 Bacteria 2274
537 nmdc:mga0rr50_178317_c1 3300050513 Bacteria 1736
538 nmdc:mga08x19_183956_c1 3300050514 Bacteria 1427
539 nmdc:mga0a205_109486_c1 3300050515 Bacteria 2661
540 nmdc:mga0a205_200364_c1 3300050515 Bacteria 1887
541 nmdc:mga0a205_205896_c1 3300050515 Bacteria 1856
542 nmdc:mga0a205_300736_c1 3300050515 Bacteria 1478
543 Ga0495601_0000286 3300053077 Bacteria 26967
544 Ga0495601_0045987 3300053077 Bacteria 2747
545 Ga0495619_0041763 3300053085 Bacteria 3001
546 Ga0495619_0495383 3300053085 Bacteria 840
547 Ga0501084_0022065 3300054114 Bacteria 5310
548 Ga0501084_0041436 3300054114 Bacteria 3852
549 Ga0501084_0063731 3300054114 Bacteria 3086
550 Ga0501084_0255291 3300054114 Bacteria 1480
551 Ga0501084_0273605 3300054114 Bacteria 1426
552 Ga0501082_0001954 3300060353 Bacteria 18144
553 Ga0501082_0021029 3300060353 Bacteria 5628
554 Ga0501082_0021680 3300060353 Bacteria 5539
555 Ga0501082_0056409 3300060353 Bacteria 3384
556 Ga0501082_0151404 3300060353 Bacteria 2015
557 Ga0530510_0005717 3300061734 Bacteria 8615
558 Ga0530510_0026416 3300061734 Bacteria 4155
559 Ga0081455_10001348
560 Ga0070690_100052613
561 Ga0070666_10072687
562 Ga0070682_100221044
563 Ga0068868_100010633
564 Ga0070691_10028429
565 Ga0070691_10165032
566 Ga0070687_100042816
567 Ga0070661_100083261
568 Ga0070692_10113578
569 Ga0070669_100207083
570 Ga0070675_100240570
571 Ga0070674_100001900
572 Ga0070674_100008677
573 Ga0070673_100544680
574 Ga0070688_100029478
575 Ga0070688_100055829
576 Ga0070659_100034767
577 Ga0070659_100085240
578 Ga0070709_10202573
579 Ga0070713_100049167
580 Ga0070701_10004608
581 Ga0070694_100021031
582 Ga0070663_100025878
583 Ga0070678_100004123
584 Ga0070678_100073762
585 Ga0070678_100461418
586 Ga0070662_100070613
587 Ga0070681_10014490
588 Ga0070681_10157834
589 Ga0070681_10196898
590 Ga0068867_100001250
591 Ga0068867_100203654
592 Ga0070706_100006568
593 Ga0070706_100121488
594 Ga0070706_100123234
595 Ga0070698_100010791
596 Ga0070698_100185943
597 Ga0070698_100259983
598 Ga0070699_100002316
599 Ga0070679_100563793
600 Ga0070684_100161899
601 Ga0070684_100335611
602 Ga0070684_100542766
603 Ga0070697_100067010
604 Ga0070697_100253350
605 Ga0070686_100053943
606 Ga0070686_100121578
607 Ga0070686_100201768
608 Ga0070695_100016191
609 Ga0070695_100034522
610 Ga0070695_100390372
611 Ga0070696_100002047
612 Ga0070696_100163650
613 Ga0070696_100370640
614 Ga0070693_100139817
615 Ga0070665_100009478
616 Ga0070665_100045409
617 Ga0070704_100503600
618 Ga0068855_100037829
619 Ga0070664_100012075
620 Ga0070664_100207890
621 Ga0068857_100589455
622 Ga0068854_100019584
623 Ga0068854_100217001
624 Ga0068856_100010139
625 Ga0068856_100043626
626 Ga0068856_100103352
627 Ga0068856_100359102
628 Ga0068852_100483023
629 Ga0068866_10001584
630 Ga0068866_10011042
631 Ga0068866_10038633
632 Ga0068861_100017448
633 Ga0068851_10004639
634 Ga0068870_10067997
635 Ga0068860_100024483
636 Ga0081455_10002471
637 Ga0081455_10058421
638 Ga0070715_10043299
639 Ga0070716_100041122
640 Ga0070712_100041205
641 Ga0070712_100053299
642 Ga0097621_100031986
643 Ga0097621_100374946
644 Ga0068871_100176237
645 Ga0075428_100000605
646 Ga0075431_100084047
647 Ga0075433_10020253
648 Ga0075433_10087259
649 Ga0075434_100129247
650 Ga0075434_100169228
651 Ga0075434_100353041
652 Ga0068865_100001383
653 Ga0068865_100066737
654 Ga0075436_100317916
655 Ga0075435_100004907
656 Ga0075435_100208385
657 Ga0075435_100315401
658 Ga0075435_100445085
659 Ga0111539_10045988
