F463863
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 287 | 555 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300047472|Ga0495686_0000940|Ga0495686_0000940_11901_12401 |
| Length | 166 |
| Sequence | MRTAVVRVDVDPSKQLAPERLDEGMVTLREAAAAIGADVIDTDLGSLPPSRRQVEILIAGDDPDELKSIALQLCTKAFGVIGAAPAVGVLTYVSRGTDDDAHGVLAGLGLRGEVHRRPSSEGGPDGPHWDVVTVTVLKADLERVPESRVHTALEASLNCEVYIVTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 4 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 5 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 6 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 69 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 160 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 175 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 178 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 184 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 185 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 186 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 193 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 236 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 237 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 238 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 239 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 240 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 241 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 242 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 243 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 244 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 245 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 268 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 283 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 284 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.51 |
| Nodule | 0.18 |
| Rhizoplane | 9.45 |
| Rhizosphere | 67.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10001574 | 3300001991 | Bacteria | 3208 |
| 2 | JGI24750J21931_1014782 | 3300002070 | Bacteria | 1052 |
| 3 | JGI24744J21845_10008416 | 3300002077 | Bacteria | 2124 |
| 4 | JGI24034J26672_10002420 | 3300002239 | Bacteria | 2564 |
| 5 | JGI24742J22300_10004481 | 3300002244 | Bacteria | 2287 |
| 6 | rootH2_10058472 | 3300003320 | Bacteria | 1581 |
| 7 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 8 | Ga0070676_10046048 | 3300005328 | Bacteria | 2542 |
| 9 | Ga0070690_100075935 | 3300005330 | Bacteria | 2191 |
| 10 | Ga0070670_100405899 | 3300005331 | Bacteria | 1203 |
| 11 | Ga0070666_10049991 | 3300005335 | Bacteria | 2811 |
| 12 | Ga0070666_10272365 | 3300005335 | Bacteria | 1202 |
| 13 | Ga0070682_100007655 | 3300005337 | Bacteria | 6086 |
| 14 | Ga0070682_100021569 | 3300005337 | Bacteria | 3804 |
| 15 | Ga0068868_100001175 | 3300005338 | Bacteria | 17927 |
| 16 | Ga0070660_100166213 | 3300005339 | Bacteria | 1780 |
| 17 | Ga0070689_100390473 | 3300005340 | Bacteria | 1174 |
| 18 | Ga0070691_10002313 | 3300005341 | Bacteria | 8446 |
| 19 | Ga0070692_10013503 | 3300005345 | Bacteria | 3809 |
| 20 | Ga0070668_100001742 | 3300005347 | Bacteria | 15831 |
| 21 | Ga0070668_100696972 | 3300005347 | Bacteria | 895 |
| 22 | Ga0070669_100028149 | 3300005353 | Bacteria | 4046 |
| 23 | Ga0070669_100032393 | 3300005353 | Bacteria | 3775 |
| 24 | Ga0070669_100085651 | 3300005353 | Bacteria | 2353 |
| 25 | Ga0070671_100113252 | 3300005355 | Bacteria | 2279 |
| 26 | Ga0070674_100000563 | 3300005356 | Bacteria | 18666 |
| 27 | Ga0070674_100198695 | 3300005356 | Bacteria | 1547 |
| 28 | Ga0070688_100003575 | 3300005365 | Bacteria | 8016 |
| 29 | Ga0070659_100611097 | 3300005366 | Bacteria | 938 |
| 30 | Ga0070667_100000073 | 3300005367 | Bacteria | 122757 |
| 31 | Ga0070667_100006165 | 3300005367 | Bacteria | 9967 |
| 32 | Ga0070667_100146250 | 3300005367 | Bacteria | 2073 |
| 33 | Ga0070667_100287258 | 3300005367 | Bacteria | 1478 |
| 34 | Ga0070667_100531753 | 3300005367 | Bacteria | 1079 |
| 35 | Ga0070709_10018035 | 3300005434 | Bacteria | 4057 |
| 36 | Ga0070709_10244056 | 3300005434 | Bacteria | 1291 |
| 37 | Ga0070714_100017948 | 3300005435 | Bacteria | 5738 |
| 38 | Ga0070713_100131026 | 3300005436 | Bacteria | 2211 |
| 39 | Ga0070710_10001265 | 3300005437 | Bacteria | 12001 |
| 40 | Ga0070710_10176050 | 3300005437 | Bacteria | 1336 |
| 41 | Ga0070701_10003417 | 3300005438 | Bacteria | 6280 |
| 42 | Ga0070711_100000861 | 3300005439 | Bacteria | 15962 |
| 43 | Ga0070711_100130607 | 3300005439 | Bacteria | 1870 |
| 44 | Ga0070705_100015195 | 3300005440 | Bacteria | 3974 |
| 45 | Ga0070700_100003148 | 3300005441 | Bacteria | 8480 |
| 46 | Ga0070694_100001137 | 3300005444 | Bacteria | 15245 |
| 47 | Ga0070663_100019883 | 3300005455 | Bacteria | 4435 |
| 48 | Ga0070663_100036058 | 3300005455 | Bacteria | 3435 |
| 49 | Ga0070678_100000818 | 3300005456 | Bacteria | 15756 |
| 50 | Ga0070662_100019824 | 3300005457 | Bacteria | 4573 |
| 51 | Ga0070681_10541060 | 3300005458 | Bacteria | 1078 |
| 52 | Ga0068867_100000117 | 3300005459 | Bacteria | 50416 |
| 53 | Ga0070685_10156766 | 3300005466 | Bacteria | 1448 |
| 54 | Ga0070679_100626071 | 3300005530 | Bacteria | 1019 |
| 55 | Ga0068853_100002723 | 3300005539 | Bacteria | 13340 |
| 56 | Ga0068853_101188734 | 3300005539 | Bacteria | 736 |
| 57 | Ga0070686_100402637 | 3300005544 | Bacteria | 1041 |
| 58 | Ga0070695_100045394 | 3300005545 | Bacteria | 2801 |
| 59 | Ga0070696_100087279 | 3300005546 | Bacteria | 2216 |
| 60 | Ga0070696_100607078 | 3300005546 | Bacteria | 883 |
| 61 | Ga0070693_100122106 | 3300005547 | Bacteria | 1617 |
| 62 | Ga0070693_100431909 | 3300005547 | Bacteria | 920 |
| 63 | Ga0070665_100004662 | 3300005548 | Bacteria | 14320 |
| 64 | Ga0070665_100046080 | 3300005548 | Bacteria | 4380 |
| 65 | Ga0070665_100110655 | 3300005548 | Bacteria | 2749 |
| 66 | Ga0070704_100000959 | 3300005549 | Bacteria | 14633 |
| 67 | Ga0068855_100224325 | 3300005563 | Bacteria | 2106 |
| 68 | Ga0068854_100000583 | 3300005578 | Bacteria | 21768 |
| 69 | Ga0068854_100422176 | 3300005578 | Bacteria | 1108 |
| 70 | Ga0068856_100235067 | 3300005614 | Bacteria | 1848 |
| 71 | Ga0070702_100000286 | 3300005615 | Bacteria | 17291 |
| 72 | Ga0068852_100179484 | 3300005616 | Bacteria | 1990 |
| 73 | Ga0068859_100000223 | 3300005617 | Bacteria | 56082 |
| 74 | Ga0068859_100001965 | 3300005617 | Bacteria | 20980 |
| 75 | Ga0068864_100126471 | 3300005618 | Bacteria | 2291 |
| 76 | Ga0068864_100333412 | 3300005618 | Bacteria | 1428 |
| 77 | Ga0068864_100661076 | 3300005618 | Bacteria | 1018 |
| 78 | Ga0068866_10000573 | 3300005718 | Bacteria | 16728 |
| 79 | Ga0068866_10825311 | 3300005718 | Bacteria | 646 |
| 80 | Ga0068861_100000507 | 3300005719 | Bacteria | 22720 |
| 81 | Ga0068861_100627658 | 3300005719 | Bacteria | 990 |
| 82 | Ga0068863_100000587 | 3300005841 | Bacteria | 37032 |
| 83 | Ga0068863_100013142 | 3300005841 | Bacteria | 7991 |
| 84 | Ga0068858_100004229 | 3300005842 | Bacteria | 14135 |
| 85 | Ga0068858_100009407 | 3300005842 | Bacteria | 9325 |
| 86 | Ga0068858_100669304 | 3300005842 | Bacteria | 1009 |
| 87 | Ga0068860_100000127 | 3300005843 | Bacteria | 122766 |
| 88 | Ga0068860_100003792 | 3300005843 | Bacteria | 15553 |
| 89 | Ga0068862_100000052 | 3300005844 | Bacteria | 144622 |
| 90 | Ga0068862_100006603 | 3300005844 | Bacteria | 9619 |
| 91 | Ga0081455_10016795 | 3300005937 | Bacteria | 7042 |
| 92 | Ga0081455_10228023 | 3300005937 | Bacteria | 1377 |
| 93 | Ga0075365_10042967 | 3300006038 | Bacteria | 2957 |
| 94 | Ga0075365_10068523 | 3300006038 | Bacteria | 2384 |
| 95 | Ga0075365_10101143 | 3300006038 | Bacteria | 1974 |
| 96 | Ga0075368_10051880 | 3300006042 | Bacteria | 1631 |
| 97 | Ga0075363_100009271 | 3300006048 | Bacteria | 4623 |
| 98 | Ga0075363_100012390 | 3300006048 | Bacteria | 4110 |
| 99 | Ga0075363_100014948 | 3300006048 | Bacteria | 3806 |
| 100 | Ga0075363_100033166 | 3300006048 | Bacteria | 2687 |
| 101 | Ga0075363_100085290 | 3300006048 | Bacteria | 1732 |
| 102 | Ga0075363_100106334 | 3300006048 | Bacteria | 1557 |
| 103 | Ga0075363_100190080 | 3300006048 | Bacteria | 1171 |
| 104 | Ga0075363_100289873 | 3300006048 | Bacteria | 948 |
| 105 | Ga0075363_100310056 | 3300006048 | Bacteria | 917 |
| 106 | Ga0075364_10002949 | 3300006051 | Bacteria | 9595 |
| 107 | Ga0075364_10003160 | 3300006051 | Bacteria | 9321 |
| 108 | Ga0075364_10030170 | 3300006051 | Bacteria | 3479 |
| 109 | Ga0075364_10061710 | 3300006051 | Bacteria | 2459 |
| 110 | Ga0075364_10116159 | 3300006051 | Bacteria | 1789 |
| 111 | Ga0075364_10119505 | 3300006051 | Bacteria | 1763 |
| 112 | Ga0075364_10173576 | 3300006051 | Bacteria | 1457 |
| 113 | Ga0075364_10493591 | 3300006051 | Bacteria | 837 |
| 114 | Ga0070715_10014293 | 3300006163 | Bacteria | 2937 |
| 115 | Ga0070716_100015321 | 3300006173 | Bacteria | 3938 |
| 116 | Ga0070716_100046065 | 3300006173 | Bacteria | 2452 |
| 117 | Ga0070716_100269425 | 3300006173 | Bacteria | 1169 |
| 118 | Ga0070712_100002997 | 3300006175 | Bacteria | 10452 |
| 119 | Ga0070712_100690952 | 3300006175 | Bacteria | 869 |
| 120 | Ga0070712_100694520 | 3300006175 | Bacteria | 867 |
| 121 | Ga0075362_10059173 | 3300006177 | Bacteria | 1730 |
| 122 | Ga0075362_10059237 | 3300006177 | Bacteria | 1729 |
| 123 | Ga0075362_10107273 | 3300006177 | Bacteria | 1312 |
| 124 | Ga0075362_10182618 | 3300006177 | Bacteria | 1017 |
| 125 | Ga0075367_10043234 | 3300006178 | Bacteria | 2639 |
| 126 | Ga0075367_10071419 | 3300006178 | Bacteria | 2088 |
| 127 | Ga0075367_10133053 | 3300006178 | Bacteria | 1538 |
| 128 | Ga0075369_10021606 | 3300006186 | Bacteria | 2646 |
| 129 | Ga0075369_10028838 | 3300006186 | Bacteria | 2329 |
| 130 | Ga0075369_10031814 | 3300006186 | Bacteria | 2229 |
| 131 | Ga0075369_10033262 | 3300006186 | Bacteria | 2184 |
