F463863

General Info

Members Datasets Scaffolds Average Seq Length
561 287 555 147

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000940|Ga0495686_0000940_11901_12401
Length 166
Sequence MRTAVVRVDVDPSKQLAPERLDEGMVTLREAAAAIGADVIDTDLGSLPPSRRQVEILIAGDDPDELKSIALQLCTKAFGVIGAAPAVGVLTYVSRGTDDDAHGVLAGLGLRGEVHRRPSSEGGPDGPHWDVVTVTVLKADLERVPESRVHTALEASLNCEVYIVTR

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
6 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
175 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
219 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
237 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
238 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
239 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
285 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.51
Nodule 0.18
Rhizoplane 9.45
Rhizosphere 67.74
Stem 0
Stem Tuber 0
Unclassified 7.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001574 3300001991 Bacteria 3208
2 JGI24750J21931_1014782 3300002070 Bacteria 1052
3 JGI24744J21845_10008416 3300002077 Bacteria 2124
4 JGI24034J26672_10002420 3300002239 Bacteria 2564
5 JGI24742J22300_10004481 3300002244 Bacteria 2287
6 rootH2_10058472 3300003320 Bacteria 1581
7 Ga0055540_1000003 3300003792 Bacteria 428375
8 Ga0070676_10046048 3300005328 Bacteria 2542
9 Ga0070690_100075935 3300005330 Bacteria 2191
10 Ga0070670_100405899 3300005331 Bacteria 1203
11 Ga0070666_10049991 3300005335 Bacteria 2811
12 Ga0070666_10272365 3300005335 Bacteria 1202
13 Ga0070682_100007655 3300005337 Bacteria 6086
14 Ga0070682_100021569 3300005337 Bacteria 3804
15 Ga0068868_100001175 3300005338 Bacteria 17927
16 Ga0070660_100166213 3300005339 Bacteria 1780
17 Ga0070689_100390473 3300005340 Bacteria 1174
18 Ga0070691_10002313 3300005341 Bacteria 8446
19 Ga0070692_10013503 3300005345 Bacteria 3809
20 Ga0070668_100001742 3300005347 Bacteria 15831
21 Ga0070668_100696972 3300005347 Bacteria 895
22 Ga0070669_100028149 3300005353 Bacteria 4046
23 Ga0070669_100032393 3300005353 Bacteria 3775
24 Ga0070669_100085651 3300005353 Bacteria 2353
25 Ga0070671_100113252 3300005355 Bacteria 2279
26 Ga0070674_100000563 3300005356 Bacteria 18666
27 Ga0070674_100198695 3300005356 Bacteria 1547
28 Ga0070688_100003575 3300005365 Bacteria 8016
29 Ga0070659_100611097 3300005366 Bacteria 938
30 Ga0070667_100000073 3300005367 Bacteria 122757
31 Ga0070667_100006165 3300005367 Bacteria 9967
32 Ga0070667_100146250 3300005367 Bacteria 2073
33 Ga0070667_100287258 3300005367 Bacteria 1478
34 Ga0070667_100531753 3300005367 Bacteria 1079
35 Ga0070709_10018035 3300005434 Bacteria 4057
36 Ga0070709_10244056 3300005434 Bacteria 1291
37 Ga0070714_100017948 3300005435 Bacteria 5738
38 Ga0070713_100131026 3300005436 Bacteria 2211
39 Ga0070710_10001265 3300005437 Bacteria 12001
40 Ga0070710_10176050 3300005437 Bacteria 1336
41 Ga0070701_10003417 3300005438 Bacteria 6280
42 Ga0070711_100000861 3300005439 Bacteria 15962
43 Ga0070711_100130607 3300005439 Bacteria 1870
44 Ga0070705_100015195 3300005440 Bacteria 3974
45 Ga0070700_100003148 3300005441 Bacteria 8480
46 Ga0070694_100001137 3300005444 Bacteria 15245
47 Ga0070663_100019883 3300005455 Bacteria 4435
48 Ga0070663_100036058 3300005455 Bacteria 3435
49 Ga0070678_100000818 3300005456 Bacteria 15756
50 Ga0070662_100019824 3300005457 Bacteria 4573
51 Ga0070681_10541060 3300005458 Bacteria 1078
52 Ga0068867_100000117 3300005459 Bacteria 50416
53 Ga0070685_10156766 3300005466 Bacteria 1448
54 Ga0070679_100626071 3300005530 Bacteria 1019
55 Ga0068853_100002723 3300005539 Bacteria 13340
56 Ga0068853_101188734 3300005539 Bacteria 736
57 Ga0070686_100402637 3300005544 Bacteria 1041
58 Ga0070695_100045394 3300005545 Bacteria 2801
59 Ga0070696_100087279 3300005546 Bacteria 2216
60 Ga0070696_100607078 3300005546 Bacteria 883
61 Ga0070693_100122106 3300005547 Bacteria 1617
62 Ga0070693_100431909 3300005547 Bacteria 920
63 Ga0070665_100004662 3300005548 Bacteria 14320
64 Ga0070665_100046080 3300005548 Bacteria 4380
65 Ga0070665_100110655 3300005548 Bacteria 2749
66 Ga0070704_100000959 3300005549 Bacteria 14633
67 Ga0068855_100224325 3300005563 Bacteria 2106
68 Ga0068854_100000583 3300005578 Bacteria 21768
69 Ga0068854_100422176 3300005578 Bacteria 1108
70 Ga0068856_100235067 3300005614 Bacteria 1848
71 Ga0070702_100000286 3300005615 Bacteria 17291
72 Ga0068852_100179484 3300005616 Bacteria 1990
73 Ga0068859_100000223 3300005617 Bacteria 56082
74 Ga0068859_100001965 3300005617 Bacteria 20980
75 Ga0068864_100126471 3300005618 Bacteria 2291
76 Ga0068864_100333412 3300005618 Bacteria 1428
77 Ga0068864_100661076 3300005618 Bacteria 1018
78 Ga0068866_10000573 3300005718 Bacteria 16728
79 Ga0068866_10825311 3300005718 Bacteria 646
80 Ga0068861_100000507 3300005719 Bacteria 22720
81 Ga0068861_100627658 3300005719 Bacteria 990
82 Ga0068863_100000587 3300005841 Bacteria 37032
83 Ga0068863_100013142 3300005841 Bacteria 7991
84 Ga0068858_100004229 3300005842 Bacteria 14135
85 Ga0068858_100009407 3300005842 Bacteria 9325
86 Ga0068858_100669304 3300005842 Bacteria 1009
87 Ga0068860_100000127 3300005843 Bacteria 122766
88 Ga0068860_100003792 3300005843 Bacteria 15553
89 Ga0068862_100000052 3300005844 Bacteria 144622
90 Ga0068862_100006603 3300005844 Bacteria 9619
91 Ga0081455_10016795 3300005937 Bacteria 7042
92 Ga0081455_10228023 3300005937 Bacteria 1377
93 Ga0075365_10042967 3300006038 Bacteria 2957
94 Ga0075365_10068523 3300006038 Bacteria 2384
95 Ga0075365_10101143 3300006038 Bacteria 1974
96 Ga0075368_10051880 3300006042 Bacteria 1631
97 Ga0075363_100009271 3300006048 Bacteria 4623
98 Ga0075363_100012390 3300006048 Bacteria 4110
99 Ga0075363_100014948 3300006048 Bacteria 3806
100 Ga0075363_100033166 3300006048 Bacteria 2687
101 Ga0075363_100085290 3300006048 Bacteria 1732
102 Ga0075363_100106334 3300006048 Bacteria 1557
103 Ga0075363_100190080 3300006048 Bacteria 1171
104 Ga0075363_100289873 3300006048 Bacteria 948
105 Ga0075363_100310056 3300006048 Bacteria 917
106 Ga0075364_10002949 3300006051 Bacteria 9595
107 Ga0075364_10003160 3300006051 Bacteria 9321
108 Ga0075364_10030170 3300006051 Bacteria 3479
109 Ga0075364_10061710 3300006051 Bacteria 2459
110 Ga0075364_10116159 3300006051 Bacteria 1789
111 Ga0075364_10119505 3300006051 Bacteria 1763
112 Ga0075364_10173576 3300006051 Bacteria 1457
113 Ga0075364_10493591 3300006051 Bacteria 837
114 Ga0070715_10014293 3300006163 Bacteria 2937
115 Ga0070716_100015321 3300006173 Bacteria 3938
116 Ga0070716_100046065 3300006173 Bacteria 2452
117 Ga0070716_100269425 3300006173 Bacteria 1169
118 Ga0070712_100002997 3300006175 Bacteria 10452
119 Ga0070712_100690952 3300006175 Bacteria 869
120 Ga0070712_100694520 3300006175 Bacteria 867
121 Ga0075362_10059173 3300006177 Bacteria 1730
122 Ga0075362_10059237 3300006177 Bacteria 1729
123 Ga0075362_10107273 3300006177 Bacteria 1312
124 Ga0075362_10182618 3300006177 Bacteria 1017
125 Ga0075367_10043234 3300006178 Bacteria 2639
126 Ga0075367_10071419 3300006178 Bacteria 2088
127 Ga0075367_10133053 3300006178 Bacteria 1538
128 Ga0075369_10021606 3300006186 Bacteria 2646
129 Ga0075369_10028838 3300006186 Bacteria 2329
130 Ga0075369_10031814 3300006186 Bacteria 2229
131 Ga0075369_10033262 3300006186 Bacteria 2184
132 Ga0075369_10065547 3300006186 Bacteria 1592
133 Ga0075369_10112334 3300006186 Bacteria 1228
134 Ga0075366_10056414 3300006195 Bacteria 2333
135 Ga0075370_10003723 3300006353 Bacteria 7298
136 Ga0075370_10012155 3300006353 Bacteria 4542
137 Ga0075370_10026300 3300006353 Bacteria 3223
138 Ga0075370_10111484 3300006353 Bacteria 1589
139 Ga0075370_10245465 3300006353 Bacteria 1061
140 Ga0075428_100000149 3300006844 Bacteria 63444
141 Ga0075430_100023965 3300006846 Bacteria 5197
142 Ga0075431_100297113 3300006847 Bacteria 1632
143 Ga0075429_100505277 3300006880 Bacteria 1059
144 Ga0068865_100007593 3300006881 Bacteria 6675
145 Ga0068865_100201640 3300006881 Bacteria 1545
146 Ga0097620_100000223 3300006931 Bacteria 56082