660 Ga0111539_10070924
661 Ga0105245_10006850
662 Ga0105245_10109436
663 Ga0105245_10449172
664 Ga0114129_10000929
665 Ga0114129_10040750
666 Ga0114129_10428037
667 Ga0105243_10005614
668 Ga0105243_10035522
669 Ga0105243_10182549
670 Ga0105243_10202604
671 Ga0105241_10085677
672 Ga0105242_10020006
673 Ga0105242_10282137
674 Ga0105248_10225899
675 Ga0105238_10046555
676 Ga0105238_10373446
677 Ga0105239_10656685
678 Ga0105239_10688537
679 Ga0105246_10122068
680 Ga0157370_10366512
681 Ga0157369_10020223
682 Ga0157374_10212477
683 Ga0157378_10012688
684 Ga0163162_10261896
685 Ga0157372_10013152
686 Ga0157372_10042596
687 Ga0157372_10170135
688 Ga0157372_10350620
689 Ga0157375_10026621
690 Ga0157375_10027860
691 Ga0157375_10059165
692 Ga0157375_10077488
693 Ga0157375_10085928
694 Ga0157375_10344611
695 Ga0163163_10115757
696 Ga0157380_10498217
697 Ga0157377_10103111
698 Ga0157379_10016232
699 Ga0157379_10111031
700 Ga0157376_10082002
701 Ga0157376_10103001
702 Ga0157376_10246437
703 Ga0163161_10125794
704 Ga0207692_10081178
705 Ga0207642_10000996
706 Ga0207710_10163370
707 Ga0207688_10030760
708 Ga0207688_10076841
709 Ga0207688_10089472
710 Ga0207688_10170627
711 Ga0207645_10092788
712 Ga0207643_10074066
713 Ga0207643_10076368
714 Ga0207684_10000136
715 Ga0207684_10259143
716 Ga0207707_10157657
717 Ga0207693_10015127
718 Ga0207693_10022087
719 Ga0207693_10068432
720 Ga0207660_10043989
721 Ga0207660_10116295
722 Ga0207662_10003110
723 Ga0207662_10118313
724 Ga0207657_10001010
725 Ga0207657_10122214
726 Ga0207657_10156214
727 Ga0207649_10060697
728 Ga0207649_10164801
729 Ga0207652_10686543
730 Ga0207681_10111990
731 Ga0207687_10193760
732 Ga0207644_10388022
733 Ga0207690_10009393
734 Ga0207690_10402724
735 Ga0207706_10003053
736 Ga0207706_10235749
737 Ga0207686_10000748
738 Ga0207686_10300290
739 Ga0207709_10000475
740 Ga0207709_10084447
741 Ga0207709_10112692
742 Ga0207709_10130969
743 Ga0207709_10460126
744 Ga0207670_10037994
745 Ga0207665_10048607
746 Ga0207691_10014839
747 Ga0207691_10035180
748 Ga0207691_10273012
749 Ga0207711_10074939
750 Ga0207689_10039198
751 Ga0207689_10054291
752 Ga0207661_10010231
753 Ga0207661_10166955
754 Ga0207679_10408539
755 Ga0207667_10222979
756 Ga0207651_10123356
757 Ga0207640_10217369
758 Ga0207658_10006892
759 Ga0207677_10044212
760 Ga0207677_10604725
761 Ga0207678_10034547
762 Ga0207678_10439771
763 Ga0207708_10122915
764 Ga0207708_10337299
765 Ga0207702_10009611
766 Ga0207702_10498561
767 Ga0207641_10447839
768 Ga0207648_10002594
769 Ga0207648_10022186
770 Ga0207648_10158760
771 Ga0207676_10038585
772 Ga0207674_10096367
773 Ga0207674_10598349
774 Ga0207675_100028603
775 Ga0207675_100080743
776 Ga0207675_100181202
777 Ga0207683_10120234
778 Ga0207683_10449285
779 Ga0207683_10519380
780 Ga0207698_10141993
781 Ga0207698_10315561
782 Ga0268265_10306604
783 Ga0268264_10265903
784 Ga0265319_1020275
785 Ga0265319_1042157
786 Ga0265318_10046220
787 Ga0265318_10072220
788 Ga0265323_10022679
789 Ga0265336_10022978
790 Ga0265339_10157350
791 Ga0265316_10053334
792 Ga0307513_10000198
793 Ga0307408_100036817
794 Ga0307408_100077155
795 Ga0265313_10006517
796 Ga0307405_10021066
797 Ga0307405_10505136
798 Ga0307405_10509083
799 Ga0307413_10078132
800 Ga0307410_10006367
801 Ga0307410_10130361
802 Ga0307406_10009294
803 Ga0307406_10021224
804 Ga0307407_10077794
805 Ga0307412_10009248
806 Ga0307412_10191279
807 Ga0307409_100072393
808 Ga0307409_100139095
809 Ga0307409_100912352
810 Ga0307416_100031353
811 Ga0307416_100058013