| 132 | Ga0075369_10065547 | 3300006186 | Bacteria | 1592 |
| 133 | Ga0075369_10112334 | 3300006186 | Bacteria | 1228 |
| 134 | Ga0075366_10056414 | 3300006195 | Bacteria | 2333 |
| 135 | Ga0075370_10003723 | 3300006353 | Bacteria | 7298 |
| 136 | Ga0075370_10012155 | 3300006353 | Bacteria | 4542 |
| 137 | Ga0075370_10026300 | 3300006353 | Bacteria | 3223 |
| 138 | Ga0075370_10111484 | 3300006353 | Bacteria | 1589 |
| 139 | Ga0075370_10245465 | 3300006353 | Bacteria | 1061 |
| 140 | Ga0075428_100000149 | 3300006844 | Bacteria | 63444 |
| 141 | Ga0075430_100023965 | 3300006846 | Bacteria | 5197 |
| 142 | Ga0075431_100297113 | 3300006847 | Bacteria | 1632 |
| 143 | Ga0075429_100505277 | 3300006880 | Bacteria | 1059 |
| 144 | Ga0068865_100007593 | 3300006881 | Bacteria | 6675 |
| 145 | Ga0068865_100201640 | 3300006881 | Bacteria | 1545 |
| 146 | Ga0097620_100000223 | 3300006931 | Bacteria | 56082 |
| 147 | Ga0097620_100001965 | 3300006931 | Bacteria | 20980 |
| 148 | Ga0099795_10011365 | 3300007788 | Bacteria | 2660 |
| 149 | Ga0105250_10064935 | 3300009092 | Bacteria | 1471 |
| 150 | Ga0105245_10002923 | 3300009098 | Bacteria | 15332 |
| 151 | Ga0105247_10000066 | 3300009101 | Bacteria | 121025 |
| 152 | Ga0105247_10005571 | 3300009101 | Bacteria | 7913 |
| 153 | Ga0114129_10033330 | 3300009147 | Bacteria | 7278 |
| 154 | Ga0114129_11140618 | 3300009147 | Bacteria | 974 |
| 155 | Ga0114129_11747384 | 3300009147 | Bacteria | 758 |
| 156 | Ga0105243_10002003 | 3300009148 | Bacteria | 17327 |
| 157 | Ga0105243_10547029 | 3300009148 | Bacteria | 1105 |
| 158 | Ga0105242_10000979 | 3300009176 | Bacteria | 22301 |
| 159 | Ga0105242_10990595 | 3300009176 | Bacteria | 847 |
| 160 | Ga0105248_10000613 | 3300009177 | Bacteria | 40714 |
| 161 | Ga0105248_11242667 | 3300009177 | Bacteria | 842 |
| 162 | Ga0105237_10009594 | 3300009545 | Bacteria | 10364 |
| 163 | Ga0105237_10020056 | 3300009545 | Bacteria | 6901 |
| 164 | Ga0105237_10223591 | 3300009545 | Bacteria | 1883 |
| 165 | Ga0105238_10116699 | 3300009551 | Bacteria | 2649 |
| 166 | Ga0105238_10163046 | 3300009551 | Bacteria | 2205 |
| 167 | Ga0105249_10000093 | 3300009553 | Bacteria | 122840 |
| 168 | Ga0105249_10001158 | 3300009553 | Bacteria | 23315 |
| 169 | Ga0105249_10138044 | 3300009553 | Bacteria | 2335 |
| 170 | Ga0105239_10026074 | 3300010375 | Bacteria | 6435 |
| 171 | Ga0105239_10051386 | 3300010375 | Bacteria | 4519 |
| 172 | Ga0105239_10743802 | 3300010375 | Bacteria | 1122 |
| 173 | Ga0157371_10064389 | 3300013102 | Bacteria | 2598 |
| 174 | Ga0157369_10262280 | 3300013105 | Bacteria | 1802 |
| 175 | Ga0157374_10372306 | 3300013296 | Bacteria | 1422 |
| 176 | Ga0157378_10002180 | 3300013297 | Bacteria | 17360 |
| 177 | Ga0157378_12397833 | 3300013297 | Bacteria | 579 |
| 178 | Ga0157378_12433133 | 3300013297 | Unclassified | 575 |
| 179 | Ga0163162_10006763 | 3300013306 | Bacteria | 11128 |
| 180 | Ga0163162_10089548 | 3300013306 | Bacteria | 3158 |
| 181 | Ga0163162_10203017 | 3300013306 | Bacteria | 2111 |
| 182 | Ga0163162_12281638 | 3300013306 | Bacteria | 622 |
| 183 | Ga0157372_10007056 | 3300013307 | Bacteria | 11968 |
| 184 | Ga0157375_10000151 | 3300013308 | Bacteria | 68008 |
| 185 | Ga0163163_10012823 | 3300014325 | Bacteria | 7649 |
| 186 | Ga0163163_10037556 | 3300014325 | Bacteria | 4713 |
| 187 | Ga0163163_10088824 | 3300014325 | Bacteria | 3102 |
| 188 | Ga0157380_10008689 | 3300014326 | Bacteria | 7259 |
| 189 | Ga0157377_10180754 | 3300014745 | Bacteria | 1326 |
| 190 | Ga0157379_10006897 | 3300014968 | Bacteria | 9822 |
| 191 | Ga0157379_10050118 | 3300014968 | Bacteria | 3727 |
| 192 | Ga0157376_10072772 | 3300014969 | Bacteria | 2925 |
| 193 | Ga0163161_10002439 | 3300017792 | Bacteria | 13286 |
| 194 | Ga0213874_10026576 | 3300021377 | Bacteria | 1640 |
| 195 | Ga0213876_10000674 | 3300021384 | Bacteria | 24320 |
| 196 | Ga0213876_10011710 | 3300021384 | Bacteria | 4681 |
| 197 | Ga0213876_10013547 | 3300021384 | Bacteria | 4327 |
| 198 | Ga0213876_10165481 | 3300021384 | Bacteria | 1177 |
| 199 | Ga0213875_10023757 | 3300021388 | Bacteria | 2926 |
| 200 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 201 | Ga0207692_10016581 | 3300025898 | Bacteria | 3267 |
| 202 | Ga0207642_10002214 | 3300025899 | Bacteria | 6030 |
| 203 | Ga0207710_10000090 | 3300025900 | Bacteria | 121405 |
| 204 | Ga0207710_10009664 | 3300025900 | Bacteria | 4053 |
| 205 | Ga0207688_10000025 | 3300025901 | Bacteria | 48564 |
| 206 | Ga0207680_10072025 | 3300025903 | Bacteria | 2144 |
| 207 | Ga0207680_10298399 | 3300025903 | Bacteria | 1123 |
| 208 | Ga0207685_10003762 | 3300025905 | Bacteria | 3745 |
| 209 | Ga0207699_10006989 | 3300025906 | Bacteria | 5497 |
| 210 | Ga0207645_10240688 | 3300025907 | Bacteria | 1195 |
| 211 | Ga0207707_10454582 | 3300025912 | Bacteria | 1096 |
| 212 | Ga0207671_10007814 | 3300025914 | Bacteria | 9198 |
| 213 | Ga0207671_10019240 | 3300025914 | Bacteria | 5225 |
| 214 | Ga0207671_10225288 | 3300025914 | Bacteria | 1470 |
| 215 | Ga0207693_10000123 | 3300025915 | Bacteria | 69311 |
| 216 | Ga0207663_10009847 | 3300025916 | Bacteria | 5059 |
| 217 | Ga0207663_10954634 | 3300025916 | Bacteria | 687 |
| 218 | Ga0207681_10005438 | 3300025923 | Bacteria | 7822 |
| 219 | Ga0207681_10011516 | 3300025923 | Bacteria | 5433 |
| 220 | Ga0207694_10205682 | 3300025924 | Bacteria | 1602 |
| 221 | Ga0207687_10199505 | 3300025927 | Bacteria | 1563 |
| 222 | Ga0207700_10282393 | 3300025928 | Bacteria | 1428 |
| 223 | Ga0207664_10184127 | 3300025929 | Bacteria | 1794 |
| 224 | Ga0207644_10055312 | 3300025931 | Bacteria | 2860 |
| 225 | Ga0207644_10059568 | 3300025931 | Bacteria | 2761 |
| 226 | Ga0207644_10113368 | 3300025931 | Bacteria | 2053 |
| 227 | Ga0207690_10091240 | 3300025932 | Bacteria | 2153 |
| 228 | Ga0207706_10005323 | 3300025933 | Bacteria | 11997 |
| 229 | Ga0207686_10001243 | 3300025934 | Bacteria | 14738 |
| 230 | Ga0207709_10021107 | 3300025935 | Bacteria | 3683 |
| 231 | Ga0207669_10000400 | 3300025937 | Bacteria | 19143 |
| 232 | Ga0207704_10000325 | 3300025938 | Bacteria | 22184 |
| 233 | Ga0207665_10008251 | 3300025939 | Bacteria | 6875 |
| 234 | Ga0207665_10082774 | 3300025939 | Bacteria | 2212 |
| 235 | Ga0207665_10453959 | 3300025939 | Bacteria | 984 |
| 236 | Ga0207711_10000183 | 3300025941 | Bacteria | 67270 |
| 237 | Ga0207667_10318000 | 3300025949 | Bacteria | 1590 |
| 238 | Ga0207712_10000073 | 3300025961 | Bacteria | 123046 |
| 239 | Ga0207712_10006113 | 3300025961 | Bacteria | 7597 |
| 240 | Ga0207712_10616414 | 3300025961 | Bacteria | 940 |
| 241 | Ga0207640_10000582 | 3300025981 | Bacteria | 21781 |
| 242 | Ga0207640_10867911 | 3300025981 | Bacteria | 786 |
| 243 | Ga0207658_10000304 | 3300025986 | Bacteria | 50815 |
| 244 | Ga0207658_10003640 | 3300025986 | Bacteria | 10879 |
| 245 | Ga0207658_10007427 | 3300025986 | Bacteria | 7475 |
| 246 | Ga0207658_10042565 | 3300025986 | Bacteria | 3295 |
| 247 | Ga0207658_10289095 | 3300025986 | Bacteria | 1408 |
| 248 | Ga0207658_10382148 | 3300025986 | Bacteria | 1233 |
| 249 | Ga0207677_10009499 | 3300026023 | Bacteria | 5475 |
| 250 | Ga0207703_10005075 | 3300026035 | Bacteria | 10656 |
| 251 | Ga0207703_10010298 | 3300026035 | Bacteria | 7323 |
| 252 | Ga0207678_10006722 | 3300026067 | Bacteria | 10198 |
| 253 | Ga0207678_10029559 | 3300026067 | Bacteria | 4783 |
| 254 | Ga0207708_10000452 | 3300026075 | Bacteria | 31890 |
| 255 | Ga0207708_10361553 | 3300026075 | Bacteria | 1193 |
| 256 | Ga0207702_10618438 | 3300026078 | Bacteria | 1064 |
| 257 | Ga0207641_10000413 | 3300026088 | Bacteria | 49861 |
| 258 | Ga0207641_10008652 | 3300026088 | Bacteria | 8404 |
| 259 | Ga0207648_10000381 | 3300026089 | Bacteria | 48976 |
| 260 | Ga0207676_10269958 | 3300026095 | Bacteria | 1540 |
| 261 | Ga0207676_10271194 | 3300026095 | Bacteria | 1537 |
| 262 | Ga0207675_100000406 | 3300026118 | Bacteria | 41422 |
| 263 | Ga0207675_101186887 | 3300026118 | Bacteria | 783 |
| 264 | Ga0207683_10001482 | 3300026121 | Bacteria | 21160 |
| 265 | Ga0207683_10618513 | 3300026121 | Bacteria | 1003 |
| 266 | Ga0207698_10587445 | 3300026142 | Bacteria | 1096 |
| 267 | Ga0268266_10007258 | 3300028379 | Bacteria | 10020 |
| 268 | Ga0268266_10061743 | 3300028379 | Bacteria | 3232 |
| 269 | Ga0268266_10087000 | 3300028379 | Bacteria | 2733 |
| 270 | Ga0268265_10000063 | 3300028380 | Bacteria | 144643 |
| 271 | Ga0268265_10011038 | 3300028380 | Bacteria | 6101 |
| 272 | Ga0268265_10036750 | 3300028380 | Bacteria | 3589 |
| 273 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 274 | Ga0268264_10009176 | 3300028381 | Bacteria | 8195 |
| 275 | Ga0307511_10193734 | 3300030521 | Bacteria | 1069 |
| 276 | Ga0265327_10001674 | 3300031251 | Bacteria | 26619 |
| 277 | Ga0307405_10388196 | 3300031731 | Bacteria | 1089 |
| 278 | Ga0307410_10102661 | 3300031852 | Bacteria | 2052 |
| 279 | Ga0307410_10150343 | 3300031852 | Bacteria | 1733 |
| 280 | Ga0307409_100209857 | 3300031995 | Bacteria | 1749 |
| 281 | Ga0307409_100885158 | 3300031995 | Bacteria | 906 |
| 282 | Ga0307409_100895520 | 3300031995 | Bacteria | 901 |
| 283 | Ga0307409_101311706 | 3300031995 | Bacteria | 749 |
| 284 | Ga0307416_100030887 | 3300032002 | Bacteria | 4026 |
| 285 | Ga0307415_100515876 | 3300032126 | Bacteria | 1048 |
| 286 | Ga0373960_0097009 | 3300035121 | Bacteria | 950 |
| 287 | Ga0373943_0147883 | 3300035170 | Bacteria | 1271 |
| 288 | Ga0373931_0031120 | 3300035691 | Bacteria | 2752 |
| 289 | Ga0373931_0345922 | 3300035691 | Bacteria | 930 |
| 290 | Ga0373927_0446391 | 3300035695 | Bacteria | 854 |
| 291 | Ga0316584_0038500 | 3300036712 | Bacteria | 3557 |
| 292 | Ga0373925_0697568 | 3300037068 | Bacteria | 837 |
| 293 | Ga0436364_0448603 | 3300037853 | Bacteria | 3112 |
| 294 | Ga0436364_1184081 | 3300037853 | Bacteria | 5385 |