147 Ga0097620_100001965 3300006931 Bacteria 20980
148 Ga0099795_10011365 3300007788 Bacteria 2660
149 Ga0105250_10064935 3300009092 Bacteria 1471
150 Ga0105245_10002923 3300009098 Bacteria 15332
151 Ga0105247_10000066 3300009101 Bacteria 121025
152 Ga0105247_10005571 3300009101 Bacteria 7913
153 Ga0114129_10033330 3300009147 Bacteria 7278
154 Ga0114129_11140618 3300009147 Bacteria 974
155 Ga0114129_11747384 3300009147 Bacteria 758
156 Ga0105243_10002003 3300009148 Bacteria 17327
157 Ga0105243_10547029 3300009148 Bacteria 1105
158 Ga0105242_10000979 3300009176 Bacteria 22301
159 Ga0105242_10990595 3300009176 Bacteria 847
160 Ga0105248_10000613 3300009177 Bacteria 40714
161 Ga0105248_11242667 3300009177 Bacteria 842
162 Ga0105237_10009594 3300009545 Bacteria 10364
163 Ga0105237_10020056 3300009545 Bacteria 6901
164 Ga0105237_10223591 3300009545 Bacteria 1883
165 Ga0105238_10116699 3300009551 Bacteria 2649
166 Ga0105238_10163046 3300009551 Bacteria 2205
167 Ga0105249_10000093 3300009553 Bacteria 122840
168 Ga0105249_10001158 3300009553 Bacteria 23315
169 Ga0105249_10138044 3300009553 Bacteria 2335
170 Ga0105239_10026074 3300010375 Bacteria 6435
171 Ga0105239_10051386 3300010375 Bacteria 4519
172 Ga0105239_10743802 3300010375 Bacteria 1122
173 Ga0157371_10064389 3300013102 Bacteria 2598
174 Ga0157369_10262280 3300013105 Bacteria 1802
175 Ga0157374_10372306 3300013296 Bacteria 1422
176 Ga0157378_10002180 3300013297 Bacteria 17360
177 Ga0157378_12397833 3300013297 Bacteria 579
178 Ga0157378_12433133 3300013297 Unclassified 575
179 Ga0163162_10006763 3300013306 Bacteria 11128
180 Ga0163162_10089548 3300013306 Bacteria 3158
181 Ga0163162_10203017 3300013306 Bacteria 2111
182 Ga0163162_12281638 3300013306 Bacteria 622
183 Ga0157372_10007056 3300013307 Bacteria 11968
184 Ga0157375_10000151 3300013308 Bacteria 68008
185 Ga0163163_10012823 3300014325 Bacteria 7649
186 Ga0163163_10037556 3300014325 Bacteria 4713
187 Ga0163163_10088824 3300014325 Bacteria 3102
188 Ga0157380_10008689 3300014326 Bacteria 7259
189 Ga0157377_10180754 3300014745 Bacteria 1326
190 Ga0157379_10006897 3300014968 Bacteria 9822
191 Ga0157379_10050118 3300014968 Bacteria 3727
192 Ga0157376_10072772 3300014969 Bacteria 2925
193 Ga0163161_10002439 3300017792 Bacteria 13286
194 Ga0213874_10026576 3300021377 Bacteria 1640
195 Ga0213876_10000674 3300021384 Bacteria 24320
196 Ga0213876_10011710 3300021384 Bacteria 4681
197 Ga0213876_10013547 3300021384 Bacteria 4327
198 Ga0213876_10165481 3300021384 Bacteria 1177
199 Ga0213875_10023757 3300021388 Bacteria 2926
200 Ga0209051_1000011 3300025303 Bacteria 610828
201 Ga0207692_10016581 3300025898 Bacteria 3267
202 Ga0207642_10002214 3300025899 Bacteria 6030
203 Ga0207710_10000090 3300025900 Bacteria 121405
204 Ga0207710_10009664 3300025900 Bacteria 4053
205 Ga0207688_10000025 3300025901 Bacteria 48564
206 Ga0207680_10072025 3300025903 Bacteria 2144
207 Ga0207680_10298399 3300025903 Bacteria 1123
208 Ga0207685_10003762 3300025905 Bacteria 3745
209 Ga0207699_10006989 3300025906 Bacteria 5497
210 Ga0207645_10240688 3300025907 Bacteria 1195
211 Ga0207707_10454582 3300025912 Bacteria 1096
212 Ga0207671_10007814 3300025914 Bacteria 9198
213 Ga0207671_10019240 3300025914 Bacteria 5225
214 Ga0207671_10225288 3300025914 Bacteria 1470
215 Ga0207693_10000123 3300025915 Bacteria 69311
216 Ga0207663_10009847 3300025916 Bacteria 5059
217 Ga0207663_10954634 3300025916 Bacteria 687
218 Ga0207681_10005438 3300025923 Bacteria 7822
219 Ga0207681_10011516 3300025923 Bacteria 5433
220 Ga0207694_10205682 3300025924 Bacteria 1602
221 Ga0207687_10199505 3300025927 Bacteria 1563
222 Ga0207700_10282393 3300025928 Bacteria 1428
223 Ga0207664_10184127 3300025929 Bacteria 1794
224 Ga0207644_10055312 3300025931 Bacteria 2860
225 Ga0207644_10059568 3300025931 Bacteria 2761
226 Ga0207644_10113368 3300025931 Bacteria 2053
227 Ga0207690_10091240 3300025932 Bacteria 2153
228 Ga0207706_10005323 3300025933 Bacteria 11997
229 Ga0207686_10001243 3300025934 Bacteria 14738
230 Ga0207709_10021107 3300025935 Bacteria 3683
231 Ga0207669_10000400 3300025937 Bacteria 19143
232 Ga0207704_10000325 3300025938 Bacteria 22184
233 Ga0207665_10008251 3300025939 Bacteria 6875
234 Ga0207665_10082774 3300025939 Bacteria 2212
235 Ga0207665_10453959 3300025939 Bacteria 984
236 Ga0207711_10000183 3300025941 Bacteria 67270
237 Ga0207667_10318000 3300025949 Bacteria 1590
238 Ga0207712_10000073 3300025961 Bacteria 123046
239 Ga0207712_10006113 3300025961 Bacteria 7597
240 Ga0207712_10616414 3300025961 Bacteria 940
241 Ga0207640_10000582 3300025981 Bacteria 21781
242 Ga0207640_10867911 3300025981 Bacteria 786
243 Ga0207658_10000304 3300025986 Bacteria 50815
244 Ga0207658_10003640 3300025986 Bacteria 10879
245 Ga0207658_10007427 3300025986 Bacteria 7475
246 Ga0207658_10042565 3300025986 Bacteria 3295
247 Ga0207658_10289095 3300025986 Bacteria 1408
248 Ga0207658_10382148 3300025986 Bacteria 1233
249 Ga0207677_10009499 3300026023 Bacteria 5475
250 Ga0207703_10005075 3300026035 Bacteria 10656
251 Ga0207703_10010298 3300026035 Bacteria 7323
252 Ga0207678_10006722 3300026067 Bacteria 10198
253 Ga0207678_10029559 3300026067 Bacteria 4783
254 Ga0207708_10000452 3300026075 Bacteria 31890
255 Ga0207708_10361553 3300026075 Bacteria 1193
256 Ga0207702_10618438 3300026078 Bacteria 1064
257 Ga0207641_10000413 3300026088 Bacteria 49861
258 Ga0207641_10008652 3300026088 Bacteria 8404
259 Ga0207648_10000381 3300026089 Bacteria 48976
260 Ga0207676_10269958 3300026095 Bacteria 1540
261 Ga0207676_10271194 3300026095 Bacteria 1537
262 Ga0207675_100000406 3300026118 Bacteria 41422
263 Ga0207675_101186887 3300026118 Bacteria 783
264 Ga0207683_10001482 3300026121 Bacteria 21160
265 Ga0207683_10618513 3300026121 Bacteria 1003
266 Ga0207698_10587445 3300026142 Bacteria 1096
267 Ga0268266_10007258 3300028379 Bacteria 10020
268 Ga0268266_10061743 3300028379 Bacteria 3232
269 Ga0268266_10087000 3300028379 Bacteria 2733
270 Ga0268265_10000063 3300028380 Bacteria 144643
271 Ga0268265_10011038 3300028380 Bacteria 6101
272 Ga0268265_10036750 3300028380 Bacteria 3589
273 Ga0268264_10000007 3300028381 Bacteria 815790
274 Ga0268264_10009176 3300028381 Bacteria 8195
275 Ga0307511_10193734 3300030521 Bacteria 1069
276 Ga0265327_10001674 3300031251 Bacteria 26619
277 Ga0307405_10388196 3300031731 Bacteria 1089
278 Ga0307410_10102661 3300031852 Bacteria 2052
279 Ga0307410_10150343 3300031852 Bacteria 1733
280 Ga0307409_100209857 3300031995 Bacteria 1749
281 Ga0307409_100885158 3300031995 Bacteria 906
282 Ga0307409_100895520 3300031995 Bacteria 901
283 Ga0307409_101311706 3300031995 Bacteria 749
284 Ga0307416_100030887 3300032002 Bacteria 4026
285 Ga0307415_100515876 3300032126 Bacteria 1048
286 Ga0373960_0097009 3300035121 Bacteria 950
287 Ga0373943_0147883 3300035170 Bacteria 1271
288 Ga0373931_0031120 3300035691 Bacteria 2752
289 Ga0373931_0345922 3300035691 Bacteria 930
290 Ga0373927_0446391 3300035695 Bacteria 854
291 Ga0316584_0038500 3300036712 Bacteria 3557
292 Ga0373925_0697568 3300037068 Bacteria 837
293 Ga0436364_0448603 3300037853 Bacteria 3112
294 Ga0436364_1184081 3300037853 Bacteria 5385
295 Ga0436365_0016980 3300039437 Bacteria 29756
296 Ga0436365_0119240 3300039437 Bacteria 17758
297 Ga0436365_0347716 3300039437 Bacteria 1774
298 Ga0436365_0731445 3300039437 Bacteria 19835
299 Ga0436365_1212976 3300039437 Bacteria 1446
300 Ga0436365_1664352 3300039437 Bacteria 3811
301 Ga0436360_0492879 3300039438 Bacteria 588
302 Ga0436361_0751346 3300039447 Bacteria 637
303 Ga0436363_0746391 3300039450 Bacteria 718
304 Ga0436363_1397604 3300039450 Bacteria 5061
305 Ga0436363_1576561 3300039450 Bacteria 1022
306 Ga0436362_1020382 3300039453 Bacteria 564
307 Ga0436362_1084299 3300039453 Bacteria 772
308 Ga0439466_0046181 3300041411 Bacteria 1439
309 Ga0439466_0074647 3300041411 Bacteria 1075
310 Ga0439465_0001090 3300041413 Bacteria 8696
311 Ga0439465_0007860 3300041413 Bacteria 3379
312 Ga0439465_0016208 3300041413 Bacteria 2324