812 Ga0307416_100064011
813 Ga0307416_100112321
814 Ga0307416_100393704
815 Ga0307416_100417879
816 Ga0307414_10170313
817 Ga0307414_10266732
818 Ga0307411_10259858
819 Ga0307411_10320285
820 Ga0307415_100021927
821 Ga0307415_100022290
822 Ga0307415_100026011
823 Ga0307415_100123730
824 Ga0307415_100413078
825 Ga0373944_0033171
826 Ga0373952_0039839
827 Ga0373941_0038597
828 Ga0373941_0095900
829 Ga0373946_0002532
830 Ga0373946_0107797
831 Ga0373962_0018740
832 Ga0373931_0073570
833 Ga0373931_0297711
834 Ga0373935_0015546
835 Ga0373927_0203228
836 Ga0373947_0000920
837 Ga0373925_0030282
838 Ga0395899_0000942
839 Ga0395900_0004057
840 Ga0395900_0004348
841 Ga0395900_0004909
842 Ga0395900_0035328
843 Ga0395900_0074206
844 Ga0395900_0094485
845 Ga0395900_0154798
846 Ga0395900_0356393
847 Ga0395900_0418874
848 Ga0395898_0002986
849 Ga0395898_0010247
850 Ga0395898_0018806
851 Ga0395898_0158403
852 Ga0395898_0167975
853 Ga0395905_0001431
854 Ga0395905_0004185
855 Ga0395905_0009968
856 Ga0395905_0023473
857 Ga0395905_0029441
858 Ga0395905_0079171
859 Ga0436364_0919138
860 Ga0395901_0004768
861 Ga0395901_0005545
862 Ga0395901_0008409
863 Ga0395901_0015002
864 Ga0395901_0016806
865 Ga0395901_0032713
866 Ga0395901_0043967
867 Ga0395901_0045637
868 Ga0395901_0125595
869 Ga0395901_0182618
870 Ga0395901_0277486
871 Ga0439453_0017553
872 Ga0439466_0069442
873 Ga0451853_1371537
874 Ga0451853_3283519
875 Ga0439448_0153319
876 Ga0439460_0117717
877 Ga0451577_0353217
878 Ga0466965_0072242
879 Ga0466957_0064596
880 Ga0466957_0192732
881 Ga0466960_0132395
882 Ga0466959_0012081
883 Ga0466959_0072276
884 Ga0466967_0015382
885 Ga0495617_036535
886 Ga0495592_0029017
887 Ga0495603_0139232
888 Ga0495603_0154863
889 Ga0495629_0005758
890 Ga0495629_0501925
891 Ga0495641_0001250
892 Ga0495651_0025208
893 Ga0495651_0131519
894 Ga0495651_0331132
895 Ga0495653_0056435
896 Ga0495653_0113952
897 Ga0495582_0000397
898 Ga0495582_0011515
899 Ga0495582_0023948
900 Ga0495605_0076048
901 Ga0495639_0012532
902 Ga0495662_0001952
903 Ga0495662_0119016
904 Ga0495584_0072319
905 Ga0495585_0117414
906 Ga0495594_0023204
907 Ga0495594_0086752
908 Ga0495607_0170311
909 Ga0495608_0020534
910 Ga0495608_0073888
911 Ga0495620_0033497
912 Ga0495628_0075051
913 Ga0495630_0009259
914 Ga0495630_0013130
915 Ga0495630_0240724
916 Ga0495631_0066607
917 Ga0495644_0085517
918 Ga0495663_0042891
919 Ga0495665_0000713
920 Ga0495640_0018759
921 Ga0495640_0169541
922 Ga0495598_0000333
923 Ga0495609_0037482
924 Ga0495621_0076402
925 Ga0495645_0109353
926 Ga0495645_0143455
927 Ga0495667_0025938
928 Ga0495667_0079469
929 Ga0495667_0085976
930 Ga0495656_0029604
931 Ga0495656_0084783
932 Ga0495656_0125618
933 Ga0495656_0160734
934 Ga0495634_0034885
935 Ga0495635_0043614
936 Ga0495635_0054553
937 Ga0495635_0105594
938 Ga0495659_0002162
939 Ga0495588_0035429
940 Ga0495588_0086354
941 Ga0495588_0091750
942 Ga0495646_0126791
943 Ga0495647_0007442
944 Ga0495647_0049368
945 Ga0495647_0094388
946 Ga0495658_0003336
947 Ga0495658_0085187
948 Ga0495613_0003522
949 Ga0495624_0007594
950 Ga0495670_0014569
951 Ga0495670_0207119
952 Ga0495589_0008588
953 Ga0495600_0019247
954 Ga0495581_0003082
955 Ga0495581_0010501
956 Ga0495674_0049170
957 Ga0495674_0259584
958 Ga0495674_0373534
959 Ga0495676_0006933
960 Ga0495676_0039297
961 Ga0495680_0001890
962 Ga0495680_0010034
963 Ga0495680_0017518
964 Ga0495680_0029105
965 Ga0495684_0002909
966 Ga0495684_0029569
967 Ga0495593_0063802
968 Ga0495602_0152267
969 Ga0495614_0002329