| 295 | Ga0436365_0016980 | 3300039437 | Bacteria | 29756 |
| 296 | Ga0436365_0119240 | 3300039437 | Bacteria | 17758 |
| 297 | Ga0436365_0347716 | 3300039437 | Bacteria | 1774 |
| 298 | Ga0436365_0731445 | 3300039437 | Bacteria | 19835 |
| 299 | Ga0436365_1212976 | 3300039437 | Bacteria | 1446 |
| 300 | Ga0436365_1664352 | 3300039437 | Bacteria | 3811 |
| 301 | Ga0436360_0492879 | 3300039438 | Bacteria | 588 |
| 302 | Ga0436361_0751346 | 3300039447 | Bacteria | 637 |
| 303 | Ga0436363_0746391 | 3300039450 | Bacteria | 718 |
| 304 | Ga0436363_1397604 | 3300039450 | Bacteria | 5061 |
| 305 | Ga0436363_1576561 | 3300039450 | Bacteria | 1022 |
| 306 | Ga0436362_1020382 | 3300039453 | Bacteria | 564 |
| 307 | Ga0436362_1084299 | 3300039453 | Bacteria | 772 |
| 308 | Ga0439466_0046181 | 3300041411 | Bacteria | 1439 |
| 309 | Ga0439466_0074647 | 3300041411 | Bacteria | 1075 |
| 310 | Ga0439465_0001090 | 3300041413 | Bacteria | 8696 |
| 311 | Ga0439465_0007860 | 3300041413 | Bacteria | 3379 |
| 312 | Ga0439465_0016208 | 3300041413 | Bacteria | 2324 |
| 313 | Ga0451789_0556179 | 3300041443 | Bacteria | 802 |
| 314 | Ga0451793_1520913 | 3300041452 | Bacteria | 667 |
| 315 | Ga0451802_0501702 | 3300041460 | Bacteria | 918 |
| 316 | Ga0451839_0495621 | 3300041496 | Bacteria | 867 |
| 317 | Ga0451851_1183602 | 3300041507 | Bacteria | 828 |
| 318 | Ga0439442_077698 | 3300042002 | Bacteria | 709 |
| 319 | Ga0439445_0014459 | 3300042004 | Bacteria | 1922 |
| 320 | Ga0439448_0015051 | 3300042005 | Bacteria | 2340 |
| 321 | Ga0450906_076488 | 3300042145 | Bacteria | 602 |
| 322 | Ga0439434_0030541 | 3300042435 | Bacteria | 1636 |
| 323 | Ga0466972_0034477 | 3300044658 | Bacteria | 2479 |
| 324 | Ga0466972_0068577 | 3300044658 | Bacteria | 1694 |
| 325 | Ga0466972_0309961 | 3300044658 | Bacteria | 737 |
| 326 | Ga0466965_0002055 | 3300044683 | Bacteria | 8431 |
| 327 | Ga0466965_0002997 | 3300044683 | Bacteria | 7329 |
| 328 | Ga0466965_0203888 | 3300044683 | Bacteria | 1050 |
| 329 | Ga0466965_0281658 | 3300044683 | Bacteria | 898 |
| 330 | Ga0466965_0357703 | 3300044683 | Bacteria | 801 |
| 331 | Ga0466961_0010397 | 3300044693 | Bacteria | 5939 |
| 332 | Ga0466961_0042451 | 3300044693 | Bacteria | 2915 |
| 333 | Ga0466963_0140783 | 3300044694 | Bacteria | 1671 |
| 334 | Ga0466963_0626646 | 3300044694 | Bacteria | 759 |
| 335 | Ga0466968_0001326 | 3300044735 | Bacteria | 8858 |
| 336 | Ga0466968_0277801 | 3300044735 | Bacteria | 801 |
| 337 | Ga0466970_0017334 | 3300044765 | Bacteria | 3721 |
| 338 | Ga0466970_0122508 | 3300044765 | Bacteria | 1425 |
| 339 | Ga0466957_0005427 | 3300044842 | Bacteria | 7159 |
| 340 | Ga0466957_0007638 | 3300044842 | Bacteria | 6115 |
| 341 | Ga0466957_0032729 | 3300044842 | Bacteria | 3115 |
| 342 | Ga0466957_0223482 | 3300044842 | Bacteria | 1244 |
| 343 | Ga0466957_0257922 | 3300044842 | Bacteria | 1161 |
| 344 | Ga0466957_0419629 | 3300044842 | Bacteria | 918 |
| 345 | Ga0466960_0000320 | 3300044901 | Bacteria | 16474 |
| 346 | Ga0466960_0001519 | 3300044901 | Bacteria | 8452 |
| 347 | Ga0466960_0001941 | 3300044901 | Bacteria | 7645 |
| 348 | Ga0466960_0450449 | 3300044901 | Bacteria | 748 |
| 349 | Ga0466960_0587416 | 3300044901 | Bacteria | 660 |
| 350 | Ga0466960_0590682 | 3300044901 | Bacteria | 658 |
| 351 | Ga0466959_0001756 | 3300045049 | Bacteria | 13505 |
| 352 | Ga0466959_0536802 | 3300045049 | Bacteria | 789 |
| 353 | Ga0466959_0731807 | 3300045049 | Bacteria | 662 |
| 354 | Ga0466958_0073149 | 3300045836 | Bacteria | 2100 |
| 355 | Ga0466958_0102303 | 3300045836 | Bacteria | 1782 |
| 356 | Ga0466958_0129948 | 3300045836 | Bacteria | 1581 |
| 357 | Ga0466958_0257798 | 3300045836 | Bacteria | 1116 |
| 358 | Ga0466958_0617525 | 3300045836 | Bacteria | 705 |
| 359 | Ga0466967_0002447 | 3300045976 | Bacteria | 11559 |
| 360 | Ga0466967_0002855 | 3300045976 | Bacteria | 10973 |
| 361 | Ga0466967_0005640 | 3300045976 | Bacteria | 8712 |
| 362 | Ga0466967_0015951 | 3300045976 | Bacteria | 5907 |
| 363 | Ga0466967_0042813 | 3300045976 | Bacteria | 3916 |
| 364 | Ga0466967_0129856 | 3300045976 | Bacteria | 2338 |
| 365 | Ga0466967_0307239 | 3300045976 | Bacteria | 1527 |
| 366 | Ga0466967_0616038 | 3300045976 | Bacteria | 1072 |
| 367 | Ga0466967_0889842 | 3300045976 | Bacteria | 885 |
| 368 | Ga0466967_1400377 | 3300045976 | Bacteria | 696 |
| 369 | Ga0466967_1455805 | 3300045976 | Bacteria | 682 |
| 370 | Ga0466967_2174205 | 3300045976 | Bacteria | 551 |
| 371 | Ga0495629_0039368 | 3300046459 | Bacteria | 3327 |
| 372 | Ga0495638_0002780 | 3300046460 | Bacteria | 14050 |
| 373 | Ga0495641_0013995 | 3300046461 | Bacteria | 4367 |
| 374 | Ga0495650_0144127 | 3300046471 | Bacteria | 860 |
| 375 | Ga0495606_0065956 | 3300046507 | Bacteria | 2298 |
| 376 | Ga0495616_0192408 | 3300046513 | Bacteria | 901 |
| 377 | Ga0495665_0080424 | 3300046531 | Bacteria | 1714 |
| 378 | Ga0495640_0015166 | 3300046533 | Bacteria | 5803 |
| 379 | Ga0495667_0392075 | 3300046559 | Bacteria | 875 |
| 380 | Ga0495668_0155376 | 3300046616 | Bacteria | 1253 |
| 381 | Ga0495625_0147894 | 3300046660 | Bacteria | 1581 |
| 382 | Ga0495658_0012503 | 3300046683 | Bacteria | 4304 |
| 383 | Ga0495671_0076765 | 3300046692 | Bacteria | 1638 |
| 384 | Ga0495672_0103539 | 3300047320 | Bacteria | 1540 |
| 385 | Ga0495676_0356819 | 3300047321 | Bacteria | 976 |
| 386 | Ga0495686_0000940 | 3300047472 | Bacteria | 36165 |
| 387 | Ga0495686_0164803 | 3300047472 | Bacteria | 1292 |
| 388 | Ga0495593_0006029 | 3300047673 | Bacteria | 7131 |
| 389 | Ga0495614_0066438 | 3300048089 | Bacteria | 1551 |
| 390 | Ga0495626_0039009 | 3300048091 | Bacteria | 2249 |
| 391 | Ga0496100_0001254 | 3300048903 | Bacteria | 12378 |
| 392 | Ga0496100_0006694 | 3300048903 | Bacteria | 6305 |
| 393 | Ga0496100_0079741 | 3300048903 | Bacteria | 2207 |
| 394 | Ga0496100_0233972 | 3300048903 | Bacteria | 1353 |
| 395 | Ga0496100_1317915 | 3300048903 | Bacteria | 570 |
| 396 | Ga0496101_0035226 | 3300048904 | Bacteria | 3539 |
| 397 | Ga0496101_0045273 | 3300048904 | Bacteria | 3151 |
| 398 | Ga0496101_0049531 | 3300048904 | Bacteria | 3022 |
| 399 | Ga0496101_0175593 | 3300048904 | Bacteria | 1648 |
| 400 | Ga0496101_0398029 | 3300048904 | Bacteria | 1084 |
| 401 | Ga0496102_0000168 | 3300048905 | Bacteria | 88511 |
| 402 | Ga0496102_0002086 | 3300048905 | Bacteria | 17193 |
| 403 | Ga0496102_0019989 | 3300048905 | Bacteria | 5908 |
| 404 | Ga0496102_0057771 | 3300048905 | Bacteria | 3544 |
| 405 | Ga0496102_0709530 | 3300048905 | Bacteria | 929 |
| 406 | Ga0496102_1406995 | 3300048905 | Bacteria | 616 |
| 407 | Ga0496103_0000991 | 3300048906 | Bacteria | 20033 |
| 408 | Ga0496103_0031558 | 3300048906 | Bacteria | 3228 |
| 409 | Ga0496103_0045239 | 3300048906 | Bacteria | 2716 |
| 410 | Ga0496103_0084642 | 3300048906 | Bacteria | 1998 |
| 411 | Ga0496103_0207235 | 3300048906 | Bacteria | 1261 |
| 412 | Ga0496104_0012733 | 3300048907 | Bacteria | 7577 |
| 413 | Ga0496105_0047005 | 3300048908 | Bacteria | 3562 |
| 414 | Ga0496106_0001129 | 3300048909 | Bacteria | 19754 |
| 415 | Ga0496106_0545886 | 3300048909 | Bacteria | 930 |
| 416 | Ga0496107_0000495 | 3300048910 | Bacteria | 21738 |
| 417 | Ga0496107_0015409 | 3300048910 | Bacteria | 5357 |
| 418 | Ga0496108_0022268 | 3300048911 | Bacteria | 5211 |
| 419 | Ga0496108_0485719 | 3300048911 | Bacteria | 1079 |
| 420 | Ga0496108_1003628 | 3300048911 | Bacteria | 713 |
| 421 | Ga0496109_0032986 | 3300048912 | Bacteria | 4658 |
| 422 | Ga0496109_0176908 | 3300048912 | Bacteria | 2003 |
| 423 | Ga0496109_0285433 | 3300048912 | Bacteria | 1556 |
| 424 | Ga0496110_0019813 | 3300048913 | Bacteria | 5669 |
| 425 | Ga0496110_0029838 | 3300048913 | Bacteria | 4699 |
| 426 | Ga0496112_0010535 | 3300048915 | Bacteria | 8394 |
| 427 | Ga0496112_0043922 | 3300048915 | Bacteria | 4376 |
| 428 | Ga0496112_0355356 | 3300048915 | Bacteria | 1407 |
| 429 | Ga0496112_0625299 | 3300048915 | Bacteria | 1008 |
| 430 | Ga0496113_0005415 | 3300048916 | Bacteria | 7956 |
| 431 | Ga0496113_0337388 | 3300048916 | Bacteria | 1209 |
| 432 | Ga0496113_0414811 | 3300048916 | Bacteria | 1081 |
| 433 | Ga0496113_0420966 | 3300048916 | Bacteria | 1073 |
| 434 | Ga0496114_0000419 | 3300048917 | Bacteria | 31425 |
| 435 | Ga0496114_0597929 | 3300048917 | Bacteria | 973 |
| 436 | Ga0496114_0636767 | 3300048917 | Bacteria | 939 |
| 437 | Ga0496114_1136240 | 3300048917 | Bacteria | 666 |
| 438 | Ga0496115_0090795 | 3300048918 | Bacteria | 2495 |
| 439 | Ga0496115_0146957 | 3300048918 | Bacteria | 1946 |
| 440 | Ga0496115_0751539 | 3300048918 | Bacteria | 762 |
| 441 | Ga0496116_0015907 | 3300048919 | Bacteria | 5918 |
| 442 | Ga0496117_0008185 | 3300048920 | Bacteria | 9978 |
| 443 | Ga0496118_0000171 | 3300048921 | Bacteria | 117495 |
| 444 | Ga0496119_0003283 | 3300048922 | Bacteria | 16913 |
| 445 | Ga0496120_0017049 | 3300048923 | Bacteria | 4723 |
| 446 | Ga0496120_0073458 | 3300048923 | Bacteria | 1872 |
| 447 | Ga0496120_0323768 | 3300048923 | Bacteria | 699 |
| 448 | Ga0496121_0013914 | 3300048924 | Bacteria | 8599 |
| 449 | Ga0496122_0057779 | 3300048925 | Bacteria | 2877 |
| 450 | Ga0496123_0062741 | 3300048926 | Bacteria | 2378 |
| 451 | Ga0496124_0072339 | 3300048927 | Bacteria | 2855 |
| 452 | Ga0496125_0121012 | 3300048928 | Bacteria | 1867 |
| 453 | Ga0496125_0474678 | 3300048928 | Bacteria | 710 |
| 454 | Ga0496126_0004133 | 3300048929 | Bacteria | 17554 |
| 455 | Ga0496126_0032421 | 3300048929 | Bacteria | 4922 |
| 456 | Ga0496126_0589400 | 3300048929 | Bacteria | 877 |
| 457 | Ga0501032_0000510 | 3300049569 | Bacteria | 31534 |
| 458 | Ga0501032_0202148 | 3300049569 | Bacteria | 1296 |
| 459 | Ga0501032_0461352 | 3300049569 | Bacteria | 813 |
| 460 | Ga0501033_0006101 | 3300049570 | Bacteria | 9453 |