313 Ga0451789_0556179 3300041443 Bacteria 802
314 Ga0451793_1520913 3300041452 Bacteria 667
315 Ga0451802_0501702 3300041460 Bacteria 918
316 Ga0451839_0495621 3300041496 Bacteria 867
317 Ga0451851_1183602 3300041507 Bacteria 828
318 Ga0439442_077698 3300042002 Bacteria 709
319 Ga0439445_0014459 3300042004 Bacteria 1922
320 Ga0439448_0015051 3300042005 Bacteria 2340
321 Ga0450906_076488 3300042145 Bacteria 602
322 Ga0439434_0030541 3300042435 Bacteria 1636
323 Ga0466972_0034477 3300044658 Bacteria 2479
324 Ga0466972_0068577 3300044658 Bacteria 1694
325 Ga0466972_0309961 3300044658 Bacteria 737
326 Ga0466965_0002055 3300044683 Bacteria 8431
327 Ga0466965_0002997 3300044683 Bacteria 7329
328 Ga0466965_0203888 3300044683 Bacteria 1050
329 Ga0466965_0281658 3300044683 Bacteria 898
330 Ga0466965_0357703 3300044683 Bacteria 801
331 Ga0466961_0010397 3300044693 Bacteria 5939
332 Ga0466961_0042451 3300044693 Bacteria 2915
333 Ga0466963_0140783 3300044694 Bacteria 1671
334 Ga0466963_0626646 3300044694 Bacteria 759
335 Ga0466968_0001326 3300044735 Bacteria 8858
336 Ga0466968_0277801 3300044735 Bacteria 801
337 Ga0466970_0017334 3300044765 Bacteria 3721
338 Ga0466970_0122508 3300044765 Bacteria 1425
339 Ga0466957_0005427 3300044842 Bacteria 7159
340 Ga0466957_0007638 3300044842 Bacteria 6115
341 Ga0466957_0032729 3300044842 Bacteria 3115
342 Ga0466957_0223482 3300044842 Bacteria 1244
343 Ga0466957_0257922 3300044842 Bacteria 1161
344 Ga0466957_0419629 3300044842 Bacteria 918
345 Ga0466960_0000320 3300044901 Bacteria 16474
346 Ga0466960_0001519 3300044901 Bacteria 8452
347 Ga0466960_0001941 3300044901 Bacteria 7645
348 Ga0466960_0450449 3300044901 Bacteria 748
349 Ga0466960_0587416 3300044901 Bacteria 660
350 Ga0466960_0590682 3300044901 Bacteria 658
351 Ga0466959_0001756 3300045049 Bacteria 13505
352 Ga0466959_0536802 3300045049 Bacteria 789
353 Ga0466959_0731807 3300045049 Bacteria 662
354 Ga0466958_0073149 3300045836 Bacteria 2100
355 Ga0466958_0102303 3300045836 Bacteria 1782
356 Ga0466958_0129948 3300045836 Bacteria 1581
357 Ga0466958_0257798 3300045836 Bacteria 1116
358 Ga0466958_0617525 3300045836 Bacteria 705
359 Ga0466967_0002447 3300045976 Bacteria 11559
360 Ga0466967_0002855 3300045976 Bacteria 10973
361 Ga0466967_0005640 3300045976 Bacteria 8712
362 Ga0466967_0015951 3300045976 Bacteria 5907
363 Ga0466967_0042813 3300045976 Bacteria 3916
364 Ga0466967_0129856 3300045976 Bacteria 2338
365 Ga0466967_0307239 3300045976 Bacteria 1527
366 Ga0466967_0616038 3300045976 Bacteria 1072
367 Ga0466967_0889842 3300045976 Bacteria 885
368 Ga0466967_1400377 3300045976 Bacteria 696
369 Ga0466967_1455805 3300045976 Bacteria 682
370 Ga0466967_2174205 3300045976 Bacteria 551
371 Ga0495629_0039368 3300046459 Bacteria 3327
372 Ga0495638_0002780 3300046460 Bacteria 14050
373 Ga0495641_0013995 3300046461 Bacteria 4367
374 Ga0495650_0144127 3300046471 Bacteria 860
375 Ga0495606_0065956 3300046507 Bacteria 2298
376 Ga0495616_0192408 3300046513 Bacteria 901
377 Ga0495665_0080424 3300046531 Bacteria 1714
378 Ga0495640_0015166 3300046533 Bacteria 5803
379 Ga0495667_0392075 3300046559 Bacteria 875
380 Ga0495668_0155376 3300046616 Bacteria 1253
381 Ga0495625_0147894 3300046660 Bacteria 1581
382 Ga0495658_0012503 3300046683 Bacteria 4304
383 Ga0495671_0076765 3300046692 Bacteria 1638
384 Ga0495672_0103539 3300047320 Bacteria 1540
385 Ga0495676_0356819 3300047321 Bacteria 976
386 Ga0495686_0000940 3300047472 Bacteria 36165
387 Ga0495686_0164803 3300047472 Bacteria 1292
388 Ga0495593_0006029 3300047673 Bacteria 7131
389 Ga0495614_0066438 3300048089 Bacteria 1551
390 Ga0495626_0039009 3300048091 Bacteria 2249
391 Ga0496100_0001254 3300048903 Bacteria 12378
392 Ga0496100_0006694 3300048903 Bacteria 6305
393 Ga0496100_0079741 3300048903 Bacteria 2207
394 Ga0496100_0233972 3300048903 Bacteria 1353
395 Ga0496100_1317915 3300048903 Bacteria 570
396 Ga0496101_0035226 3300048904 Bacteria 3539
397 Ga0496101_0045273 3300048904 Bacteria 3151
398 Ga0496101_0049531 3300048904 Bacteria 3022
399 Ga0496101_0175593 3300048904 Bacteria 1648
400 Ga0496101_0398029 3300048904 Bacteria 1084
401 Ga0496102_0000168 3300048905 Bacteria 88511
402 Ga0496102_0002086 3300048905 Bacteria 17193
403 Ga0496102_0019989 3300048905 Bacteria 5908
404 Ga0496102_0057771 3300048905 Bacteria 3544
405 Ga0496102_0709530 3300048905 Bacteria 929
406 Ga0496102_1406995 3300048905 Bacteria 616
407 Ga0496103_0000991 3300048906 Bacteria 20033
408 Ga0496103_0031558 3300048906 Bacteria 3228
409 Ga0496103_0045239 3300048906 Bacteria 2716
410 Ga0496103_0084642 3300048906 Bacteria 1998
411 Ga0496103_0207235 3300048906 Bacteria 1261
412 Ga0496104_0012733 3300048907 Bacteria 7577
413 Ga0496105_0047005 3300048908 Bacteria 3562
414 Ga0496106_0001129 3300048909 Bacteria 19754
415 Ga0496106_0545886 3300048909 Bacteria 930
416 Ga0496107_0000495 3300048910 Bacteria 21738
417 Ga0496107_0015409 3300048910 Bacteria 5357
418 Ga0496108_0022268 3300048911 Bacteria 5211
419 Ga0496108_0485719 3300048911 Bacteria 1079
420 Ga0496108_1003628 3300048911 Bacteria 713
421 Ga0496109_0032986 3300048912 Bacteria 4658
422 Ga0496109_0176908 3300048912 Bacteria 2003
423 Ga0496109_0285433 3300048912 Bacteria 1556
424 Ga0496110_0019813 3300048913 Bacteria 5669
425 Ga0496110_0029838 3300048913 Bacteria 4699
426 Ga0496112_0010535 3300048915 Bacteria 8394
427 Ga0496112_0043922 3300048915 Bacteria 4376
428 Ga0496112_0355356 3300048915 Bacteria 1407
429 Ga0496112_0625299 3300048915 Bacteria 1008
430 Ga0496113_0005415 3300048916 Bacteria 7956
431 Ga0496113_0337388 3300048916 Bacteria 1209
432 Ga0496113_0414811 3300048916 Bacteria 1081
433 Ga0496113_0420966 3300048916 Bacteria 1073
434 Ga0496114_0000419 3300048917 Bacteria 31425
435 Ga0496114_0597929 3300048917 Bacteria 973
436 Ga0496114_0636767 3300048917 Bacteria 939
437 Ga0496114_1136240 3300048917 Bacteria 666
438 Ga0496115_0090795 3300048918 Bacteria 2495
439 Ga0496115_0146957 3300048918 Bacteria 1946
440 Ga0496115_0751539 3300048918 Bacteria 762
441 Ga0496116_0015907 3300048919 Bacteria 5918
442 Ga0496117_0008185 3300048920 Bacteria 9978
443 Ga0496118_0000171 3300048921 Bacteria 117495
444 Ga0496119_0003283 3300048922 Bacteria 16913
445 Ga0496120_0017049 3300048923 Bacteria 4723
446 Ga0496120_0073458 3300048923 Bacteria 1872
447 Ga0496120_0323768 3300048923 Bacteria 699
448 Ga0496121_0013914 3300048924 Bacteria 8599
449 Ga0496122_0057779 3300048925 Bacteria 2877
450 Ga0496123_0062741 3300048926 Bacteria 2378
451 Ga0496124_0072339 3300048927 Bacteria 2855
452 Ga0496125_0121012 3300048928 Bacteria 1867
453 Ga0496125_0474678 3300048928 Bacteria 710
454 Ga0496126_0004133 3300048929 Bacteria 17554
455 Ga0496126_0032421 3300048929 Bacteria 4922
456 Ga0496126_0589400 3300048929 Bacteria 877
457 Ga0501032_0000510 3300049569 Bacteria 31534
458 Ga0501032_0202148 3300049569 Bacteria 1296
459 Ga0501032_0461352 3300049569 Bacteria 813
460 Ga0501033_0006101 3300049570 Bacteria 9453
461 Ga0501033_0052419 3300049570 Bacteria 3024
462 Ga0501033_0452714 3300049570 Bacteria 891
463 Ga0501034_0001987 3300049571 Bacteria 25894
464 Ga0501034_0005475 3300049571 Bacteria 13863
465 Ga0501034_0130096 3300049571 Bacteria 2501
466 Ga0501034_0163709 3300049571 Bacteria 2194
467 Ga0501034_0855028 3300049571 Bacteria 800
468 Ga0501036_0002002 3300049572 Bacteria 15830
469 Ga0501036_0356474 3300049572 Bacteria 1221
470 Ga0501037_0000677 3300049573 Bacteria 26104
471 Ga0501037_0028731 3300049573 Bacteria 4108
472 Ga0501037_0073325 3300049573 Bacteria 2489
473 Ga0501038_0001664 3300049574 Bacteria 20619
474 Ga0501038_0791088 3300049574 Bacteria 705
475 Ga0501039_0000157 3300049575 Bacteria 46924
476 Ga0501043_0000971 3300049579 Bacteria 25346
477 Ga0501043_0015753 3300049579 Bacteria 5927
478 Ga0501046_0004078 3300049580 Bacteria 13317
479 Ga0501047_0001180 3300049581 Bacteria 25903
480 Ga0501047_0107234 3300049581 Bacteria 2675
481 Ga0501047_0172077 3300049581 Bacteria 2034
482 Ga0501047_0228914 3300049581 Bacteria 1713
483 Ga0501048_0003008 3300049582 Bacteria 12870