970 Ga0496100_0043340
971 Ga0496100_0114420
972 Ga0496101_0007164
973 Ga0496101_0018462
974 Ga0496101_0040541
975 Ga0496101_0125160
976 Ga0496102_0038734
977 Ga0496102_0053024
978 Ga0496102_0176892
979 Ga0496102_0218742
980 Ga0496103_0132169
981 Ga0496104_0016972
982 Ga0496104_0082316
983 Ga0496104_0157800
984 Ga0496104_0175772
985 Ga0496104_0581211
986 Ga0496105_0013100
987 Ga0496105_0068806
988 Ga0496105_0081251
989 Ga0496105_0479648
990 Ga0496106_0138204
991 Ga0496106_0476423
992 Ga0496106_0583807
993 Ga0496107_0057886
994 Ga0496107_0130684
995 Ga0496107_0440262
996 Ga0496108_0018273
997 Ga0496108_0106219
998 Ga0496109_0012226
999 Ga0496109_0017633
1000 Ga0496109_0019529
1001 Ga0496109_0041338
1002 Ga0496109_0157389
1003 Ga0496109_0200436
1004 Ga0496109_0629560
1005 Ga0496110_0070774
1006 Ga0496110_0213036
1007 Ga0496110_0521838
1008 Ga0496111_0007438
1009 Ga0496111_0035161
1010 Ga0496111_0083692
1011 Ga0496111_0128013
1012 Ga0496111_0423576
1013 Ga0496113_0076238
1014 Ga0496113_0127938
1015 Ga0496113_0392475
1016 Ga0496114_0015831
1017 Ga0496114_0026052
1018 Ga0496114_0036293
1019 Ga0496114_0049363
1020 Ga0496114_0204281
1021 Ga0496114_0218899
1022 Ga0496114_0329130
1023 Ga0496115_0005261
1024 Ga0496115_0203381
1025 Ga0496115_0278373
1026 Ga0501291_024775
1027 Ga0501031_0000740
1028 Ga0501032_0056027
1029 Ga0501033_0047771
1030 Ga0501036_0018233
1031 Ga0501038_0035659
1032 Ga0501038_0143255
1033 Ga0501038_0235986
1034 Ga0501039_0002692
1035 Ga0501039_0053643
1036 Ga0501039_0114819
1037 Ga0501040_0002290
1038 Ga0501041_0002947
1039 Ga0501041_0083223
1040 Ga0501042_0000668
1041 Ga0501042_0071668
1042 Ga0501043_0062436
1043 Ga0501046_0012467
1044 Ga0501048_0002010
1045 Ga0501048_0097519
1046 Ga0501048_0396994
1047 Ga0501067_0194410
1048 Ga0501068_0041251
1049 Ga0501069_0037508
1050 Ga0501070_0015940
1051 Ga0501071_0017981
1052 Ga0501071_0144406
1053 Ga0501071_0298306
1054 Ga0501072_0000221
1055 Ga0501072_0015467
1056 Ga0501072_0020397
1057 Ga0501072_0298496
1058 Ga0501074_0120735
1059 Ga0501074_0178321
1060 Ga0501074_0221548
1061 Ga0501074_0286788
1062 Ga0501074_0320705
1063 Ga0501074_0427444
1064 Ga0501075_0002018
1065 Ga0501075_0003439
1066 Ga0501076_0001572
1067 Ga0501076_0185408
1068 Ga0501076_0310956
1069 Ga0501077_0007093
1070 Ga0501079_0004053
1071 Ga0501079_0018830
1072 Ga0501079_0204727
1073 Ga0501080_0002437
1074 Ga0501080_0693989
1075 Ga0501081_0001276
1076 Ga0501083_0017802
1077 Ga0501035_0020329
1078 Ga0501035_0190741
1079 Ga0501035_0656704
1080 Ga0501045_0001352
1081 Ga0501045_0025808
1082 Ga0501045_0389419
1083 nmdc:mga00v17_123443_c1
1084 nmdc:mga00v17_97030_c1
1085 nmdc:mga0yw44_101935_c1
1086 nmdc:mga05p37_13_c1
1087 nmdc:mga05p37_54989_c1
1088 nmdc:mga09592_64536_c1
1089 nmdc:mga08y16_96769_c1
1090 nmdc:mga0n895_134105_c1
1091 nmdc:mga0n895_205767_c1
1092 nmdc:mga0n895_475082_c1
1093 nmdc:mga0n895_843855_c1
1094 nmdc:mga0rr50_100215_c1
1095 nmdc:mga0rr50_178317_c1
1096 nmdc:mga08x19_183956_c1
1097 nmdc:mga0a205_109486_c1
1098 nmdc:mga0a205_200364_c1
1099 nmdc:mga0a205_205896_c1
1100 nmdc:mga0a205_300736_c1
1101 Ga0495601_0000286
1102 Ga0495601_0045987
1103 Ga0495619_0041763
1104 Ga0495619_0495383
1105 Ga0501084_0022065
1106 Ga0501084_0041436
1107 Ga0501084_0063731
1108 Ga0501084_0255291
1109 Ga0501084_0273605
1110 Ga0501082_0001954
1111 Ga0501082_0021029
1112 Ga0501082_0021680
1113 Ga0501082_0056409
1114 Ga0501082_0151404
1115 Ga0530510_0005717
1116 Ga0530510_0026416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