| 461 | Ga0501033_0052419 | 3300049570 | Bacteria | 3024 |
| 462 | Ga0501033_0452714 | 3300049570 | Bacteria | 891 |
| 463 | Ga0501034_0001987 | 3300049571 | Bacteria | 25894 |
| 464 | Ga0501034_0005475 | 3300049571 | Bacteria | 13863 |
| 465 | Ga0501034_0130096 | 3300049571 | Bacteria | 2501 |
| 466 | Ga0501034_0163709 | 3300049571 | Bacteria | 2194 |
| 467 | Ga0501034_0855028 | 3300049571 | Bacteria | 800 |
| 468 | Ga0501036_0002002 | 3300049572 | Bacteria | 15830 |
| 469 | Ga0501036_0356474 | 3300049572 | Bacteria | 1221 |
| 470 | Ga0501037_0000677 | 3300049573 | Bacteria | 26104 |
| 471 | Ga0501037_0028731 | 3300049573 | Bacteria | 4108 |
| 472 | Ga0501037_0073325 | 3300049573 | Bacteria | 2489 |
| 473 | Ga0501038_0001664 | 3300049574 | Bacteria | 20619 |
| 474 | Ga0501038_0791088 | 3300049574 | Bacteria | 705 |
| 475 | Ga0501039_0000157 | 3300049575 | Bacteria | 46924 |
| 476 | Ga0501043_0000971 | 3300049579 | Bacteria | 25346 |
| 477 | Ga0501043_0015753 | 3300049579 | Bacteria | 5927 |
| 478 | Ga0501046_0004078 | 3300049580 | Bacteria | 13317 |
| 479 | Ga0501047_0001180 | 3300049581 | Bacteria | 25903 |
| 480 | Ga0501047_0107234 | 3300049581 | Bacteria | 2675 |
| 481 | Ga0501047_0172077 | 3300049581 | Bacteria | 2034 |
| 482 | Ga0501047_0228914 | 3300049581 | Bacteria | 1713 |
| 483 | Ga0501048_0003008 | 3300049582 | Bacteria | 12870 |
| 484 | Ga0501067_0083526 | 3300049583 | Bacteria | 1772 |
| 485 | Ga0501069_0432167 | 3300049585 | Bacteria | 781 |
| 486 | Ga0501070_0001412 | 3300049586 | Bacteria | 21509 |
| 487 | Ga0501070_0001918 | 3300049586 | Bacteria | 18362 |
| 488 | Ga0501073_0027278 | 3300049589 | Bacteria | 4086 |
| 489 | Ga0501073_0334497 | 3300049589 | Bacteria | 1045 |
| 490 | Ga0501077_0158860 | 3300049593 | Bacteria | 1435 |
| 491 | Ga0501079_0646871 | 3300049741 | Bacteria | 832 |
| 492 | Ga0501080_0155597 | 3300049742 | Bacteria | 2112 |
| 493 | Ga0501080_0692911 | 3300049742 | Bacteria | 899 |
| 494 | Ga0501083_0232171 | 3300049744 | Bacteria | 1201 |
| 495 | Ga0501035_0000385 | 3300049822 | Bacteria | 50730 |
| 496 | Ga0501035_0003413 | 3300049822 | Bacteria | 15199 |
| 497 | Ga0501035_0466896 | 3300049822 | Bacteria | 1042 |
| 498 | Ga0501035_1262363 | 3300049822 | Bacteria | 571 |
| 499 | Ga0501044_0001111 | 3300049823 | Bacteria | 31958 |
| 500 | Ga0501044_0018055 | 3300049823 | Bacteria | 7565 |
| 501 | Ga0501044_0403055 | 3300049823 | Bacteria | 1280 |
| 502 | nmdc:mga03683_224189_c1 | 3300050489 | Bacteria | 868 |
| 503 | nmdc:mga03683_71799_c1 | 3300050489 | Bacteria | 1481 |
| 504 | nmdc:mga03n38_148924_c1 | 3300050490 | Bacteria | 1176 |
| 505 | nmdc:mga03n38_1616_c1 | 3300050490 | Bacteria | 6579 |
| 506 | nmdc:mga03n38_20054_c1 | 3300050490 | Bacteria | 2668 |
| 507 | nmdc:mga03n38_235480_c1 | 3300050490 | Bacteria | 961 |
| 508 | nmdc:mga03n38_294965_c1 | 3300050490 | Bacteria | 869 |
| 509 | nmdc:mga03n38_59612_c1 | 3300050490 | Bacteria | 1733 |
| 510 | nmdc:mga03n38_8154_c1 | 3300050490 | Bacteria | 3744 |
| 511 | nmdc:mga00v17_1224_c1 | 3300050491 | Bacteria | 13469 |
| 512 | nmdc:mga00v17_17049_c1 | 3300050491 | Bacteria | 4102 |
| 513 | nmdc:mga00v17_24459_c1 | 3300050491 | Bacteria | 3505 |
| 514 | nmdc:mga00v17_417445_c1 | 3300050491 | Bacteria | 872 |
| 515 | nmdc:mga00v17_5015_c1 | 3300050491 | Bacteria | 6949 |
| 516 | nmdc:mga00v17_512928_c1 | 3300050491 | Bacteria | 777 |
| 517 | nmdc:mga0yw44_141802_c1 | 3300050492 | Bacteria | 1562 |
| 518 | nmdc:mga0yw44_182206_c1 | 3300050492 | Bacteria | 1383 |
| 519 | nmdc:mga0yw44_185616_c1 | 3300050492 | Bacteria | 1370 |
| 520 | nmdc:mga0yw44_5588_c1 | 3300050492 | Bacteria | 5969 |
| 521 | nmdc:mga0yw44_93741_c1 | 3300050492 | Bacteria | 1902 |
| 522 | nmdc:mga0k408_43381_c1 | 3300050493 | Bacteria | 1583 |
| 523 | nmdc:mga0k408_64805_c1 | 3300050493 | Bacteria | 2126 |
| 524 | nmdc:mga06z11_126411_c1 | 3300050494 | Bacteria | 1431 |
| 525 | nmdc:mga06z11_146969_c1 | 3300050494 | Bacteria | 1337 |
| 526 | nmdc:mga06z11_85528_c1 | 3300050494 | Bacteria | 1701 |
| 527 | nmdc:mga07m45_120289_c1 | 3300050496 | Bacteria | 1516 |
| 528 | nmdc:mga07m45_147909_c1 | 3300050496 | Bacteria | 1362 |
| 529 | nmdc:mga07m45_1850_c1 | 3300050496 | Bacteria | 9775 |
| 530 | nmdc:mga07m45_2352_c1 | 3300050496 | Bacteria | 8878 |
| 531 | nmdc:mga07m45_3834_c1 | 3300050496 | Bacteria | 7283 |
| 532 | nmdc:mga07m45_95942_c1 | 3300050496 | Bacteria | 1701 |
| 533 | nmdc:mga05p37_7689_c2 | 3300050507 | Bacteria | 4594 |
| 534 | nmdc:mga09592_484911_c1 | 3300050508 | Bacteria | 1065 |
| 535 | nmdc:mga0qj67_19203_c1 | 3300050509 | Bacteria | 5220 |
| 536 | nmdc:mga06r32_290070_c1 | 3300050510 | Bacteria | 1623 |
| 537 | nmdc:mga0sz30_120382_c1 | 3300050516 | Bacteria | 1153 |
| 538 | nmdc:mga0sz30_1490_c2 | 3300050516 | Bacteria | 5861 |
| 539 | nmdc:mga0sz30_154032_c1 | 3300050516 | Bacteria | 1017 |
| 540 | nmdc:mga0sz30_1947_c1 | 3300050516 | Bacteria | 7377 |
| 541 | nmdc:mga0sz30_2087_c1 | 3300050516 | Bacteria | 7140 |
| 542 | nmdc:mga0sz30_50598_c2 | 3300050516 | Bacteria | 1345 |
| 543 | nmdc:mga0sz30_6350_c1 | 3300050516 | Bacteria | 4387 |
| 544 | Ga0495655_0058769 | 3300053083 | Bacteria | 1042 |
| 545 | Ga0495619_0037475 | 3300053085 | Bacteria | 3160 |
| 546 | Ga0500643_002159 | 3300053087 | Bacteria | 10421 |
| 547 | Ga0500556_0124169 | 3300053104 | Bacteria | 1008 |
| 548 | Ga0500562_002482 | 3300053108 | Bacteria | 4616 |
| 549 | Ga0500562_042103 | 3300053108 | Bacteria | 1215 |
| 550 | Ga0500604_0145528 | 3300053151 | Bacteria | 803 |
| 551 | Ga0500616_0012932 | 3300053153 | Bacteria | 4864 |
| 552 | Ga0500616_0037591 | 3300053153 | Bacteria | 2620 |
| 553 | Ga0501082_0496159 | 3300060353 | Bacteria | 1067 |
| 554 | Ga0466962_0013630 | 3300061719 | Bacteria | 3913 |
| 555 | Ga0466962_0197329 | 3300061719 | Bacteria | 983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002070 | JGI24750J21931_1014782 | JGI24750J21931_10147822 | 117 |
| 2 | 3300002077 | JGI24744J21845_10008416 | JGI24744J21845_100084162 | 117 |
| 3 | 3300002239 | JGI24034J26672_10002420 | JGI24034J26672_100024202 | 117 |
| 4 | 3300002244 | JGI24742J22300_10004481 | JGI24742J22300_100044812 | 117 |
| 5 | 3300005328 | Ga0070676_10046048 | Ga0070676_100460483 | 117 |
| 6 | 3300005330 | Ga0070690_100075935 | Ga0070690_1000759352 | 117 |
| 7 | 3300005335 | Ga0070666_10049991 | Ga0070666_100499912 | 117 |
| 8 | 3300005337 | Ga0070682_100021569 | Ga0070682_1000215694 | 117 |
| 9 | 3300005338 | Ga0068868_100001175 | Ga0068868_1000011756 | 117 |
| 10 | 3300005339 | Ga0070660_100166213 | Ga0070660_1001662132 | 117 |
| 11 | 3300005340 | Ga0070689_100390473 | Ga0070689_1003904732 | 117 |
| 12 | 3300005341 | Ga0070691_10002313 | Ga0070691_100023134 | 117 |
| 13 | 3300005345 | Ga0070692_10013503 | Ga0070692_100135033 | 117 |
| 14 | 3300005347 | Ga0070668_100001742 | Ga0070668_1000017427 | 117 |
| 15 | 3300005353 | Ga0070669_100028149 | Ga0070669_1000281492 | 117 |
| 16 | 3300005356 | Ga0070674_100000563 | Ga0070674_10000056310 | 117 |
| 17 | 3300005365 | Ga0070688_100003575 | Ga0070688_1000035758 | 117 |
| 18 | 3300005366 | Ga0070659_100611097 | Ga0070659_1006110972 | 117 |
| 19 | 3300005367 | Ga0070667_100006165 | Ga0070667_1000061657 | 117 |
| 20 | 3300005438 | Ga0070701_10003417 | Ga0070701_100034172 | 117 |
| 21 | 3300005439 | Ga0070711_100000861 | Ga0070711_10000086112 | 117 |
| 22 | 3300005440 | Ga0070705_100015195 | Ga0070705_1000151953 | 117 |
| 23 | 3300005441 | Ga0070700_100003148 | Ga0070700_10000314810 | 117 |
| 24 | 3300005444 | Ga0070694_100001137 | Ga0070694_1000011375 | 117 |
| 25 | 3300005456 | Ga0070678_100000818 | Ga0070678_10000081816 | 117 |
| 26 | 3300005457 | Ga0070662_100019824 | Ga0070662_1000198242 | 117 |
| 27 | 3300005458 | Ga0070681_10541060 | Ga0070681_105410602 | 117 |
| 28 | 3300005459 | Ga0068867_100000117 | Ga0068867_10000011738 | 117 |
| 29 | 3300005466 | Ga0070685_10156766 | Ga0070685_101567662 | 117 |
| 30 | 3300005530 | Ga0070679_100626071 | Ga0070679_1006260711 | 117 |
| 31 | 3300005539 | Ga0068853_100002723 | Ga0068853_10000272312 | 117 |
| 32 | 3300005545 | Ga0070695_100045394 | Ga0070695_1000453943 | 117 |
| 33 | 3300005546 | Ga0070696_100087279 | Ga0070696_1000872792 | 117 |
| 34 | 3300005547 | Ga0070693_100122106 | Ga0070693_1001221062 | 117 |
| 35 | 3300005549 | Ga0070704_100000959 | Ga0070704_10000095910 | 117 |
| 36 | 3300005563 | Ga0068855_100224325 | Ga0068855_1002243252 | 117 |
| 37 | 3300005578 | Ga0068854_100000583 | Ga0068854_10000058324 | 117 |
| 38 | 3300005614 | Ga0068856_100235067 | Ga0068856_1002350672 | 117 |
| 39 | 3300005615 | Ga0070702_100000286 | Ga0070702_10000028614 | 117 |
| 40 | 3300005616 | Ga0068852_100179484 | Ga0068852_1001794842 | 117 |
| 41 | 3300005617 | Ga0068859_100001965 | Ga0068859_1000019655 | 117 |
| 42 | 3300005718 | Ga0068866_10000573 | Ga0068866_1000057311 | 117 |
| 43 | 3300005719 | Ga0068861_100000507 | Ga0068861_10000050712 | 117 |
| 44 | 3300005842 | Ga0068858_100009407 | Ga0068858_1000094075 | 117 |
| 45 | 3300005843 | Ga0068860_100003792 | Ga0068860_1000037925 | 117 |
| 46 | 3300005844 | Ga0068862_100006603 | Ga0068862_1000066038 | 117 |
| 47 | 3300006163 | Ga0070715_10014293 | Ga0070715_100142932 | 117 |
| 48 | 3300006173 | Ga0070716_100015321 | Ga0070716_1000153214 | 117 |
| 49 | 3300006175 | Ga0070712_100002997 | Ga0070712_1000029977 | 117 |
| 50 | 3300006881 | Ga0068865_100007593 | Ga0068865_1000075937 | 117 |
| 51 | 3300006931 | Ga0097620_100001965 | Ga0097620_1000019655 | 117 |
| 52 | 3300009098 | Ga0105245_10002923 | Ga0105245_100029236 | 117 |
| 53 | 3300009101 | Ga0105247_10005571 | Ga0105247_100055717 | 117 |
| 54 | 3300009148 | Ga0105243_10002003 | Ga0105243_100020038 | 117 |
| 55 | 3300009545 | Ga0105237_10020056 | Ga0105237_100200565 | 117 |
| 56 | 3300009551 | Ga0105238_10163046 | Ga0105238_101630462 | 117 |