484 Ga0501067_0083526 3300049583 Bacteria 1772
485 Ga0501069_0432167 3300049585 Bacteria 781
486 Ga0501070_0001412 3300049586 Bacteria 21509
487 Ga0501070_0001918 3300049586 Bacteria 18362
488 Ga0501073_0027278 3300049589 Bacteria 4086
489 Ga0501073_0334497 3300049589 Bacteria 1045
490 Ga0501077_0158860 3300049593 Bacteria 1435
491 Ga0501079_0646871 3300049741 Bacteria 832
492 Ga0501080_0155597 3300049742 Bacteria 2112
493 Ga0501080_0692911 3300049742 Bacteria 899
494 Ga0501083_0232171 3300049744 Bacteria 1201
495 Ga0501035_0000385 3300049822 Bacteria 50730
496 Ga0501035_0003413 3300049822 Bacteria 15199
497 Ga0501035_0466896 3300049822 Bacteria 1042
498 Ga0501035_1262363 3300049822 Bacteria 571
499 Ga0501044_0001111 3300049823 Bacteria 31958
500 Ga0501044_0018055 3300049823 Bacteria 7565
501 Ga0501044_0403055 3300049823 Bacteria 1280
502 nmdc:mga03683_224189_c1 3300050489 Bacteria 868
503 nmdc:mga03683_71799_c1 3300050489 Bacteria 1481
504 nmdc:mga03n38_148924_c1 3300050490 Bacteria 1176
505 nmdc:mga03n38_1616_c1 3300050490 Bacteria 6579
506 nmdc:mga03n38_20054_c1 3300050490 Bacteria 2668
507 nmdc:mga03n38_235480_c1 3300050490 Bacteria 961
508 nmdc:mga03n38_294965_c1 3300050490 Bacteria 869
509 nmdc:mga03n38_59612_c1 3300050490 Bacteria 1733
510 nmdc:mga03n38_8154_c1 3300050490 Bacteria 3744
511 nmdc:mga00v17_1224_c1 3300050491 Bacteria 13469
512 nmdc:mga00v17_17049_c1 3300050491 Bacteria 4102
513 nmdc:mga00v17_24459_c1 3300050491 Bacteria 3505
514 nmdc:mga00v17_417445_c1 3300050491 Bacteria 872
515 nmdc:mga00v17_5015_c1 3300050491 Bacteria 6949
516 nmdc:mga00v17_512928_c1 3300050491 Bacteria 777
517 nmdc:mga0yw44_141802_c1 3300050492 Bacteria 1562
518 nmdc:mga0yw44_182206_c1 3300050492 Bacteria 1383
519 nmdc:mga0yw44_185616_c1 3300050492 Bacteria 1370
520 nmdc:mga0yw44_5588_c1 3300050492 Bacteria 5969
521 nmdc:mga0yw44_93741_c1 3300050492 Bacteria 1902
522 nmdc:mga0k408_43381_c1 3300050493 Bacteria 1583
523 nmdc:mga0k408_64805_c1 3300050493 Bacteria 2126
524 nmdc:mga06z11_126411_c1 3300050494 Bacteria 1431
525 nmdc:mga06z11_146969_c1 3300050494 Bacteria 1337
526 nmdc:mga06z11_85528_c1 3300050494 Bacteria 1701
527 nmdc:mga07m45_120289_c1 3300050496 Bacteria 1516
528 nmdc:mga07m45_147909_c1 3300050496 Bacteria 1362
529 nmdc:mga07m45_1850_c1 3300050496 Bacteria 9775
530 nmdc:mga07m45_2352_c1 3300050496 Bacteria 8878
531 nmdc:mga07m45_3834_c1 3300050496 Bacteria 7283
532 nmdc:mga07m45_95942_c1 3300050496 Bacteria 1701
533 nmdc:mga05p37_7689_c2 3300050507 Bacteria 4594
534 nmdc:mga09592_484911_c1 3300050508 Bacteria 1065
535 nmdc:mga0qj67_19203_c1 3300050509 Bacteria 5220
536 nmdc:mga06r32_290070_c1 3300050510 Bacteria 1623
537 nmdc:mga0sz30_120382_c1 3300050516 Bacteria 1153
538 nmdc:mga0sz30_1490_c2 3300050516 Bacteria 5861
539 nmdc:mga0sz30_154032_c1 3300050516 Bacteria 1017
540 nmdc:mga0sz30_1947_c1 3300050516 Bacteria 7377
541 nmdc:mga0sz30_2087_c1 3300050516 Bacteria 7140
542 nmdc:mga0sz30_50598_c2 3300050516 Bacteria 1345
543 nmdc:mga0sz30_6350_c1 3300050516 Bacteria 4387
544 Ga0495655_0058769 3300053083 Bacteria 1042
545 Ga0495619_0037475 3300053085 Bacteria 3160
546 Ga0500643_002159 3300053087 Bacteria 10421
547 Ga0500556_0124169 3300053104 Bacteria 1008
548 Ga0500562_002482 3300053108 Bacteria 4616
549 Ga0500562_042103 3300053108 Bacteria 1215
550 Ga0500604_0145528 3300053151 Bacteria 803
551 Ga0500616_0012932 3300053153 Bacteria 4864
552 Ga0500616_0037591 3300053153 Bacteria 2620
553 Ga0501082_0496159 3300060353 Bacteria 1067
554 Ga0466962_0013630 3300061719 Bacteria 3913
555 Ga0466962_0197329 3300061719 Bacteria 983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002070 JGI24750J21931_1014782 JGI24750J21931_10147822 117
2 3300002077 JGI24744J21845_10008416 JGI24744J21845_100084162 117
3 3300002239 JGI24034J26672_10002420 JGI24034J26672_100024202 117
4 3300002244 JGI24742J22300_10004481 JGI24742J22300_100044812 117
5 3300005328 Ga0070676_10046048 Ga0070676_100460483 117
6 3300005330 Ga0070690_100075935 Ga0070690_1000759352 117
7 3300005335 Ga0070666_10049991 Ga0070666_100499912 117
8 3300005337 Ga0070682_100021569 Ga0070682_1000215694 117
9 3300005338 Ga0068868_100001175 Ga0068868_1000011756 117
10 3300005339 Ga0070660_100166213 Ga0070660_1001662132 117
11 3300005340 Ga0070689_100390473 Ga0070689_1003904732 117
12 3300005341 Ga0070691_10002313 Ga0070691_100023134 117
13 3300005345 Ga0070692_10013503 Ga0070692_100135033 117
14 3300005347 Ga0070668_100001742 Ga0070668_1000017427 117
15 3300005353 Ga0070669_100028149 Ga0070669_1000281492 117
16 3300005356 Ga0070674_100000563 Ga0070674_10000056310 117
17 3300005365 Ga0070688_100003575 Ga0070688_1000035758 117
18 3300005366 Ga0070659_100611097 Ga0070659_1006110972 117
19 3300005367 Ga0070667_100006165 Ga0070667_1000061657 117
20 3300005438 Ga0070701_10003417 Ga0070701_100034172 117
21 3300005439 Ga0070711_100000861 Ga0070711_10000086112 117
22 3300005440 Ga0070705_100015195 Ga0070705_1000151953 117
23 3300005441 Ga0070700_100003148 Ga0070700_10000314810 117
24 3300005444 Ga0070694_100001137 Ga0070694_1000011375 117
25 3300005456 Ga0070678_100000818 Ga0070678_10000081816 117
26 3300005457 Ga0070662_100019824 Ga0070662_1000198242 117
27 3300005458 Ga0070681_10541060 Ga0070681_105410602 117
28 3300005459 Ga0068867_100000117 Ga0068867_10000011738 117
29 3300005466 Ga0070685_10156766 Ga0070685_101567662 117
30 3300005530 Ga0070679_100626071 Ga0070679_1006260711 117
31 3300005539 Ga0068853_100002723 Ga0068853_10000272312 117
32 3300005545 Ga0070695_100045394 Ga0070695_1000453943 117
33 3300005546 Ga0070696_100087279 Ga0070696_1000872792 117
34 3300005547 Ga0070693_100122106 Ga0070693_1001221062 117
35 3300005549 Ga0070704_100000959 Ga0070704_10000095910 117
36 3300005563 Ga0068855_100224325 Ga0068855_1002243252 117
37 3300005578 Ga0068854_100000583 Ga0068854_10000058324 117
38 3300005614 Ga0068856_100235067 Ga0068856_1002350672 117
39 3300005615 Ga0070702_100000286 Ga0070702_10000028614 117
40 3300005616 Ga0068852_100179484 Ga0068852_1001794842 117
41 3300005617 Ga0068859_100001965 Ga0068859_1000019655 117
42 3300005718 Ga0068866_10000573 Ga0068866_1000057311 117
43 3300005719 Ga0068861_100000507 Ga0068861_10000050712 117
44 3300005842 Ga0068858_100009407 Ga0068858_1000094075 117
45 3300005843 Ga0068860_100003792 Ga0068860_1000037925 117
46 3300005844 Ga0068862_100006603 Ga0068862_1000066038 117
47 3300006163 Ga0070715_10014293 Ga0070715_100142932 117
48 3300006173 Ga0070716_100015321 Ga0070716_1000153214 117
49 3300006175 Ga0070712_100002997 Ga0070712_1000029977 117
50 3300006881 Ga0068865_100007593 Ga0068865_1000075937 117
51 3300006931 Ga0097620_100001965 Ga0097620_1000019655 117
52 3300009098 Ga0105245_10002923 Ga0105245_100029236 117
53 3300009101 Ga0105247_10005571 Ga0105247_100055717 117
54 3300009148 Ga0105243_10002003 Ga0105243_100020038 117
55 3300009545 Ga0105237_10020056 Ga0105237_100200565 117
56 3300009551 Ga0105238_10163046 Ga0105238_101630462 117
57 3300009553 Ga0105249_10001158 Ga0105249_1000115812 117
58 3300010375 Ga0105239_10026074 Ga0105239_100260745 117
59 3300013102 Ga0157371_10064389 Ga0157371_100643894 117
60 3300013296 Ga0157374_10372306 Ga0157374_103723062 117
61 3300013297 Ga0157378_10002180 Ga0157378_1000218016 117
62 3300013307 Ga0157372_10007056 Ga0157372_100070565 117
63 3300013308 Ga0157375_10000151 Ga0157375_1000015159 117
64 3300014326 Ga0157380_10008689 Ga0157380_100086897 117
65 3300014968 Ga0157379_10006897 Ga0157379_100068978 117
66 3300014969 Ga0157376_10072772 Ga0157376_100727723 117
67 3300017792 Ga0163161_10002439 Ga0163161_1000243912 117
68 3300025898 Ga0207692_10016581 Ga0207692_100165813 117
69 3300025899 Ga0207642_10002214 Ga0207642_100022146 117
70 3300025900 Ga0207710_10009664 Ga0207710_100096643 117
71 3300025901 Ga0207688_10000025 Ga0207688_1000002538 117
72 3300025903 Ga0207680_10072025 Ga0207680_100720252 117
73 3300025905 Ga0207685_10003762 Ga0207685_100037622 117
74 3300025907 Ga0207645_10240688 Ga0207645_102406882 117