94

187

0.94

PF08242

Methyltransf_12

Methyltransferase domain

94

185

0.94

PF13649

Methyltransf_25

Methyltransferase domain

93

183

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

82

193

0.9

PF13847

Methyltransf_31

Methyltransferase domain

88

237

0.87

PF01728

FtsJ

FtsJ-like methyltransferase

80

180

0.78

PF13489

Methyltransf_23

Methyltransferase domain

65

241

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.8263 7 134
6uk5-assembly1.cif.gz_B structure of sam bound cals10, an amino pentose methyltransferase from micromonospora echinaspora involved in calicheamicin biosynthesis 0.8218 15 134
3px2-assembly1.cif.gz_D structure of tylm1 from streptomyces fradiae h123n mutant in complex with sah and dtdp-quip3n 0.8164 1 134
5w7k-assembly2.cif.gz_B crystal structure of oxag 0.7991 8 251
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.7876 7 138
ID Description Score Start End Superfamily
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8858 19 134 3.40.50.150
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8739 34 129 3.40.50.150
af_A8MQH8_165_275_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8682 88 137 3.40.50.150
af_Q54EP8_34_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8623 25 181 3.40.50.150
af_Q54PP5_28_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8565 17 184 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9537 2 252 GO:0008757
GO:0032259
AF-A0A853DKQ2-F1-model_v4 SAM-dependent methyltransferase 0.9464 2 252 GO:0008757
GO:0032259
AF-A0A835Z4S2-F1-model_v4 S-adenosyl-L-methionine-dependent methyltransferase 0.9371 34 135 GO:0008757
GO:0016020
GO:0032259
AF-A0A4V2VD79-F1-model_v4 Methyltransferase family protein 0.9287 2 251 GO:0008757
GO:0032259
AF-A0A2E3TT19-F1-model_v4 SAM-dependent methyltransferase 0.9249 29 124 GO:0008757
GO:0032259

Map