| 57 | 3300009553 | Ga0105249_10001158 | Ga0105249_1000115812 | 117 |
| 58 | 3300010375 | Ga0105239_10026074 | Ga0105239_100260745 | 117 |
| 59 | 3300013102 | Ga0157371_10064389 | Ga0157371_100643894 | 117 |
| 60 | 3300013296 | Ga0157374_10372306 | Ga0157374_103723062 | 117 |
| 61 | 3300013297 | Ga0157378_10002180 | Ga0157378_1000218016 | 117 |
| 62 | 3300013307 | Ga0157372_10007056 | Ga0157372_100070565 | 117 |
| 63 | 3300013308 | Ga0157375_10000151 | Ga0157375_1000015159 | 117 |
| 64 | 3300014326 | Ga0157380_10008689 | Ga0157380_100086897 | 117 |
| 65 | 3300014968 | Ga0157379_10006897 | Ga0157379_100068978 | 117 |
| 66 | 3300014969 | Ga0157376_10072772 | Ga0157376_100727723 | 117 |
| 67 | 3300017792 | Ga0163161_10002439 | Ga0163161_1000243912 | 117 |
| 68 | 3300025898 | Ga0207692_10016581 | Ga0207692_100165813 | 117 |
| 69 | 3300025899 | Ga0207642_10002214 | Ga0207642_100022146 | 117 |
| 70 | 3300025900 | Ga0207710_10009664 | Ga0207710_100096643 | 117 |
| 71 | 3300025901 | Ga0207688_10000025 | Ga0207688_1000002538 | 117 |
| 72 | 3300025903 | Ga0207680_10072025 | Ga0207680_100720252 | 117 |
| 73 | 3300025905 | Ga0207685_10003762 | Ga0207685_100037622 | 117 |
| 74 | 3300025907 | Ga0207645_10240688 | Ga0207645_102406882 | 117 |
| 75 | 3300025912 | Ga0207707_10454582 | Ga0207707_104545822 | 117 |
| 76 | 3300025914 | Ga0207671_10019240 | Ga0207671_100192404 | 117 |
| 77 | 3300025915 | Ga0207693_10000123 | Ga0207693_1000012342 | 117 |
| 78 | 3300025916 | Ga0207663_10009847 | Ga0207663_100098475 | 117 |
| 79 | 3300025923 | Ga0207681_10011516 | Ga0207681_100115163 | 117 |
| 80 | 3300025927 | Ga0207687_10199505 | Ga0207687_101995052 | 117 |
| 81 | 3300025931 | Ga0207644_10055312 | Ga0207644_100553122 | 117 |
| 82 | 3300025932 | Ga0207690_10091240 | Ga0207690_100912402 | 117 |
| 83 | 3300025933 | Ga0207706_10005323 | Ga0207706_1000532312 | 117 |
| 84 | 3300025934 | Ga0207686_10001243 | Ga0207686_100012439 | 117 |
| 85 | 3300025935 | Ga0207709_10021107 | Ga0207709_100211073 | 117 |
| 86 | 3300025937 | Ga0207669_10000400 | Ga0207669_1000040011 | 117 |
| 87 | 3300025938 | Ga0207704_10000325 | Ga0207704_1000032517 | 117 |
| 88 | 3300025939 | Ga0207665_10008251 | Ga0207665_100082515 | 117 |
| 89 | 3300025949 | Ga0207667_10318000 | Ga0207667_103180002 | 117 |
| 90 | 3300025961 | Ga0207712_10006113 | Ga0207712_100061136 | 117 |
| 91 | 3300025981 | Ga0207640_10000582 | Ga0207640_1000058210 | 117 |
| 92 | 3300025986 | Ga0207658_10003640 | Ga0207658_100036402 | 117 |
| 93 | 3300026023 | Ga0207677_10009499 | Ga0207677_100094993 | 117 |
| 94 | 3300026035 | Ga0207703_10005075 | Ga0207703_1000507510 | 117 |
| 95 | 3300026075 | Ga0207708_10000452 | Ga0207708_1000045234 | 117 |
| 96 | 3300026078 | Ga0207702_10618438 | Ga0207702_106184382 | 117 |
| 97 | 3300026089 | Ga0207648_10000381 | Ga0207648_1000038117 | 117 |
| 98 | 3300026118 | Ga0207675_100000406 | Ga0207675_1000004068 | 117 |
| 99 | 3300026121 | Ga0207683_10001482 | Ga0207683_1000148220 | 117 |
| 100 | 3300028380 | Ga0268265_10036750 | Ga0268265_100367503 | 117 |
| 101 | 3300028381 | Ga0268264_10009176 | Ga0268264_100091768 | 117 |
| 102 | 3300035121 | Ga0373960_0097009 | Ga0373960_0097009_210_683 | 117 |
| 103 | 3300035691 | Ga0373931_0031120 | Ga0373931_0031120_124_597 | 117 |
| 104 | 3300048903 | Ga0496100_0001254 | Ga0496100_0001254_3304_3777 | 117 |
| 105 | 3300048904 | Ga0496101_0049531 | Ga0496101_0049531_2177_2650 | 117 |
| 106 | 3300048905 | Ga0496102_0002086 | Ga0496102_0002086_12069_12542 | 117 |
| 107 | 3300048906 | Ga0496103_0000991 | Ga0496103_0000991_10472_10945 | 117 |
| 108 | 3300048909 | Ga0496106_0001129 | Ga0496106_0001129_9829_10302 | 117 |
| 109 | 3300048910 | Ga0496107_0000495 | Ga0496107_0000495_9381_9854 | 117 |
| 110 | 3300048917 | Ga0496114_0000419 | Ga0496114_0000419_5272_5745 | 117 |
| 111 | 3300048918 | Ga0496115_0090795 | Ga0496115_0090795_54_527 | 117 |
| 112 | 3300005434 | Ga0070709_10018035 | Ga0070709_100180354 | 126 |
| 113 | 3300005437 | Ga0070710_10001265 | Ga0070710_100012653 | 126 |
| 114 | 3300005548 | Ga0070665_100046080 | Ga0070665_1000460805 | 126 |
| 115 | 3300009147 | Ga0114129_11140618 | Ga0114129_111406182 | 126 |
| 116 | 3300009176 | Ga0105242_10000979 | Ga0105242_1000097915 | 126 |
| 117 | 3300025906 | Ga0207699_10006989 | Ga0207699_100069895 | 126 |
| 118 | 3300028379 | Ga0268266_10087000 | Ga0268266_100870003 | 126 |
| 119 | 3300050490 | nmdc:mga03n38_148924_c1 | nmdc:mga03n38_148924_c1_324_725 | 126 |
| 120 | 3300050491 | nmdc:mga00v17_24459_c1 | nmdc:mga00v17_24459_c1_1119_1520 | 126 |
| 121 | 3300050492 | nmdc:mga0yw44_141802_c1 | nmdc:mga0yw44_141802_c1_890_1291 | 126 |
| 122 | 3300050516 | nmdc:mga0sz30_2087_c1 | nmdc:mga0sz30_2087_c1_5636_6037 | 126 |
| 123 | 3300003792 | Ga0055540_1000003 | Ga0055540_1000003188 | 129 |
| 124 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011408 | 129 |
| 125 | 3300041411 | Ga0439466_0074647 | Ga0439466_0074647_128_526 | 132 |
| 126 | 3300041413 | Ga0439465_0007860 | Ga0439465_0007860_2558_2956 | 132 |
| 127 | 3300042002 | Ga0439442_077698 | Ga0439442_077698_42_440 | 132 |
| 128 | 3300048911 | Ga0496108_1003628 | Ga0496108_1003628_109_507 | 132 |
| 129 | 3300005937 | Ga0081455_10228023 | Ga0081455_102280232 | 133 |
| 130 | 3300039437 | Ga0436365_1664352 | Ga0436365_1664352_1770_2171 | 133 |
| 131 | 3300039450 | Ga0436363_1397604 | Ga0436363_1397604_1731_2132 | 133 |
| 132 | 3300046692 | Ga0495671_0076765 | Ga0495671_0076765_36_446 | 133 |
| 133 | 3300048911 | Ga0496108_0485719 | Ga0496108_0485719_656_1057 | 133 |
| 134 | 3300048912 | Ga0496109_0285433 | Ga0496109_0285433_823_1224 | 133 |
| 135 | 3300048915 | Ga0496112_0355356 | Ga0496112_0355356_436_837 | 133 |
| 136 | 3300049742 | Ga0501080_0692911 | Ga0501080_0692911_13_414 | 133 |
| 137 | 3300049822 | Ga0501035_1262363 | Ga0501035_1262363_40_441 | 133 |
| 138 | 3300053104 | Ga0500556_0124169 | Ga0500556_0124169_13_423 | 133 |
| 139 | 3300045976 | Ga0466967_2174205 | Ga0466967_2174205_42_515 | 135 |
| 140 | 3300044658 | Ga0466972_0034477 | Ga0466972_0034477_510_944 | 144 |
| 141 | 3300044683 | Ga0466965_0002997 | Ga0466965_0002997_4385_4819 | 144 |
| 142 | 3300044694 | Ga0466963_0626646 | Ga0466963_0626646_262_696 | 144 |
| 143 | 3300044735 | Ga0466968_0001326 | Ga0466968_0001326_2330_2764 | 144 |
| 144 | 3300044842 | Ga0466957_0005427 | Ga0466957_0005427_4890_5324 | 144 |
| 145 | 3300044901 | Ga0466960_0001519 | Ga0466960_0001519_3002_3436 | 144 |
| 146 | 3300045049 | Ga0466959_0001756 | Ga0466959_0001756_7234_7668 | 144 |
| 147 | 3300045836 | Ga0466958_0102303 | Ga0466958_0102303_1019_1453 | 144 |
| 148 | 3300045976 | Ga0466967_0015951 | Ga0466967_0015951_5121_5555 | 144 |
| 149 | 3300045976 | Ga0466967_0129856 | Ga0466967_0129856_1424_1897 | 144 |
| 150 | 3300039437 | Ga0436365_1212976 | Ga0436365_1212976_464_937 | 147 |
| 151 | 3300039453 | Ga0436362_1020382 | Ga0436362_1020382_13_486 | 148 |
| 152 | 3300045976 | Ga0466967_1455805 | Ga0466967_1455805_222_668 | 148 |
| 153 | 3300025914 | Ga0207671_10007814 | Ga0207671_100078149 | 149 |
| 154 | 3300048903 | Ga0496100_0079741 | Ga0496100_0079741_1296_1745 | 149 |
| 155 | 3300048904 | Ga0496101_0045273 | Ga0496101_0045273_362_811 | 149 |
| 156 | 3300048915 | Ga0496112_0010535 | Ga0496112_0010535_7704_8153 | 149 |
| 157 | 3300048916 | Ga0496113_0005415 | Ga0496113_0005415_4997_5446 | 149 |
| 158 | 3300048918 | Ga0496115_0751539 | Ga0496115_0751539_115_564 | 149 |
| 159 | 3300048923 | Ga0496120_0073458 | Ga0496120_0073458_1075_1524 | 149 |
| 160 | 3300048925 | Ga0496122_0057779 | Ga0496122_0057779_181_630 | 149 |
| 161 | 3300048926 | Ga0496123_0062741 | Ga0496123_0062741_1429_1878 | 149 |
| 162 | 3300048929 | Ga0496126_0032421 | Ga0496126_0032421_4358_4807 | 149 |
| 163 | iso_pu_bacteria | 2738541264 | 2738666917 | 149 |
| 164 | iso_pu_bacteria | 2738541356 | 2739145761 | 149 |
| 165 | 3300006048 | Ga0075363_100190080 | Ga0075363_1001900802 | 150 |
| 166 | 3300006051 | Ga0075364_10030170 | Ga0075364_100301704 | 150 |
| 167 | 3300006186 | Ga0075369_10021606 | Ga0075369_100216064 | 150 |
| 168 | 3300005937 | Ga0081455_10016795 | Ga0081455_100167957 | 151 |
| 169 | 3300006038 | Ga0075365_10068523 | Ga0075365_100685234 | 151 |
| 170 | 3300006048 | Ga0075363_100012390 | Ga0075363_1000123902 | 151 |
| 171 | 3300006051 | Ga0075364_10002949 | Ga0075364_100029492 | 151 |
| 172 | 3300006178 | Ga0075367_10133053 | Ga0075367_101330532 | 151 |
| 173 | 3300006353 | Ga0075370_10003723 | Ga0075370_100037232 | 151 |
| 174 | 3300031731 | Ga0307405_10388196 | Ga0307405_103881962 | 151 |
| 175 | 3300031852 | Ga0307410_10102661 | Ga0307410_101026612 | 151 |
| 176 | 3300031995 | Ga0307409_100209857 | Ga0307409_1002098572 | 151 |
| 177 | 3300032002 | Ga0307416_100030887 | Ga0307416_1000308872 | 151 |
| 178 | 3300032126 | Ga0307415_100515876 | Ga0307415_1005158762 | 151 |
| 179 | 3300050490 | nmdc:mga03n38_1616_c1 | nmdc:mga03n38_1616_c1_2731_3186 | 151 |
| 180 | 3300050491 | nmdc:mga00v17_1224_c1 | nmdc:mga00v17_1224_c1_8970_9425 | 151 |
| 181 | 3300050492 | nmdc:mga0yw44_185616_c1 | nmdc:mga0yw44_185616_c1_153_608 | 151 |
| 182 | 3300050494 | nmdc:mga06z11_85528_c1 | nmdc:mga06z11_85528_c1_813_1268 | 151 |
| 183 | 3300050496 | nmdc:mga07m45_3834_c1 | nmdc:mga07m45_3834_c1_6713_7168 | 151 |
| 184 | 3300050516 | nmdc:mga0sz30_1490_c2 | nmdc:mga0sz30_1490_c2_2766_3221 | 151 |
| 185 | 3300053108 | Ga0500562_042103 | Ga0500562_042103_565_1020 | 151 |
| 186 | 3300042435 | Ga0439434_0030541 | Ga0439434_0030541_755_1213 | 152 |
| 187 | 3300044683 | Ga0466965_0203888 | Ga0466965_0203888_150_608 | 152 |
| 188 | 3300044693 | Ga0466961_0010397 | Ga0466961_0010397_2058_2516 | 152 |
| 189 | 3300044735 | Ga0466968_0277801 | Ga0466968_0277801_310_768 | 152 |
| 190 | 3300044842 | Ga0466957_0007638 | Ga0466957_0007638_5512_5985 | 152 |