75 3300025912 Ga0207707_10454582 Ga0207707_104545822 117
76 3300025914 Ga0207671_10019240 Ga0207671_100192404 117
77 3300025915 Ga0207693_10000123 Ga0207693_1000012342 117
78 3300025916 Ga0207663_10009847 Ga0207663_100098475 117
79 3300025923 Ga0207681_10011516 Ga0207681_100115163 117
80 3300025927 Ga0207687_10199505 Ga0207687_101995052 117
81 3300025931 Ga0207644_10055312 Ga0207644_100553122 117
82 3300025932 Ga0207690_10091240 Ga0207690_100912402 117
83 3300025933 Ga0207706_10005323 Ga0207706_1000532312 117
84 3300025934 Ga0207686_10001243 Ga0207686_100012439 117
85 3300025935 Ga0207709_10021107 Ga0207709_100211073 117
86 3300025937 Ga0207669_10000400 Ga0207669_1000040011 117
87 3300025938 Ga0207704_10000325 Ga0207704_1000032517 117
88 3300025939 Ga0207665_10008251 Ga0207665_100082515 117
89 3300025949 Ga0207667_10318000 Ga0207667_103180002 117
90 3300025961 Ga0207712_10006113 Ga0207712_100061136 117
91 3300025981 Ga0207640_10000582 Ga0207640_1000058210 117
92 3300025986 Ga0207658_10003640 Ga0207658_100036402 117
93 3300026023 Ga0207677_10009499 Ga0207677_100094993 117
94 3300026035 Ga0207703_10005075 Ga0207703_1000507510 117
95 3300026075 Ga0207708_10000452 Ga0207708_1000045234 117
96 3300026078 Ga0207702_10618438 Ga0207702_106184382 117
97 3300026089 Ga0207648_10000381 Ga0207648_1000038117 117
98 3300026118 Ga0207675_100000406 Ga0207675_1000004068 117
99 3300026121 Ga0207683_10001482 Ga0207683_1000148220 117
100 3300028380 Ga0268265_10036750 Ga0268265_100367503 117
101 3300028381 Ga0268264_10009176 Ga0268264_100091768 117
102 3300035121 Ga0373960_0097009 Ga0373960_0097009_210_683 117
103 3300035691 Ga0373931_0031120 Ga0373931_0031120_124_597 117
104 3300048903 Ga0496100_0001254 Ga0496100_0001254_3304_3777 117
105 3300048904 Ga0496101_0049531 Ga0496101_0049531_2177_2650 117
106 3300048905 Ga0496102_0002086 Ga0496102_0002086_12069_12542 117
107 3300048906 Ga0496103_0000991 Ga0496103_0000991_10472_10945 117
108 3300048909 Ga0496106_0001129 Ga0496106_0001129_9829_10302 117
109 3300048910 Ga0496107_0000495 Ga0496107_0000495_9381_9854 117
110 3300048917 Ga0496114_0000419 Ga0496114_0000419_5272_5745 117
111 3300048918 Ga0496115_0090795 Ga0496115_0090795_54_527 117
112 3300005434 Ga0070709_10018035 Ga0070709_100180354 126
113 3300005437 Ga0070710_10001265 Ga0070710_100012653 126
114 3300005548 Ga0070665_100046080 Ga0070665_1000460805 126
115 3300009147 Ga0114129_11140618 Ga0114129_111406182 126
116 3300009176 Ga0105242_10000979 Ga0105242_1000097915 126
117 3300025906 Ga0207699_10006989 Ga0207699_100069895 126
118 3300028379 Ga0268266_10087000 Ga0268266_100870003 126
119 3300050490 nmdc:mga03n38_148924_c1 nmdc:mga03n38_148924_c1_324_725 126
120 3300050491 nmdc:mga00v17_24459_c1 nmdc:mga00v17_24459_c1_1119_1520 126
121 3300050492 nmdc:mga0yw44_141802_c1 nmdc:mga0yw44_141802_c1_890_1291 126
122 3300050516 nmdc:mga0sz30_2087_c1 nmdc:mga0sz30_2087_c1_5636_6037 126
123 3300003792 Ga0055540_1000003 Ga0055540_1000003188 129
124 3300025303 Ga0209051_1000011 Ga0209051_1000011408 129
125 3300041411 Ga0439466_0074647 Ga0439466_0074647_128_526 132
126 3300041413 Ga0439465_0007860 Ga0439465_0007860_2558_2956 132
127 3300042002 Ga0439442_077698 Ga0439442_077698_42_440 132
128 3300048911 Ga0496108_1003628 Ga0496108_1003628_109_507 132
129 3300005937 Ga0081455_10228023 Ga0081455_102280232 133
130 3300039437 Ga0436365_1664352 Ga0436365_1664352_1770_2171 133
131 3300039450 Ga0436363_1397604 Ga0436363_1397604_1731_2132 133
132 3300046692 Ga0495671_0076765 Ga0495671_0076765_36_446 133
133 3300048911 Ga0496108_0485719 Ga0496108_0485719_656_1057 133
134 3300048912 Ga0496109_0285433 Ga0496109_0285433_823_1224 133
135 3300048915 Ga0496112_0355356 Ga0496112_0355356_436_837 133
136 3300049742 Ga0501080_0692911 Ga0501080_0692911_13_414 133
137 3300049822 Ga0501035_1262363 Ga0501035_1262363_40_441 133
138 3300053104 Ga0500556_0124169 Ga0500556_0124169_13_423 133
139 3300045976 Ga0466967_2174205 Ga0466967_2174205_42_515 135
140 3300044658 Ga0466972_0034477 Ga0466972_0034477_510_944 144
141 3300044683 Ga0466965_0002997 Ga0466965_0002997_4385_4819 144
142 3300044694 Ga0466963_0626646 Ga0466963_0626646_262_696 144
143 3300044735 Ga0466968_0001326 Ga0466968_0001326_2330_2764 144
144 3300044842 Ga0466957_0005427 Ga0466957_0005427_4890_5324 144
145 3300044901 Ga0466960_0001519 Ga0466960_0001519_3002_3436 144
146 3300045049 Ga0466959_0001756 Ga0466959_0001756_7234_7668 144
147 3300045836 Ga0466958_0102303 Ga0466958_0102303_1019_1453 144
148 3300045976 Ga0466967_0015951 Ga0466967_0015951_5121_5555 144
149 3300045976 Ga0466967_0129856 Ga0466967_0129856_1424_1897 144
150 3300039437 Ga0436365_1212976 Ga0436365_1212976_464_937 147
151 3300039453 Ga0436362_1020382 Ga0436362_1020382_13_486 148
152 3300045976 Ga0466967_1455805 Ga0466967_1455805_222_668 148
153 3300025914 Ga0207671_10007814 Ga0207671_100078149 149
154 3300048903 Ga0496100_0079741 Ga0496100_0079741_1296_1745 149
155 3300048904 Ga0496101_0045273 Ga0496101_0045273_362_811 149
156 3300048915 Ga0496112_0010535 Ga0496112_0010535_7704_8153 149
157 3300048916 Ga0496113_0005415 Ga0496113_0005415_4997_5446 149
158 3300048918 Ga0496115_0751539 Ga0496115_0751539_115_564 149
159 3300048923 Ga0496120_0073458 Ga0496120_0073458_1075_1524 149
160 3300048925 Ga0496122_0057779 Ga0496122_0057779_181_630 149
161 3300048926 Ga0496123_0062741 Ga0496123_0062741_1429_1878 149
162 3300048929 Ga0496126_0032421 Ga0496126_0032421_4358_4807 149
163 iso_pu_bacteria 2738541264 2738666917 149
164 iso_pu_bacteria 2738541356 2739145761 149
165 3300006048 Ga0075363_100190080 Ga0075363_1001900802 150
166 3300006051 Ga0075364_10030170 Ga0075364_100301704 150
167 3300006186 Ga0075369_10021606 Ga0075369_100216064 150
168 3300005937 Ga0081455_10016795 Ga0081455_100167957 151
169 3300006038 Ga0075365_10068523 Ga0075365_100685234 151
170 3300006048 Ga0075363_100012390 Ga0075363_1000123902 151
171 3300006051 Ga0075364_10002949 Ga0075364_100029492 151
172 3300006178 Ga0075367_10133053 Ga0075367_101330532 151
173 3300006353 Ga0075370_10003723 Ga0075370_100037232 151
174 3300031731 Ga0307405_10388196 Ga0307405_103881962 151
175 3300031852 Ga0307410_10102661 Ga0307410_101026612 151
176 3300031995 Ga0307409_100209857 Ga0307409_1002098572 151
177 3300032002 Ga0307416_100030887 Ga0307416_1000308872 151
178 3300032126 Ga0307415_100515876 Ga0307415_1005158762 151
179 3300050490 nmdc:mga03n38_1616_c1 nmdc:mga03n38_1616_c1_2731_3186 151
180 3300050491 nmdc:mga00v17_1224_c1 nmdc:mga00v17_1224_c1_8970_9425 151
181 3300050492 nmdc:mga0yw44_185616_c1 nmdc:mga0yw44_185616_c1_153_608 151
182 3300050494 nmdc:mga06z11_85528_c1 nmdc:mga06z11_85528_c1_813_1268 151
183 3300050496 nmdc:mga07m45_3834_c1 nmdc:mga07m45_3834_c1_6713_7168 151
184 3300050516 nmdc:mga0sz30_1490_c2 nmdc:mga0sz30_1490_c2_2766_3221 151
185 3300053108 Ga0500562_042103 Ga0500562_042103_565_1020 151
186 3300042435 Ga0439434_0030541 Ga0439434_0030541_755_1213 152
187 3300044683 Ga0466965_0203888 Ga0466965_0203888_150_608 152
188 3300044693 Ga0466961_0010397 Ga0466961_0010397_2058_2516 152
189 3300044735 Ga0466968_0277801 Ga0466968_0277801_310_768 152
190 3300044842 Ga0466957_0007638 Ga0466957_0007638_5512_5985 152
191 3300044842 Ga0466957_0223482 Ga0466957_0223482_752_1210 152
192 3300044901 Ga0466960_0587416 Ga0466960_0587416_110_568 152
193 3300045049 Ga0466959_0731807 Ga0466959_0731807_43_501 152
194 3300045836 Ga0466958_0129948 Ga0466958_0129948_1086_1544 152
195 3300045836 Ga0466958_0257798 Ga0466958_0257798_205_678 152
196 3300049571 Ga0501034_0855028 Ga0501034_0855028_190_648 152
197 3300049581 Ga0501047_0172077 Ga0501047_0172077_92_550 152
198 3300061719 Ga0466962_0013630 Ga0466962_0013630_1222_1695 152
199 3300006038 Ga0075365_10042967 Ga0075365_100429674 153
200 3300006048 Ga0075363_100106334 Ga0075363_1001063342 153
201 3300006051 Ga0075364_10061710 Ga0075364_100617102 153
202 3300006177 Ga0075362_10107273 Ga0075362_101072732 153
203 3300006178 Ga0075367_10043234 Ga0075367_100432342 153
204 3300006186 Ga0075369_10031814 Ga0075369_100318142 153
205 3300009545 Ga0105237_10009594 Ga0105237_100095944 153
206 3300010375 Ga0105239_10051386 Ga0105239_100513864 153
207 3300021377 Ga0213874_10026576 Ga0213874_100265762 153
208 3300031251 Ga0265327_10001674 Ga0265327_1000167415 153
209 3300039453 Ga0436362_1084299 Ga0436362_1084299_39_500 153
210 3300041411 Ga0439466_0046181 Ga0439466_0046181_506_967 153
211 3300041413 Ga0439465_0016208 Ga0439465_0016208_86_547 153
212 3300041507 Ga0451851_1183602 Ga0451851_1183602_327_788 153
213 3300042005 Ga0439448_0015051 Ga0439448_0015051_1232_1693 153
214 3300042145 Ga0450906_076488 Ga0450906_076488_23_484 153
215 3300044658 Ga0466972_0309961 Ga0466972_0309961_247_717 153
216 3300044683 Ga0466965_0281658 Ga0466965_0281658_310_771 153
217 3300044765 Ga0466970_0017334 Ga0466970_0017334_2540_3010 153
218 3300045049 Ga0466959_0536802 Ga0466959_0536802_94_564 153
219 3300045836 Ga0466958_0617525 Ga0466958_0617525_31_501 153
220 3300045976 Ga0466967_0002447 Ga0466967_0002447_7146_7607 153
221 3300048906 Ga0496103_0207235 Ga0496103_0207235_135_596 153
222 iso_pu_bacteria 2842134933 2842140109 153
223 iso_pu_bacteria 2919713450 2919713674 153
224 iso_pu_bacteria 2939582691 2939588806 153
225 3300003320 rootH2_10058472 rootH2_100584722 154
226 3300005434 Ga0070709_10244056 Ga0070709_102440562 154
227 3300005435 Ga0070714_100017948 Ga0070714_1000179482 154
228 3300005436 Ga0070713_100131026 Ga0070713_1001310263 154
229 3300005578 Ga0068854_100422176 Ga0068854_1004221762 154
230 3300006173 Ga0070716_100269425 Ga0070716_1002694252 154
231 3300006175 Ga0070712_100690952 Ga0070712_1006909522 154
232 3300009545 Ga0105237_10223591 Ga0105237_102235912 154
233 3300013105 Ga0157369_10262280 Ga0157369_102622803 154
234 3300025914 Ga0207671_10225288 Ga0207671_102252882 154
235 3300025928 Ga0207700_10282393 Ga0207700_102823932 154
236 3300025929 Ga0207664_10184127 Ga0207664_101841272 154
237 3300025939 Ga0207665_10453959 Ga0207665_104539592 154
238 3300025981 Ga0207640_10867911 Ga0207640_108679111 154
239 3300005337 Ga0070682_100007655 Ga0070682_1000076557 156
240 3300005455 Ga0070663_100019883 Ga0070663_1000198834 156
241 3300005547 Ga0070693_100431909 Ga0070693_1004319091 156
242 3300005618 Ga0068864_100661076 Ga0068864_1006610761 156
243 3300006048 Ga0075363_100033166 Ga0075363_1000331664 156
244 3300006353 Ga0075370_10111484 Ga0075370_101114842 156
245 3300009551 Ga0105238_10116699 Ga0105238_101166994 156
246 3300013297 Ga0157378_12433133 Ga0157378_124331331 156
247 3300013306 Ga0163162_12281638 Ga0163162_122816381 156
248 3300014325 Ga0163163_10037556 Ga0163163_100375565 156
249 3300014745 Ga0157377_10180754 Ga0157377_101807542 156
250 3300021384 Ga0213876_10011710 Ga0213876_100117105 156
251 3300025924 Ga0207694_10205682 Ga0207694_102056822 156
252 3300026067 Ga0207678_10029559 Ga0207678_100295594 156
253 3300026075 Ga0207708_10361553 Ga0207708_103615531 156
254 3300026095 Ga0207676_10271194 Ga0207676_102711942 156
255 3300026142 Ga0207698_10587445 Ga0207698_105874452 156
256 3300039437 Ga0436365_0731445 Ga0436365_0731445_3998_4471 156
257 3300041452 Ga0451793_1520913 Ga0451793_1520913_65_535 156
258 3300048903 Ga0496100_0233972 Ga0496100_0233972_61_531 156
259 3300048904 Ga0496101_0398029 Ga0496101_0398029_267_737 156
260 3300048911 Ga0496108_0022268 Ga0496108_0022268_2408_2878 156
261 3300048912 Ga0496109_0032986 Ga0496109_0032986_1854_2324 156
262 3300048913 Ga0496110_0019813 Ga0496110_0019813_2959_3429 156
263 3300048915 Ga0496112_0043922 Ga0496112_0043922_772_1242 156
264 3300048916 Ga0496113_0414811 Ga0496113_0414811_387_857 156
265 3300048917 Ga0496114_0597929 Ga0496114_0597929_470_940 156
266 3300048917 Ga0496114_1136240 Ga0496114_1136240_12_482 156
267 3300048918 Ga0496115_0146957 Ga0496115_0146957_431_901 156
268 3300048929 Ga0496126_0004133 Ga0496126_0004133_6072_6542 156
269 3300050490 nmdc:mga03n38_8154_c1 nmdc:mga03n38_8154_c1_469_939 156
270 3300050496 nmdc:mga07m45_120289_c1 nmdc:mga07m45_120289_c1_327_797 156
271 3300053083 Ga0495655_0058769 Ga0495655_0058769_455_925 156
272 3300001991 JGI24743J22301_10001574 JGI24743J22301_100015742 157
273 3300005331 Ga0070670_100405899 Ga0070670_1004058992 157
274 3300005335 Ga0070666_10272365 Ga0070666_102723652 157
275 3300005347 Ga0070668_100696972 Ga0070668_1006969722 157
276 3300005353 Ga0070669_100032393 Ga0070669_1000323934 157
277 3300005353 Ga0070669_100085651 Ga0070669_1000856514 157
278 3300005355 Ga0070671_100113252 Ga0070671_1001132522 157
279 3300005356 Ga0070674_100198695 Ga0070674_1001986951 157
280 3300005367 Ga0070667_100000073 Ga0070667_10000007337 157
281 3300005367 Ga0070667_100146250 Ga0070667_1001462502 157
282 3300005367 Ga0070667_100287258 Ga0070667_1002872582 157
283 3300005367 Ga0070667_100531753 Ga0070667_1005317531 157
284 3300005437 Ga0070710_10176050 Ga0070710_101760502 157
285 3300005439 Ga0070711_100130607 Ga0070711_1001306071 157
286 3300005455 Ga0070663_100036058 Ga0070663_1000360583 157
287 3300005539 Ga0068853_101188734 Ga0068853_1011887341 157
288 3300005544 Ga0070686_100402637 Ga0070686_1004026372 157
289 3300005546 Ga0070696_100607078 Ga0070696_1006070782 157
290 3300005548 Ga0070665_100004662 Ga0070665_1000046629 157
291 3300005548 Ga0070665_100110655 Ga0070665_1001106553 157
292 3300005617 Ga0068859_100000223 Ga0068859_10000022343 157
293 3300005618 Ga0068864_100126471 Ga0068864_1001264712 157
294 3300005618 Ga0068864_100333412 Ga0068864_1003334122 157
295 3300005718 Ga0068866_10825311 Ga0068866_108253111 157
296 3300005719 Ga0068861_100627658 Ga0068861_1006276582 157
297 3300005841 Ga0068863_100000587 Ga0068863_10000058738 157
298 3300005841 Ga0068863_100013142 Ga0068863_1000131427 157
299 3300005842 Ga0068858_100004229 Ga0068858_10000422912 157
300 3300005842 Ga0068858_100669304 Ga0068858_1006693042 157
301 3300005843 Ga0068860_100000127 Ga0068860_10000012738 157
302 3300005844 Ga0068862_100000052 Ga0068862_100000052103 157
303 3300006038 Ga0075365_10101143 Ga0075365_101011432 157
304 3300006042 Ga0075368_10051880 Ga0075368_100518802 157
305 3300006048 Ga0075363_100009271 Ga0075363_1000092714 157
306 3300006048 Ga0075363_100014948 Ga0075363_1000149484 157
307 3300006048 Ga0075363_100085290 Ga0075363_1000852902 157
308 3300006048 Ga0075363_100289873 Ga0075363_1002898732 157
309 3300006048 Ga0075363_100310056 Ga0075363_1003100562 157
310 3300006051 Ga0075364_10003160 Ga0075364_100031602 157
311 3300006051 Ga0075364_10116159 Ga0075364_101161592 157
312 3300006051 Ga0075364_10119505 Ga0075364_101195052 157
313 3300006051 Ga0075364_10173576 Ga0075364_101735762 157
314 3300006051 Ga0075364_10493591 Ga0075364_104935912 157
315 3300006173 Ga0070716_100046065 Ga0070716_1000460653 157
316 3300006175 Ga0070712_100694520 Ga0070712_1006945201 157
317 3300006177 Ga0075362_10059173 Ga0075362_100591732 157
318 3300006177 Ga0075362_10059237 Ga0075362_100592372 157
319 3300006177 Ga0075362_10182618 Ga0075362_101826182 157
320 3300006178 Ga0075367_10071419 Ga0075367_100714192 157
321 3300006186 Ga0075369_10028838 Ga0075369_100288382 157
322 3300006186 Ga0075369_10033262 Ga0075369_100332622 157
323 3300006186 Ga0075369_10065547 Ga0075369_100655472 157
324 3300006186 Ga0075369_10112334 Ga0075369_101123341 157
325 3300006195 Ga0075366_10056414 Ga0075366_100564142 157
326 3300006353 Ga0075370_10012155 Ga0075370_100121554 157
327 3300006353 Ga0075370_10026300 Ga0075370_100263004 157
328 3300006353 Ga0075370_10245465 Ga0075370_102454652 157
329 3300006844 Ga0075428_100000149 Ga0075428_10000014925 157
330 3300006846 Ga0075430_100023965 Ga0075430_1000239655 157
331 3300006847 Ga0075431_100297113 Ga0075431_1002971132 157
332 3300006880 Ga0075429_100505277 Ga0075429_1005052772 157
333 3300006881 Ga0068865_100201640 Ga0068865_1002016402 157
334 3300006931 Ga0097620_100000223 Ga0097620_10000022343 157
335 3300007788 Ga0099795_10011365 Ga0099795_100113652 157
336 3300009092 Ga0105250_10064935 Ga0105250_100649352 157