| 191 | 3300044842 | Ga0466957_0223482 | Ga0466957_0223482_752_1210 | 152 |
| 192 | 3300044901 | Ga0466960_0587416 | Ga0466960_0587416_110_568 | 152 |
| 193 | 3300045049 | Ga0466959_0731807 | Ga0466959_0731807_43_501 | 152 |
| 194 | 3300045836 | Ga0466958_0129948 | Ga0466958_0129948_1086_1544 | 152 |
| 195 | 3300045836 | Ga0466958_0257798 | Ga0466958_0257798_205_678 | 152 |
| 196 | 3300049571 | Ga0501034_0855028 | Ga0501034_0855028_190_648 | 152 |
| 197 | 3300049581 | Ga0501047_0172077 | Ga0501047_0172077_92_550 | 152 |
| 198 | 3300061719 | Ga0466962_0013630 | Ga0466962_0013630_1222_1695 | 152 |
| 199 | 3300006038 | Ga0075365_10042967 | Ga0075365_100429674 | 153 |
| 200 | 3300006048 | Ga0075363_100106334 | Ga0075363_1001063342 | 153 |
| 201 | 3300006051 | Ga0075364_10061710 | Ga0075364_100617102 | 153 |
| 202 | 3300006177 | Ga0075362_10107273 | Ga0075362_101072732 | 153 |
| 203 | 3300006178 | Ga0075367_10043234 | Ga0075367_100432342 | 153 |
| 204 | 3300006186 | Ga0075369_10031814 | Ga0075369_100318142 | 153 |
| 205 | 3300009545 | Ga0105237_10009594 | Ga0105237_100095944 | 153 |
| 206 | 3300010375 | Ga0105239_10051386 | Ga0105239_100513864 | 153 |
| 207 | 3300021377 | Ga0213874_10026576 | Ga0213874_100265762 | 153 |
| 208 | 3300031251 | Ga0265327_10001674 | Ga0265327_1000167415 | 153 |
| 209 | 3300039453 | Ga0436362_1084299 | Ga0436362_1084299_39_500 | 153 |
| 210 | 3300041411 | Ga0439466_0046181 | Ga0439466_0046181_506_967 | 153 |
| 211 | 3300041413 | Ga0439465_0016208 | Ga0439465_0016208_86_547 | 153 |
| 212 | 3300041507 | Ga0451851_1183602 | Ga0451851_1183602_327_788 | 153 |
| 213 | 3300042005 | Ga0439448_0015051 | Ga0439448_0015051_1232_1693 | 153 |
| 214 | 3300042145 | Ga0450906_076488 | Ga0450906_076488_23_484 | 153 |
| 215 | 3300044658 | Ga0466972_0309961 | Ga0466972_0309961_247_717 | 153 |
| 216 | 3300044683 | Ga0466965_0281658 | Ga0466965_0281658_310_771 | 153 |
| 217 | 3300044765 | Ga0466970_0017334 | Ga0466970_0017334_2540_3010 | 153 |
| 218 | 3300045049 | Ga0466959_0536802 | Ga0466959_0536802_94_564 | 153 |
| 219 | 3300045836 | Ga0466958_0617525 | Ga0466958_0617525_31_501 | 153 |
| 220 | 3300045976 | Ga0466967_0002447 | Ga0466967_0002447_7146_7607 | 153 |
| 221 | 3300048906 | Ga0496103_0207235 | Ga0496103_0207235_135_596 | 153 |
| 222 | iso_pu_bacteria | 2842134933 | 2842140109 | 153 |
| 223 | iso_pu_bacteria | 2919713450 | 2919713674 | 153 |
| 224 | iso_pu_bacteria | 2939582691 | 2939588806 | 153 |
| 225 | 3300003320 | rootH2_10058472 | rootH2_100584722 | 154 |
| 226 | 3300005434 | Ga0070709_10244056 | Ga0070709_102440562 | 154 |
| 227 | 3300005435 | Ga0070714_100017948 | Ga0070714_1000179482 | 154 |
| 228 | 3300005436 | Ga0070713_100131026 | Ga0070713_1001310263 | 154 |
| 229 | 3300005578 | Ga0068854_100422176 | Ga0068854_1004221762 | 154 |
| 230 | 3300006173 | Ga0070716_100269425 | Ga0070716_1002694252 | 154 |
| 231 | 3300006175 | Ga0070712_100690952 | Ga0070712_1006909522 | 154 |
| 232 | 3300009545 | Ga0105237_10223591 | Ga0105237_102235912 | 154 |
| 233 | 3300013105 | Ga0157369_10262280 | Ga0157369_102622803 | 154 |
| 234 | 3300025914 | Ga0207671_10225288 | Ga0207671_102252882 | 154 |
| 235 | 3300025928 | Ga0207700_10282393 | Ga0207700_102823932 | 154 |
| 236 | 3300025929 | Ga0207664_10184127 | Ga0207664_101841272 | 154 |
| 237 | 3300025939 | Ga0207665_10453959 | Ga0207665_104539592 | 154 |
| 238 | 3300025981 | Ga0207640_10867911 | Ga0207640_108679111 | 154 |
| 239 | 3300005337 | Ga0070682_100007655 | Ga0070682_1000076557 | 156 |
| 240 | 3300005455 | Ga0070663_100019883 | Ga0070663_1000198834 | 156 |
| 241 | 3300005547 | Ga0070693_100431909 | Ga0070693_1004319091 | 156 |
| 242 | 3300005618 | Ga0068864_100661076 | Ga0068864_1006610761 | 156 |
| 243 | 3300006048 | Ga0075363_100033166 | Ga0075363_1000331664 | 156 |
| 244 | 3300006353 | Ga0075370_10111484 | Ga0075370_101114842 | 156 |
| 245 | 3300009551 | Ga0105238_10116699 | Ga0105238_101166994 | 156 |
| 246 | 3300013297 | Ga0157378_12433133 | Ga0157378_124331331 | 156 |
| 247 | 3300013306 | Ga0163162_12281638 | Ga0163162_122816381 | 156 |
| 248 | 3300014325 | Ga0163163_10037556 | Ga0163163_100375565 | 156 |
| 249 | 3300014745 | Ga0157377_10180754 | Ga0157377_101807542 | 156 |
| 250 | 3300021384 | Ga0213876_10011710 | Ga0213876_100117105 | 156 |
| 251 | 3300025924 | Ga0207694_10205682 | Ga0207694_102056822 | 156 |
| 252 | 3300026067 | Ga0207678_10029559 | Ga0207678_100295594 | 156 |
| 253 | 3300026075 | Ga0207708_10361553 | Ga0207708_103615531 | 156 |
| 254 | 3300026095 | Ga0207676_10271194 | Ga0207676_102711942 | 156 |
| 255 | 3300026142 | Ga0207698_10587445 | Ga0207698_105874452 | 156 |
| 256 | 3300039437 | Ga0436365_0731445 | Ga0436365_0731445_3998_4471 | 156 |
| 257 | 3300041452 | Ga0451793_1520913 | Ga0451793_1520913_65_535 | 156 |
| 258 | 3300048903 | Ga0496100_0233972 | Ga0496100_0233972_61_531 | 156 |
| 259 | 3300048904 | Ga0496101_0398029 | Ga0496101_0398029_267_737 | 156 |
| 260 | 3300048911 | Ga0496108_0022268 | Ga0496108_0022268_2408_2878 | 156 |
| 261 | 3300048912 | Ga0496109_0032986 | Ga0496109_0032986_1854_2324 | 156 |
| 262 | 3300048913 | Ga0496110_0019813 | Ga0496110_0019813_2959_3429 | 156 |
| 263 | 3300048915 | Ga0496112_0043922 | Ga0496112_0043922_772_1242 | 156 |
| 264 | 3300048916 | Ga0496113_0414811 | Ga0496113_0414811_387_857 | 156 |
| 265 | 3300048917 | Ga0496114_0597929 | Ga0496114_0597929_470_940 | 156 |
| 266 | 3300048917 | Ga0496114_1136240 | Ga0496114_1136240_12_482 | 156 |
| 267 | 3300048918 | Ga0496115_0146957 | Ga0496115_0146957_431_901 | 156 |
| 268 | 3300048929 | Ga0496126_0004133 | Ga0496126_0004133_6072_6542 | 156 |
| 269 | 3300050490 | nmdc:mga03n38_8154_c1 | nmdc:mga03n38_8154_c1_469_939 | 156 |
| 270 | 3300050496 | nmdc:mga07m45_120289_c1 | nmdc:mga07m45_120289_c1_327_797 | 156 |
| 271 | 3300053083 | Ga0495655_0058769 | Ga0495655_0058769_455_925 | 156 |
| 272 | 3300001991 | JGI24743J22301_10001574 | JGI24743J22301_100015742 | 157 |
| 273 | 3300005331 | Ga0070670_100405899 | Ga0070670_1004058992 | 157 |
| 274 | 3300005335 | Ga0070666_10272365 | Ga0070666_102723652 | 157 |
| 275 | 3300005347 | Ga0070668_100696972 | Ga0070668_1006969722 | 157 |
| 276 | 3300005353 | Ga0070669_100032393 | Ga0070669_1000323934 | 157 |
| 277 | 3300005353 | Ga0070669_100085651 | Ga0070669_1000856514 | 157 |
| 278 | 3300005355 | Ga0070671_100113252 | Ga0070671_1001132522 | 157 |
| 279 | 3300005356 | Ga0070674_100198695 | Ga0070674_1001986951 | 157 |
| 280 | 3300005367 | Ga0070667_100000073 | Ga0070667_10000007337 | 157 |
| 281 | 3300005367 | Ga0070667_100146250 | Ga0070667_1001462502 | 157 |
| 282 | 3300005367 | Ga0070667_100287258 | Ga0070667_1002872582 | 157 |
| 283 | 3300005367 | Ga0070667_100531753 | Ga0070667_1005317531 | 157 |
| 284 | 3300005437 | Ga0070710_10176050 | Ga0070710_101760502 | 157 |
| 285 | 3300005439 | Ga0070711_100130607 | Ga0070711_1001306071 | 157 |
| 286 | 3300005455 | Ga0070663_100036058 | Ga0070663_1000360583 | 157 |
| 287 | 3300005539 | Ga0068853_101188734 | Ga0068853_1011887341 | 157 |
| 288 | 3300005544 | Ga0070686_100402637 | Ga0070686_1004026372 | 157 |
| 289 | 3300005546 | Ga0070696_100607078 | Ga0070696_1006070782 | 157 |
| 290 | 3300005548 | Ga0070665_100004662 | Ga0070665_1000046629 | 157 |
| 291 | 3300005548 | Ga0070665_100110655 | Ga0070665_1001106553 | 157 |
| 292 | 3300005617 | Ga0068859_100000223 | Ga0068859_10000022343 | 157 |
| 293 | 3300005618 | Ga0068864_100126471 | Ga0068864_1001264712 | 157 |
| 294 | 3300005618 | Ga0068864_100333412 | Ga0068864_1003334122 | 157 |
| 295 | 3300005718 | Ga0068866_10825311 | Ga0068866_108253111 | 157 |
| 296 | 3300005719 | Ga0068861_100627658 | Ga0068861_1006276582 | 157 |
| 297 | 3300005841 | Ga0068863_100000587 | Ga0068863_10000058738 | 157 |
| 298 | 3300005841 | Ga0068863_100013142 | Ga0068863_1000131427 | 157 |
| 299 | 3300005842 | Ga0068858_100004229 | Ga0068858_10000422912 | 157 |
| 300 | 3300005842 | Ga0068858_100669304 | Ga0068858_1006693042 | 157 |
| 301 | 3300005843 | Ga0068860_100000127 | Ga0068860_10000012738 | 157 |
| 302 | 3300005844 | Ga0068862_100000052 | Ga0068862_100000052103 | 157 |
| 303 | 3300006038 | Ga0075365_10101143 | Ga0075365_101011432 | 157 |
| 304 | 3300006042 | Ga0075368_10051880 | Ga0075368_100518802 | 157 |
| 305 | 3300006048 | Ga0075363_100009271 | Ga0075363_1000092714 | 157 |
| 306 | 3300006048 | Ga0075363_100014948 | Ga0075363_1000149484 | 157 |
| 307 | 3300006048 | Ga0075363_100085290 | Ga0075363_1000852902 | 157 |
| 308 | 3300006048 | Ga0075363_100289873 | Ga0075363_1002898732 | 157 |
| 309 | 3300006048 | Ga0075363_100310056 | Ga0075363_1003100562 | 157 |
| 310 | 3300006051 | Ga0075364_10003160 | Ga0075364_100031602 | 157 |
| 311 | 3300006051 | Ga0075364_10116159 | Ga0075364_101161592 | 157 |
| 312 | 3300006051 | Ga0075364_10119505 | Ga0075364_101195052 | 157 |
| 313 | 3300006051 | Ga0075364_10173576 | Ga0075364_101735762 | 157 |
| 314 | 3300006051 | Ga0075364_10493591 | Ga0075364_104935912 | 157 |
| 315 | 3300006173 | Ga0070716_100046065 | Ga0070716_1000460653 | 157 |
| 316 | 3300006175 | Ga0070712_100694520 | Ga0070712_1006945201 | 157 |
| 317 | 3300006177 | Ga0075362_10059173 | Ga0075362_100591732 | 157 |
| 318 | 3300006177 | Ga0075362_10059237 | Ga0075362_100592372 | 157 |
| 319 | 3300006177 | Ga0075362_10182618 | Ga0075362_101826182 | 157 |
| 320 | 3300006178 | Ga0075367_10071419 | Ga0075367_100714192 | 157 |
| 321 | 3300006186 | Ga0075369_10028838 | Ga0075369_100288382 | 157 |
| 322 | 3300006186 | Ga0075369_10033262 | Ga0075369_100332622 | 157 |
| 323 | 3300006186 | Ga0075369_10065547 | Ga0075369_100655472 | 157 |
| 324 | 3300006186 | Ga0075369_10112334 | Ga0075369_101123341 | 157 |
| 325 | 3300006195 | Ga0075366_10056414 | Ga0075366_100564142 | 157 |
| 326 | 3300006353 | Ga0075370_10012155 | Ga0075370_100121554 | 157 |
| 327 | 3300006353 | Ga0075370_10026300 | Ga0075370_100263004 | 157 |
| 328 | 3300006353 | Ga0075370_10245465 | Ga0075370_102454652 | 157 |
| 329 | 3300006844 | Ga0075428_100000149 | Ga0075428_10000014925 | 157 |
| 330 | 3300006846 | Ga0075430_100023965 | Ga0075430_1000239655 | 157 |
| 331 | 3300006847 | Ga0075431_100297113 | Ga0075431_1002971132 | 157 |
| 332 | 3300006880 | Ga0075429_100505277 | Ga0075429_1005052772 | 157 |
| 333 | 3300006881 | Ga0068865_100201640 | Ga0068865_1002016402 | 157 |
| 334 | 3300006931 | Ga0097620_100000223 | Ga0097620_10000022343 | 157 |
| 335 | 3300007788 | Ga0099795_10011365 | Ga0099795_100113652 | 157 |
| 336 | 3300009092 | Ga0105250_10064935 | Ga0105250_100649352 | 157 |
| 337 | 3300009101 | Ga0105247_10000066 | Ga0105247_1000006677 | 157 |
| 338 | 3300009147 | Ga0114129_10033330 | Ga0114129_100333304 | 157 |
| 339 | 3300009147 | Ga0114129_11747384 | Ga0114129_117473842 | 157 |
| 340 | 3300009148 | Ga0105243_10547029 | Ga0105243_105470292 | 157 |
| 341 | 3300009176 | Ga0105242_10990595 | Ga0105242_109905952 | 157 |
| 342 | 3300009177 | Ga0105248_10000613 | Ga0105248_1000061338 | 157 |
| 343 | 3300009177 | Ga0105248_11242667 | Ga0105248_112426672 | 157 |
| 344 | 3300009553 | Ga0105249_10000093 | Ga0105249_1000009378 | 157 |
| 345 | 3300009553 | Ga0105249_10138044 | Ga0105249_101380444 | 157 |
| 346 | 3300010375 | Ga0105239_10743802 | Ga0105239_107438022 | 157 |
| 347 | 3300013297 | Ga0157378_12397833 | Ga0157378_123978331 | 157 |
| 348 | 3300013306 | Ga0163162_10006763 | Ga0163162_1000676310 | 157 |
| 349 | 3300013306 | Ga0163162_10089548 | Ga0163162_100895484 | 157 |
| 350 | 3300013306 | Ga0163162_10203017 | Ga0163162_102030172 | 157 |
| 351 | 3300014325 | Ga0163163_10012823 | Ga0163163_100128237 | 157 |
| 352 | 3300014325 | Ga0163163_10088824 | Ga0163163_100888242 | 157 |
| 353 | 3300014968 | Ga0157379_10050118 | Ga0157379_100501182 | 157 |
| 354 | 3300021384 | Ga0213876_10000674 | Ga0213876_1000067414 | 157 |
| 355 | 3300021384 | Ga0213876_10013547 | Ga0213876_100135474 | 157 |
| 356 | 3300021384 | Ga0213876_10165481 | Ga0213876_101654811 | 157 |
| 357 | 3300021388 | Ga0213875_10023757 | Ga0213875_100237572 | 157 |
| 358 | 3300025900 | Ga0207710_10000090 | Ga0207710_1000009077 | 157 |
| 359 | 3300025903 | Ga0207680_10298399 | Ga0207680_102983992 | 157 |
| 360 | 3300025916 | Ga0207663_10954634 | Ga0207663_109546341 | 157 |
| 361 | 3300025923 | Ga0207681_10005438 | Ga0207681_100054384 | 157 |
| 362 | 3300025931 | Ga0207644_10059568 | Ga0207644_100595682 | 157 |
| 363 | 3300025931 | Ga0207644_10113368 | Ga0207644_101133683 | 157 |
| 364 | 3300025939 | Ga0207665_10082774 | Ga0207665_100827742 | 157 |
| 365 | 3300025941 | Ga0207711_10000183 | Ga0207711_1000018338 | 157 |
| 366 | 3300025961 | Ga0207712_10000073 | Ga0207712_1000007378 | 157 |
| 367 | 3300025961 | Ga0207712_10616414 | Ga0207712_106164142 | 157 |
| 368 | 3300025986 | Ga0207658_10000304 | Ga0207658_1000030447 | 157 |
| 369 | 3300025986 | Ga0207658_10007427 | Ga0207658_100074275 | 157 |
| 370 | 3300025986 | Ga0207658_10042565 | Ga0207658_100425652 | 157 |
| 371 | 3300025986 | Ga0207658_10289095 | Ga0207658_102890951 | 157 |
| 372 | 3300025986 | Ga0207658_10382148 | Ga0207658_103821482 | 157 |
| 373 | 3300026035 | Ga0207703_10010298 | Ga0207703_100102985 | 157 |
| 374 | 3300026067 | Ga0207678_10006722 | Ga0207678_100067227 | 157 |
| 375 | 3300026088 | Ga0207641_10000413 | Ga0207641_1000041331 | 157 |
| 376 | 3300026088 | Ga0207641_10008652 | Ga0207641_100086527 | 157 |
| 377 | 3300026095 | Ga0207676_10269958 | Ga0207676_102699582 | 157 |
| 378 | 3300026118 | Ga0207675_101186887 | Ga0207675_1011868872 | 157 |
| 379 | 3300026121 | Ga0207683_10618513 | Ga0207683_106185132 | 157 |
| 380 | 3300028379 | Ga0268266_10007258 | Ga0268266_100072589 | 157 |
| 381 | 3300028379 | Ga0268266_10061743 | Ga0268266_100617432 | 157 |
| 382 | 3300028380 | Ga0268265_10000063 | Ga0268265_10000063103 | 157 |
| 383 | 3300028380 | Ga0268265_10011038 | Ga0268265_100110387 | 157 |
| 384 | 3300028381 | Ga0268264_10000007 | Ga0268264_1000000738 | 157 |
| 385 | 3300030521 | Ga0307511_10193734 | Ga0307511_101937342 | 157 |
| 386 | 3300031852 | Ga0307410_10150343 | Ga0307410_101503432 | 157 |
| 387 | 3300031995 | Ga0307409_100885158 | Ga0307409_1008851582 | 157 |
| 388 | 3300031995 | Ga0307409_100895520 | Ga0307409_1008955202 | 157 |
| 389 | 3300031995 | Ga0307409_101311706 | Ga0307409_1013117061 | 157 |
| 390 | 3300035170 | Ga0373943_0147883 | Ga0373943_0147883_63_536 | 157 |
| 391 | 3300035691 | Ga0373931_0345922 | Ga0373931_0345922_118_591 | 157 |
| 392 | 3300035695 | Ga0373927_0446391 | Ga0373927_0446391_146_619 | 157 |
| 393 | 3300036712 | Ga0316584_0038500 | Ga0316584_0038500_178_651 | 157 |
| 394 | 3300037068 | Ga0373925_0697568 | Ga0373925_0697568_15_488 | 157 |
| 395 | 3300037853 | Ga0436364_0448603 | Ga0436364_0448603_2598_3083 | 157 |
| 396 | 3300037853 | Ga0436364_1184081 | Ga0436364_1184081_4237_4710 | 157 |
| 397 | 3300039437 | Ga0436365_0016980 | Ga0436365_0016980_11372_11845 | 157 |
| 398 | 3300039437 | Ga0436365_0119240 | Ga0436365_0119240_6051_6524 | 157 |
| 399 | 3300039437 | Ga0436365_0347716 | Ga0436365_0347716_855_1328 | 157 |
| 400 | 3300039438 | Ga0436360_0492879 | Ga0436360_0492879_54_527 | 157 |
| 401 | 3300039447 | Ga0436361_0751346 | Ga0436361_0751346_28_501 | 157 |
| 402 | 3300039450 | Ga0436363_0746391 | Ga0436363_0746391_37_510 | 157 |
| 403 | 3300039450 | Ga0436363_1576561 | Ga0436363_1576561_449_922 | 157 |
| 404 | 3300041413 | Ga0439465_0001090 | Ga0439465_0001090_3797_4270 | 157 |
| 405 | 3300041443 | Ga0451789_0556179 | Ga0451789_0556179_234_719 | 157 |
| 406 | 3300041460 | Ga0451802_0501702 | Ga0451802_0501702_137_610 | 157 |
| 407 | 3300041496 | Ga0451839_0495621 | Ga0451839_0495621_103_594 | 157 |
| 408 | 3300042004 | Ga0439445_0014459 | Ga0439445_0014459_1337_1810 | 157 |
| 409 | 3300044658 | Ga0466972_0068577 | Ga0466972_0068577_263_739 | 157 |
| 410 | 3300044683 | Ga0466965_0002055 | Ga0466965_0002055_5163_5639 | 157 |
| 411 | 3300044683 | Ga0466965_0357703 | Ga0466965_0357703_103_576 | 157 |
| 412 | 3300044693 | Ga0466961_0042451 | Ga0466961_0042451_1114_1587 | 157 |
| 413 | 3300044694 | Ga0466963_0140783 | Ga0466963_0140783_711_1184 | 157 |
| 414 | 3300044765 | Ga0466970_0122508 | Ga0466970_0122508_51_524 | 157 |
| 415 | 3300044842 | Ga0466957_0032729 | Ga0466957_0032729_1101_1577 | 157 |
| 416 | 3300044842 | Ga0466957_0257922 | Ga0466957_0257922_426_899 | 157 |
| 417 | 3300044842 | Ga0466957_0419629 | Ga0466957_0419629_203_676 | 157 |
| 418 | 3300044901 | Ga0466960_0000320 | Ga0466960_0000320_447_923 | 157 |
| 419 | 3300044901 | Ga0466960_0001941 | Ga0466960_0001941_6396_6869 | 157 |
| 420 | 3300044901 | Ga0466960_0450449 | Ga0466960_0450449_91_564 | 157 |
| 421 | 3300044901 | Ga0466960_0590682 | Ga0466960_0590682_100_573 | 157 |
| 422 | 3300045836 | Ga0466958_0073149 | Ga0466958_0073149_827_1300 | 157 |
| 423 | 3300045976 | Ga0466967_0002855 | Ga0466967_0002855_4338_4814 | 157 |
| 424 | 3300045976 | Ga0466967_0005640 | Ga0466967_0005640_4453_4926 | 157 |
| 425 | 3300045976 | Ga0466967_0042813 | Ga0466967_0042813_3347_3820 | 157 |
| 426 | 3300045976 | Ga0466967_0307239 | Ga0466967_0307239_672_1151 | 157 |
| 427 | 3300045976 | Ga0466967_0616038 | Ga0466967_0616038_475_948 | 157 |
| 428 | 3300045976 | Ga0466967_0889842 | Ga0466967_0889842_52_525 | 157 |
| 429 | 3300045976 | Ga0466967_1400377 | Ga0466967_1400377_23_502 | 157 |
| 430 | 3300046459 | Ga0495629_0039368 | Ga0495629_0039368_1469_1942 | 157 |
| 431 | 3300046460 | Ga0495638_0002780 | Ga0495638_0002780_12077_12559 | 157 |
| 432 | 3300046461 | Ga0495641_0013995 | Ga0495641_0013995_3603_4076 | 157 |
| 433 | 3300046471 | Ga0495650_0144127 | Ga0495650_0144127_11_484 | 157 |
| 434 | 3300046507 | Ga0495606_0065956 | Ga0495606_0065956_860_1333 | 157 |
| 435 | 3300046513 | Ga0495616_0192408 | Ga0495616_0192408_102_584 | 157 |
| 436 | 3300046531 | Ga0495665_0080424 | Ga0495665_0080424_387_860 | 157 |
| 437 | 3300046533 | Ga0495640_0015166 | Ga0495640_0015166_4700_5173 | 157 |
| 438 | 3300046559 | Ga0495667_0392075 | Ga0495667_0392075_368_841 | 157 |
| 439 | 3300046616 | Ga0495668_0155376 | Ga0495668_0155376_27_509 | 157 |
| 440 | 3300046660 | Ga0495625_0147894 | Ga0495625_0147894_576_1058 | 157 |
| 441 | 3300046683 | Ga0495658_0012503 | Ga0495658_0012503_95_568 | 157 |
| 442 | 3300047320 | Ga0495672_0103539 | Ga0495672_0103539_31_504 | 157 |
| 443 | 3300047321 | Ga0495676_0356819 | Ga0495676_0356819_377_850 | 157 |
| 444 | 3300047472 | Ga0495686_0000940 | Ga0495686_0000940_11901_12401 | 157 |
| 445 | 3300047472 | Ga0495686_0164803 | Ga0495686_0164803_488_979 | 157 |
| 446 | 3300047673 | Ga0495593_0006029 | Ga0495593_0006029_2681_3154 | 157 |
| 447 | 3300048089 | Ga0495614_0066438 | Ga0495614_0066438_626_1099 | 157 |
| 448 | 3300048091 | Ga0495626_0039009 | Ga0495626_0039009_159_641 | 157 |
| 449 | 3300048903 | Ga0496100_0006694 | Ga0496100_0006694_4065_4538 | 157 |
| 450 | 3300048903 | Ga0496100_1317915 | Ga0496100_1317915_34_507 | 157 |
| 451 | 3300048904 | Ga0496101_0035226 | Ga0496101_0035226_1561_2034 | 157 |
| 452 | 3300048904 | Ga0496101_0175593 | Ga0496101_0175593_1037_1516 | 157 |
| 453 | 3300048905 | Ga0496102_0000168 | Ga0496102_0000168_32251_32724 | 157 |
| 454 | 3300048905 | Ga0496102_0019989 | Ga0496102_0019989_2940_3419 | 157 |
| 455 | 3300048905 | Ga0496102_0057771 | Ga0496102_0057771_2320_2793 | 157 |
| 456 | 3300048905 | Ga0496102_0709530 | Ga0496102_0709530_303_776 | 157 |
| 457 | 3300048905 | Ga0496102_1406995 | Ga0496102_1406995_111_590 | 157 |
| 458 | 3300048906 | Ga0496103_0031558 | Ga0496103_0031558_1140_1613 | 157 |
| 459 | 3300048906 | Ga0496103_0045239 | Ga0496103_0045239_1445_1924 | 157 |