337 3300009101 Ga0105247_10000066 Ga0105247_1000006677 157
338 3300009147 Ga0114129_10033330 Ga0114129_100333304 157
339 3300009147 Ga0114129_11747384 Ga0114129_117473842 157
340 3300009148 Ga0105243_10547029 Ga0105243_105470292 157
341 3300009176 Ga0105242_10990595 Ga0105242_109905952 157
342 3300009177 Ga0105248_10000613 Ga0105248_1000061338 157
343 3300009177 Ga0105248_11242667 Ga0105248_112426672 157
344 3300009553 Ga0105249_10000093 Ga0105249_1000009378 157
345 3300009553 Ga0105249_10138044 Ga0105249_101380444 157
346 3300010375 Ga0105239_10743802 Ga0105239_107438022 157
347 3300013297 Ga0157378_12397833 Ga0157378_123978331 157
348 3300013306 Ga0163162_10006763 Ga0163162_1000676310 157
349 3300013306 Ga0163162_10089548 Ga0163162_100895484 157
350 3300013306 Ga0163162_10203017 Ga0163162_102030172 157
351 3300014325 Ga0163163_10012823 Ga0163163_100128237 157
352 3300014325 Ga0163163_10088824 Ga0163163_100888242 157
353 3300014968 Ga0157379_10050118 Ga0157379_100501182 157
354 3300021384 Ga0213876_10000674 Ga0213876_1000067414 157
355 3300021384 Ga0213876_10013547 Ga0213876_100135474 157
356 3300021384 Ga0213876_10165481 Ga0213876_101654811 157
357 3300021388 Ga0213875_10023757 Ga0213875_100237572 157
358 3300025900 Ga0207710_10000090 Ga0207710_1000009077 157
359 3300025903 Ga0207680_10298399 Ga0207680_102983992 157
360 3300025916 Ga0207663_10954634 Ga0207663_109546341 157
361 3300025923 Ga0207681_10005438 Ga0207681_100054384 157
362 3300025931 Ga0207644_10059568 Ga0207644_100595682 157
363 3300025931 Ga0207644_10113368 Ga0207644_101133683 157
364 3300025939 Ga0207665_10082774 Ga0207665_100827742 157
365 3300025941 Ga0207711_10000183 Ga0207711_1000018338 157
366 3300025961 Ga0207712_10000073 Ga0207712_1000007378 157
367 3300025961 Ga0207712_10616414 Ga0207712_106164142 157
368 3300025986 Ga0207658_10000304 Ga0207658_1000030447 157
369 3300025986 Ga0207658_10007427 Ga0207658_100074275 157
370 3300025986 Ga0207658_10042565 Ga0207658_100425652 157
371 3300025986 Ga0207658_10289095 Ga0207658_102890951 157
372 3300025986 Ga0207658_10382148 Ga0207658_103821482 157
373 3300026035 Ga0207703_10010298 Ga0207703_100102985 157
374 3300026067 Ga0207678_10006722 Ga0207678_100067227 157
375 3300026088 Ga0207641_10000413 Ga0207641_1000041331 157
376 3300026088 Ga0207641_10008652 Ga0207641_100086527 157
377 3300026095 Ga0207676_10269958 Ga0207676_102699582 157
378 3300026118 Ga0207675_101186887 Ga0207675_1011868872 157
379 3300026121 Ga0207683_10618513 Ga0207683_106185132 157
380 3300028379 Ga0268266_10007258 Ga0268266_100072589 157
381 3300028379 Ga0268266_10061743 Ga0268266_100617432 157
382 3300028380 Ga0268265_10000063 Ga0268265_10000063103 157
383 3300028380 Ga0268265_10011038 Ga0268265_100110387 157
384 3300028381 Ga0268264_10000007 Ga0268264_1000000738 157
385 3300030521 Ga0307511_10193734 Ga0307511_101937342 157
386 3300031852 Ga0307410_10150343 Ga0307410_101503432 157
387 3300031995 Ga0307409_100885158 Ga0307409_1008851582 157
388 3300031995 Ga0307409_100895520 Ga0307409_1008955202 157
389 3300031995 Ga0307409_101311706 Ga0307409_1013117061 157
390 3300035170 Ga0373943_0147883 Ga0373943_0147883_63_536 157
391 3300035691 Ga0373931_0345922 Ga0373931_0345922_118_591 157
392 3300035695 Ga0373927_0446391 Ga0373927_0446391_146_619 157
393 3300036712 Ga0316584_0038500 Ga0316584_0038500_178_651 157
394 3300037068 Ga0373925_0697568 Ga0373925_0697568_15_488 157
395 3300037853 Ga0436364_0448603 Ga0436364_0448603_2598_3083 157
396 3300037853 Ga0436364_1184081 Ga0436364_1184081_4237_4710 157
397 3300039437 Ga0436365_0016980 Ga0436365_0016980_11372_11845 157
398 3300039437 Ga0436365_0119240 Ga0436365_0119240_6051_6524 157
399 3300039437 Ga0436365_0347716 Ga0436365_0347716_855_1328 157
400 3300039438 Ga0436360_0492879 Ga0436360_0492879_54_527 157
401 3300039447 Ga0436361_0751346 Ga0436361_0751346_28_501 157
402 3300039450 Ga0436363_0746391 Ga0436363_0746391_37_510 157
403 3300039450 Ga0436363_1576561 Ga0436363_1576561_449_922 157
404 3300041413 Ga0439465_0001090 Ga0439465_0001090_3797_4270 157
405 3300041443 Ga0451789_0556179 Ga0451789_0556179_234_719 157
406 3300041460 Ga0451802_0501702 Ga0451802_0501702_137_610 157
407 3300041496 Ga0451839_0495621 Ga0451839_0495621_103_594 157
408 3300042004 Ga0439445_0014459 Ga0439445_0014459_1337_1810 157
409 3300044658 Ga0466972_0068577 Ga0466972_0068577_263_739 157
410 3300044683 Ga0466965_0002055 Ga0466965_0002055_5163_5639 157
411 3300044683 Ga0466965_0357703 Ga0466965_0357703_103_576 157
412 3300044693 Ga0466961_0042451 Ga0466961_0042451_1114_1587 157
413 3300044694 Ga0466963_0140783 Ga0466963_0140783_711_1184 157
414 3300044765 Ga0466970_0122508 Ga0466970_0122508_51_524 157
415 3300044842 Ga0466957_0032729 Ga0466957_0032729_1101_1577 157
416 3300044842 Ga0466957_0257922 Ga0466957_0257922_426_899 157
417 3300044842 Ga0466957_0419629 Ga0466957_0419629_203_676 157
418 3300044901 Ga0466960_0000320 Ga0466960_0000320_447_923 157
419 3300044901 Ga0466960_0001941 Ga0466960_0001941_6396_6869 157
420 3300044901 Ga0466960_0450449 Ga0466960_0450449_91_564 157
421 3300044901 Ga0466960_0590682 Ga0466960_0590682_100_573 157
422 3300045836 Ga0466958_0073149 Ga0466958_0073149_827_1300 157
423 3300045976 Ga0466967_0002855 Ga0466967_0002855_4338_4814 157
424 3300045976 Ga0466967_0005640 Ga0466967_0005640_4453_4926 157
425 3300045976 Ga0466967_0042813 Ga0466967_0042813_3347_3820 157
426 3300045976 Ga0466967_0307239 Ga0466967_0307239_672_1151 157
427 3300045976 Ga0466967_0616038 Ga0466967_0616038_475_948 157
428 3300045976 Ga0466967_0889842 Ga0466967_0889842_52_525 157
429 3300045976 Ga0466967_1400377 Ga0466967_1400377_23_502 157
430 3300046459 Ga0495629_0039368 Ga0495629_0039368_1469_1942 157
431 3300046460 Ga0495638_0002780 Ga0495638_0002780_12077_12559 157
432 3300046461 Ga0495641_0013995 Ga0495641_0013995_3603_4076 157
433 3300046471 Ga0495650_0144127 Ga0495650_0144127_11_484 157
434 3300046507 Ga0495606_0065956 Ga0495606_0065956_860_1333 157
435 3300046513 Ga0495616_0192408 Ga0495616_0192408_102_584 157
436 3300046531 Ga0495665_0080424 Ga0495665_0080424_387_860 157
437 3300046533 Ga0495640_0015166 Ga0495640_0015166_4700_5173 157
438 3300046559 Ga0495667_0392075 Ga0495667_0392075_368_841 157
439 3300046616 Ga0495668_0155376 Ga0495668_0155376_27_509 157
440 3300046660 Ga0495625_0147894 Ga0495625_0147894_576_1058 157
441 3300046683 Ga0495658_0012503 Ga0495658_0012503_95_568 157
442 3300047320 Ga0495672_0103539 Ga0495672_0103539_31_504 157
443 3300047321 Ga0495676_0356819 Ga0495676_0356819_377_850 157
444 3300047472 Ga0495686_0000940 Ga0495686_0000940_11901_12401 157
445 3300047472 Ga0495686_0164803 Ga0495686_0164803_488_979 157
446 3300047673 Ga0495593_0006029 Ga0495593_0006029_2681_3154 157
447 3300048089 Ga0495614_0066438 Ga0495614_0066438_626_1099 157
448 3300048091 Ga0495626_0039009 Ga0495626_0039009_159_641 157
449 3300048903 Ga0496100_0006694 Ga0496100_0006694_4065_4538 157
450 3300048903 Ga0496100_1317915 Ga0496100_1317915_34_507 157
451 3300048904 Ga0496101_0035226 Ga0496101_0035226_1561_2034 157
452 3300048904 Ga0496101_0175593 Ga0496101_0175593_1037_1516 157
453 3300048905 Ga0496102_0000168 Ga0496102_0000168_32251_32724 157
454 3300048905 Ga0496102_0019989 Ga0496102_0019989_2940_3419 157
455 3300048905 Ga0496102_0057771 Ga0496102_0057771_2320_2793 157
456 3300048905 Ga0496102_0709530 Ga0496102_0709530_303_776 157
457 3300048905 Ga0496102_1406995 Ga0496102_1406995_111_590 157
458 3300048906 Ga0496103_0031558 Ga0496103_0031558_1140_1613 157
459 3300048906 Ga0496103_0045239 Ga0496103_0045239_1445_1924 157
460 3300048906 Ga0496103_0084642 Ga0496103_0084642_583_1056 157
461 3300048907 Ga0496104_0012733 Ga0496104_0012733_1519_1998 157
462 3300048908 Ga0496105_0047005 Ga0496105_0047005_68_541 157
463 3300048909 Ga0496106_0545886 Ga0496106_0545886_130_603 157
464 3300048910 Ga0496107_0015409 Ga0496107_0015409_2045_2518 157
465 3300048912 Ga0496109_0176908 Ga0496109_0176908_72_551 157
466 3300048913 Ga0496110_0029838 Ga0496110_0029838_3968_4447 157
467 3300048915 Ga0496112_0625299 Ga0496112_0625299_157_630 157
468 3300048916 Ga0496113_0337388 Ga0496113_0337388_688_1161 157
469 3300048916 Ga0496113_0420966 Ga0496113_0420966_570_1043 157
470 3300048917 Ga0496114_0636767 Ga0496114_0636767_252_725 157
471 3300048919 Ga0496116_0015907 Ga0496116_0015907_155_628 157
472 3300048920 Ga0496117_0008185 Ga0496117_0008185_155_628 157
473 3300048921 Ga0496118_0000171 Ga0496118_0000171_14799_15272 157
474 3300048922 Ga0496119_0003283 Ga0496119_0003283_8811_9284 157
475 3300048923 Ga0496120_0017049 Ga0496120_0017049_2480_2953 157
476 3300048923 Ga0496120_0323768 Ga0496120_0323768_214_687 157
477 3300048924 Ga0496121_0013914 Ga0496121_0013914_5947_6420 157
478 3300048927 Ga0496124_0072339 Ga0496124_0072339_492_965 157
479 3300048928 Ga0496125_0121012 Ga0496125_0121012_10_483 157
480 3300048928 Ga0496125_0474678 Ga0496125_0474678_18_518 157
481 3300048929 Ga0496126_0589400 Ga0496126_0589400_82_582 157
482 3300049569 Ga0501032_0000510 Ga0501032_0000510_28483_28956 157
483 3300049569 Ga0501032_0202148 Ga0501032_0202148_643_1116 157
484 3300049569 Ga0501032_0461352 Ga0501032_0461352_70_543 157
485 3300049570 Ga0501033_0006101 Ga0501033_0006101_3918_4391 157
486 3300049570 Ga0501033_0052419 Ga0501033_0052419_562_1035 157
487 3300049570 Ga0501033_0452714 Ga0501033_0452714_301_774 157
488 3300049571 Ga0501034_0001987 Ga0501034_0001987_11687_12160 157
489 3300049571 Ga0501034_0005475 Ga0501034_0005475_4546_5019 157
490 3300049571 Ga0501034_0130096 Ga0501034_0130096_448_921 157
491 3300049571 Ga0501034_0163709 Ga0501034_0163709_1043_1516 157
492 3300049572 Ga0501036_0002002 Ga0501036_0002002_3796_4269 157
493 3300049572 Ga0501036_0356474 Ga0501036_0356474_168_641 157
494 3300049573 Ga0501037_0000677 Ga0501037_0000677_16551_17024 157
495 3300049573 Ga0501037_0028731 Ga0501037_0028731_349_822 157
496 3300049573 Ga0501037_0073325 Ga0501037_0073325_1182_1655 157
497 3300049574 Ga0501038_0001664 Ga0501038_0001664_3237_3710 157
498 3300049574 Ga0501038_0791088 Ga0501038_0791088_155_628 157
499 3300049575 Ga0501039_0000157 Ga0501039_0000157_29543_30016 157
500 3300049579 Ga0501043_0000971 Ga0501043_0000971_24834_25307 157
501 3300049579 Ga0501043_0015753 Ga0501043_0015753_4326_4799 157
502 3300049580 Ga0501046_0004078 Ga0501046_0004078_3851_4324 157
503 3300049581 Ga0501047_0001180 Ga0501047_0001180_8022_8495 157
504 3300049581 Ga0501047_0107234 Ga0501047_0107234_1824_2297 157
505 3300049581 Ga0501047_0228914 Ga0501047_0228914_1061_1534 157
506 3300049582 Ga0501048_0003008 Ga0501048_0003008_11950_12423 157
507 3300049583 Ga0501067_0083526 Ga0501067_0083526_475_948 157
508 3300049585 Ga0501069_0432167 Ga0501069_0432167_77_550 157
509 3300049586 Ga0501070_0001412 Ga0501070_0001412_16642_17115 157
510 3300049586 Ga0501070_0001918 Ga0501070_0001918_7365_7838 157
511 3300049589 Ga0501073_0027278 Ga0501073_0027278_2966_3439 157
512 3300049589 Ga0501073_0334497 Ga0501073_0334497_284_757 157
513 3300049593 Ga0501077_0158860 Ga0501077_0158860_395_868 157
514 3300049741 Ga0501079_0646871 Ga0501079_0646871_283_756 157
515 3300049742 Ga0501080_0155597 Ga0501080_0155597_290_763 157
516 3300049744 Ga0501083_0232171 Ga0501083_0232171_702_1175 157
517 3300049822 Ga0501035_0000385 Ga0501035_0000385_12157_12630 157
518 3300049822 Ga0501035_0003413 Ga0501035_0003413_609_1082 157
519 3300049822 Ga0501035_0466896 Ga0501035_0466896_544_1017 157
520 3300049823 Ga0501044_0001111 Ga0501044_0001111_553_1026 157
521 3300049823 Ga0501044_0018055 Ga0501044_0018055_5459_5932 157
522 3300049823 Ga0501044_0403055 Ga0501044_0403055_702_1175 157
523 3300050489 nmdc:mga03683_224189_c1 nmdc:mga03683_224189_c1_314_787 157
524 3300050489 nmdc:mga03683_71799_c1 nmdc:mga03683_71799_c1_288_761 157
525 3300050490 nmdc:mga03n38_20054_c1 nmdc:mga03n38_20054_c1_1839_2312 157
526 3300050490 nmdc:mga03n38_235480_c1 nmdc:mga03n38_235480_c1_349_831 157
527 3300050490 nmdc:mga03n38_294965_c1 nmdc:mga03n38_294965_c1_312_785 157
528 3300050490 nmdc:mga03n38_59612_c1 nmdc:mga03n38_59612_c1_1009_1482 157
529 3300050491 nmdc:mga00v17_17049_c1 nmdc:mga00v17_17049_c1_975_1448 157
530 3300050491 nmdc:mga00v17_417445_c1 nmdc:mga00v17_417445_c1_215_688 157
531 3300050491 nmdc:mga00v17_5015_c1 nmdc:mga00v17_5015_c1_5868_6341 157
532 3300050491 nmdc:mga00v17_512928_c1 nmdc:mga00v17_512928_c1_269_742 157
533 3300050492 nmdc:mga0yw44_182206_c1 nmdc:mga0yw44_182206_c1_278_751 157
534 3300050492 nmdc:mga0yw44_5588_c1 nmdc:mga0yw44_5588_c1_4592_5065 157
535 3300050492 nmdc:mga0yw44_93741_c1 nmdc:mga0yw44_93741_c1_702_1175 157
536 3300050493 nmdc:mga0k408_43381_c1 nmdc:mga0k408_43381_c1_661_1134 157
537 3300050493 nmdc:mga0k408_64805_c1 nmdc:mga0k408_64805_c1_1371_1844 157
538 3300050494 nmdc:mga06z11_126411_c1 nmdc:mga06z11_126411_c1_762_1235 157
539 3300050494 nmdc:mga06z11_146969_c1 nmdc:mga06z11_146969_c1_374_847 157
540 3300050496 nmdc:mga07m45_147909_c1 nmdc:mga07m45_147909_c1_124_597 157
541 3300050496 nmdc:mga07m45_1850_c1 nmdc:mga07m45_1850_c1_2922_3395 157
542 3300050496 nmdc:mga07m45_2352_c1 nmdc:mga07m45_2352_c1_4928_5401 157
543 3300050496 nmdc:mga07m45_95942_c1 nmdc:mga07m45_95942_c1_91_564 157
544 3300050507 nmdc:mga05p37_7689_c2 nmdc:mga05p37_7689_c2_3038_3511 157
545 3300050508 nmdc:mga09592_484911_c1 nmdc:mga09592_484911_c1_201_674 157
546 3300050509 nmdc:mga0qj67_19203_c1 nmdc:mga0qj67_19203_c1_978_1451 157
547 3300050510 nmdc:mga06r32_290070_c1 nmdc:mga06r32_290070_c1_438_911 157
548 3300050516 nmdc:mga0sz30_120382_c1 nmdc:mga0sz30_120382_c1_63_536 157
549 3300050516 nmdc:mga0sz30_154032_c1 nmdc:mga0sz30_154032_c1_361_834 157
550 3300050516 nmdc:mga0sz30_1947_c1 nmdc:mga0sz30_1947_c1_1704_2177 157
551 3300050516 nmdc:mga0sz30_50598_c2 nmdc:mga0sz30_50598_c2_506_979 157
552 3300050516 nmdc:mga0sz30_6350_c1 nmdc:mga0sz30_6350_c1_956_1447 157
553 3300053085 Ga0495619_0037475 Ga0495619_0037475_2583_3056 157
554 3300053087 Ga0500643_002159 Ga0500643_002159_9869_10342 157
555 3300053108 Ga0500562_002482 Ga0500562_002482_1786_2268 157
556 3300053151 Ga0500604_0145528 Ga0500604_0145528_186_668 157
557 3300053153 Ga0500616_0012932 Ga0500616_0012932_311_784 157
558 3300053153 Ga0500616_0037591 Ga0500616_0037591_301_783 157
559 3300060353 Ga0501082_0496159 Ga0501082_0496159_271_744 157
560 3300061719 Ga0466962_0197329 Ga0466962_0197329_250_723 157
561 iso_pu_bacteria 2547132424 2548696427 157

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zzt-assembly1.cif.gz_A-2 crystal structure of the cytosolic domain of the cation diffusion facilitator family protein 0.7504 95 156
4bts-assembly1.cif.gz_A3 the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a 0.7298 98 157
5ndw-assembly1.cif.gz_s7 crystal structure of aminoglycoside tc007 bound to the yeast 80s ribosome 0.7252 98 157
8btr-assembly1.cif.gz_SH giardia ribosome in pre-t hybrid state (d2) 0.7215 105 157
6zxh-assembly1.cif.gz_H cryo-em structure of a late human pre-40s ribosomal subunit - state h2 0.7063 110 157
ID Description Score Start End Superfamily
af_Q8IET7_9_119_3.30.70.600 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S10 0.7711 96 157 3.30.70.600
af_O00411_1126_1230_3.30.70.370 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7486 20 78 3.30.70.370
3bp1A01 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.7399 60 89 3.30.1130.10
af_Q9VFE9_134_251_3.40.50.2060 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Sec1/Munc18 (SM) protein, domain 1 0.732 122 156 3.40.50.2060
af_O53157_4_110_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.7004 96 157 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A2S9F7Y2-F1-model_v4 Uncharacterized protein 0.9798 1 72
AF-A0A2S9F7Y2-F1-model_v4 Uncharacterized protein 0.9538 1 72
AF-A0A2S8BQU2-F1-model_v4 Uncharacterized protein 0.9314 88 157
AF-A0A6S6P869-F1-model_v4 Uncharacterized protein 0.9271 1 157
AF-A0A2S8M819-F1-model_v4 deleted 0.9215 1 102

Feature Viewer

pLDDT pTM Quality
93.78 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map