| 460 | 3300048906 | Ga0496103_0084642 | Ga0496103_0084642_583_1056 | 157 |
| 461 | 3300048907 | Ga0496104_0012733 | Ga0496104_0012733_1519_1998 | 157 |
| 462 | 3300048908 | Ga0496105_0047005 | Ga0496105_0047005_68_541 | 157 |
| 463 | 3300048909 | Ga0496106_0545886 | Ga0496106_0545886_130_603 | 157 |
| 464 | 3300048910 | Ga0496107_0015409 | Ga0496107_0015409_2045_2518 | 157 |
| 465 | 3300048912 | Ga0496109_0176908 | Ga0496109_0176908_72_551 | 157 |
| 466 | 3300048913 | Ga0496110_0029838 | Ga0496110_0029838_3968_4447 | 157 |
| 467 | 3300048915 | Ga0496112_0625299 | Ga0496112_0625299_157_630 | 157 |
| 468 | 3300048916 | Ga0496113_0337388 | Ga0496113_0337388_688_1161 | 157 |
| 469 | 3300048916 | Ga0496113_0420966 | Ga0496113_0420966_570_1043 | 157 |
| 470 | 3300048917 | Ga0496114_0636767 | Ga0496114_0636767_252_725 | 157 |
| 471 | 3300048919 | Ga0496116_0015907 | Ga0496116_0015907_155_628 | 157 |
| 472 | 3300048920 | Ga0496117_0008185 | Ga0496117_0008185_155_628 | 157 |
| 473 | 3300048921 | Ga0496118_0000171 | Ga0496118_0000171_14799_15272 | 157 |
| 474 | 3300048922 | Ga0496119_0003283 | Ga0496119_0003283_8811_9284 | 157 |
| 475 | 3300048923 | Ga0496120_0017049 | Ga0496120_0017049_2480_2953 | 157 |
| 476 | 3300048923 | Ga0496120_0323768 | Ga0496120_0323768_214_687 | 157 |
| 477 | 3300048924 | Ga0496121_0013914 | Ga0496121_0013914_5947_6420 | 157 |
| 478 | 3300048927 | Ga0496124_0072339 | Ga0496124_0072339_492_965 | 157 |
| 479 | 3300048928 | Ga0496125_0121012 | Ga0496125_0121012_10_483 | 157 |
| 480 | 3300048928 | Ga0496125_0474678 | Ga0496125_0474678_18_518 | 157 |
| 481 | 3300048929 | Ga0496126_0589400 | Ga0496126_0589400_82_582 | 157 |
| 482 | 3300049569 | Ga0501032_0000510 | Ga0501032_0000510_28483_28956 | 157 |
| 483 | 3300049569 | Ga0501032_0202148 | Ga0501032_0202148_643_1116 | 157 |
| 484 | 3300049569 | Ga0501032_0461352 | Ga0501032_0461352_70_543 | 157 |
| 485 | 3300049570 | Ga0501033_0006101 | Ga0501033_0006101_3918_4391 | 157 |
| 486 | 3300049570 | Ga0501033_0052419 | Ga0501033_0052419_562_1035 | 157 |
| 487 | 3300049570 | Ga0501033_0452714 | Ga0501033_0452714_301_774 | 157 |
| 488 | 3300049571 | Ga0501034_0001987 | Ga0501034_0001987_11687_12160 | 157 |
| 489 | 3300049571 | Ga0501034_0005475 | Ga0501034_0005475_4546_5019 | 157 |
| 490 | 3300049571 | Ga0501034_0130096 | Ga0501034_0130096_448_921 | 157 |
| 491 | 3300049571 | Ga0501034_0163709 | Ga0501034_0163709_1043_1516 | 157 |
| 492 | 3300049572 | Ga0501036_0002002 | Ga0501036_0002002_3796_4269 | 157 |
| 493 | 3300049572 | Ga0501036_0356474 | Ga0501036_0356474_168_641 | 157 |
| 494 | 3300049573 | Ga0501037_0000677 | Ga0501037_0000677_16551_17024 | 157 |
| 495 | 3300049573 | Ga0501037_0028731 | Ga0501037_0028731_349_822 | 157 |
| 496 | 3300049573 | Ga0501037_0073325 | Ga0501037_0073325_1182_1655 | 157 |
| 497 | 3300049574 | Ga0501038_0001664 | Ga0501038_0001664_3237_3710 | 157 |
| 498 | 3300049574 | Ga0501038_0791088 | Ga0501038_0791088_155_628 | 157 |
| 499 | 3300049575 | Ga0501039_0000157 | Ga0501039_0000157_29543_30016 | 157 |
| 500 | 3300049579 | Ga0501043_0000971 | Ga0501043_0000971_24834_25307 | 157 |
| 501 | 3300049579 | Ga0501043_0015753 | Ga0501043_0015753_4326_4799 | 157 |
| 502 | 3300049580 | Ga0501046_0004078 | Ga0501046_0004078_3851_4324 | 157 |
| 503 | 3300049581 | Ga0501047_0001180 | Ga0501047_0001180_8022_8495 | 157 |
| 504 | 3300049581 | Ga0501047_0107234 | Ga0501047_0107234_1824_2297 | 157 |
| 505 | 3300049581 | Ga0501047_0228914 | Ga0501047_0228914_1061_1534 | 157 |
| 506 | 3300049582 | Ga0501048_0003008 | Ga0501048_0003008_11950_12423 | 157 |
| 507 | 3300049583 | Ga0501067_0083526 | Ga0501067_0083526_475_948 | 157 |
| 508 | 3300049585 | Ga0501069_0432167 | Ga0501069_0432167_77_550 | 157 |
| 509 | 3300049586 | Ga0501070_0001412 | Ga0501070_0001412_16642_17115 | 157 |
| 510 | 3300049586 | Ga0501070_0001918 | Ga0501070_0001918_7365_7838 | 157 |
| 511 | 3300049589 | Ga0501073_0027278 | Ga0501073_0027278_2966_3439 | 157 |
| 512 | 3300049589 | Ga0501073_0334497 | Ga0501073_0334497_284_757 | 157 |
| 513 | 3300049593 | Ga0501077_0158860 | Ga0501077_0158860_395_868 | 157 |
| 514 | 3300049741 | Ga0501079_0646871 | Ga0501079_0646871_283_756 | 157 |
| 515 | 3300049742 | Ga0501080_0155597 | Ga0501080_0155597_290_763 | 157 |
| 516 | 3300049744 | Ga0501083_0232171 | Ga0501083_0232171_702_1175 | 157 |
| 517 | 3300049822 | Ga0501035_0000385 | Ga0501035_0000385_12157_12630 | 157 |
| 518 | 3300049822 | Ga0501035_0003413 | Ga0501035_0003413_609_1082 | 157 |
| 519 | 3300049822 | Ga0501035_0466896 | Ga0501035_0466896_544_1017 | 157 |
| 520 | 3300049823 | Ga0501044_0001111 | Ga0501044_0001111_553_1026 | 157 |
| 521 | 3300049823 | Ga0501044_0018055 | Ga0501044_0018055_5459_5932 | 157 |
| 522 | 3300049823 | Ga0501044_0403055 | Ga0501044_0403055_702_1175 | 157 |
| 523 | 3300050489 | nmdc:mga03683_224189_c1 | nmdc:mga03683_224189_c1_314_787 | 157 |
| 524 | 3300050489 | nmdc:mga03683_71799_c1 | nmdc:mga03683_71799_c1_288_761 | 157 |
| 525 | 3300050490 | nmdc:mga03n38_20054_c1 | nmdc:mga03n38_20054_c1_1839_2312 | 157 |
| 526 | 3300050490 | nmdc:mga03n38_235480_c1 | nmdc:mga03n38_235480_c1_349_831 | 157 |
| 527 | 3300050490 | nmdc:mga03n38_294965_c1 | nmdc:mga03n38_294965_c1_312_785 | 157 |
| 528 | 3300050490 | nmdc:mga03n38_59612_c1 | nmdc:mga03n38_59612_c1_1009_1482 | 157 |
| 529 | 3300050491 | nmdc:mga00v17_17049_c1 | nmdc:mga00v17_17049_c1_975_1448 | 157 |
| 530 | 3300050491 | nmdc:mga00v17_417445_c1 | nmdc:mga00v17_417445_c1_215_688 | 157 |
| 531 | 3300050491 | nmdc:mga00v17_5015_c1 | nmdc:mga00v17_5015_c1_5868_6341 | 157 |
| 532 | 3300050491 | nmdc:mga00v17_512928_c1 | nmdc:mga00v17_512928_c1_269_742 | 157 |
| 533 | 3300050492 | nmdc:mga0yw44_182206_c1 | nmdc:mga0yw44_182206_c1_278_751 | 157 |
| 534 | 3300050492 | nmdc:mga0yw44_5588_c1 | nmdc:mga0yw44_5588_c1_4592_5065 | 157 |
| 535 | 3300050492 | nmdc:mga0yw44_93741_c1 | nmdc:mga0yw44_93741_c1_702_1175 | 157 |
| 536 | 3300050493 | nmdc:mga0k408_43381_c1 | nmdc:mga0k408_43381_c1_661_1134 | 157 |
| 537 | 3300050493 | nmdc:mga0k408_64805_c1 | nmdc:mga0k408_64805_c1_1371_1844 | 157 |
| 538 | 3300050494 | nmdc:mga06z11_126411_c1 | nmdc:mga06z11_126411_c1_762_1235 | 157 |
| 539 | 3300050494 | nmdc:mga06z11_146969_c1 | nmdc:mga06z11_146969_c1_374_847 | 157 |
| 540 | 3300050496 | nmdc:mga07m45_147909_c1 | nmdc:mga07m45_147909_c1_124_597 | 157 |
| 541 | 3300050496 | nmdc:mga07m45_1850_c1 | nmdc:mga07m45_1850_c1_2922_3395 | 157 |
| 542 | 3300050496 | nmdc:mga07m45_2352_c1 | nmdc:mga07m45_2352_c1_4928_5401 | 157 |
| 543 | 3300050496 | nmdc:mga07m45_95942_c1 | nmdc:mga07m45_95942_c1_91_564 | 157 |
| 544 | 3300050507 | nmdc:mga05p37_7689_c2 | nmdc:mga05p37_7689_c2_3038_3511 | 157 |
| 545 | 3300050508 | nmdc:mga09592_484911_c1 | nmdc:mga09592_484911_c1_201_674 | 157 |
| 546 | 3300050509 | nmdc:mga0qj67_19203_c1 | nmdc:mga0qj67_19203_c1_978_1451 | 157 |
| 547 | 3300050510 | nmdc:mga06r32_290070_c1 | nmdc:mga06r32_290070_c1_438_911 | 157 |
| 548 | 3300050516 | nmdc:mga0sz30_120382_c1 | nmdc:mga0sz30_120382_c1_63_536 | 157 |
| 549 | 3300050516 | nmdc:mga0sz30_154032_c1 | nmdc:mga0sz30_154032_c1_361_834 | 157 |
| 550 | 3300050516 | nmdc:mga0sz30_1947_c1 | nmdc:mga0sz30_1947_c1_1704_2177 | 157 |
| 551 | 3300050516 | nmdc:mga0sz30_50598_c2 | nmdc:mga0sz30_50598_c2_506_979 | 157 |
| 552 | 3300050516 | nmdc:mga0sz30_6350_c1 | nmdc:mga0sz30_6350_c1_956_1447 | 157 |
| 553 | 3300053085 | Ga0495619_0037475 | Ga0495619_0037475_2583_3056 | 157 |
| 554 | 3300053087 | Ga0500643_002159 | Ga0500643_002159_9869_10342 | 157 |
| 555 | 3300053108 | Ga0500562_002482 | Ga0500562_002482_1786_2268 | 157 |
| 556 | 3300053151 | Ga0500604_0145528 | Ga0500604_0145528_186_668 | 157 |
| 557 | 3300053153 | Ga0500616_0012932 | Ga0500616_0012932_311_784 | 157 |
| 558 | 3300053153 | Ga0500616_0037591 | Ga0500616_0037591_301_783 | 157 |
| 559 | 3300060353 | Ga0501082_0496159 | Ga0501082_0496159_271_744 | 157 |
| 560 | 3300061719 | Ga0466962_0197329 | Ga0466962_0197329_250_723 | 157 |
| 561 | iso_pu_bacteria | 2547132424 | 2548696427 | 157 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zzt-assembly1.cif.gz_A-2 | crystal structure of the cytosolic domain of the cation diffusion facilitator family protein | 0.7504 | 95 | 156 |
| 4bts-assembly1.cif.gz_A3 | the crystal structure of the eukaryotic 40s ribosomal subunit in complex with eif1 and eif1a | 0.7298 | 98 | 157 |
| 5ndw-assembly1.cif.gz_s7 | crystal structure of aminoglycoside tc007 bound to the yeast 80s ribosome | 0.7252 | 98 | 157 |
| 8btr-assembly1.cif.gz_SH | giardia ribosome in pre-t hybrid state (d2) | 0.7215 | 105 | 157 |
| 6zxh-assembly1.cif.gz_H | cryo-em structure of a late human pre-40s ribosomal subunit - state h2 | 0.7063 | 110 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IET7_9_119_3.30.70.600 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S10 | 0.7711 | 96 | 157 | 3.30.70.600 |
| af_O00411_1126_1230_3.30.70.370 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7486 | 20 | 78 | 3.30.70.370 |
| 3bp1A01 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.7399 | 60 | 89 | 3.30.1130.10 |
| af_Q9VFE9_134_251_3.40.50.2060 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Sec1/Munc18 (SM) protein, domain 1 | 0.732 | 122 | 156 | 3.40.50.2060 |
| af_O53157_4_110_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.7004 | 96 | 157 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9F7Y2-F1-model_v4 | Uncharacterized protein | 0.9798 | 1 | 72 |
|
| AF-A0A2S9F7Y2-F1-model_v4 | Uncharacterized protein | 0.9538 | 1 | 72 |
|
| AF-A0A2S8BQU2-F1-model_v4 | Uncharacterized protein | 0.9314 | 88 | 157 |
|
| AF-A0A6S6P869-F1-model_v4 | Uncharacterized protein | 0.9271 | 1 | 157 |
|
| AF-A0A2S8M819-F1-model_v4 | deleted | 0.9215 | 1 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar