F463853

General Info

Members Datasets Scaffolds Average Seq Length
561 485 212 454

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0068138|Ga0495638_0068138_415_1899
Length 494
Sequence MVDIRLTALDKHCDLRKQWRQIDDISVRQGPGRKQMRTVAKIVRWLLGLVVLAIAALFAWLYIAPPELIRVGSGYSAKIVCSNVFIAGRDANEVLAVDVQAPGHPLLRLMRVSVDKNRGTVSAGLLGFLGKSLAVARDGLGCASVPDGDVGKARRTAVYAEPSAVSQDALWPEGERVEPSQDPVIAKLLDDAALTGTGMRAVVVVKNGRVVAERYGAGFSEKTPLLGWSMTKTVNAAIVGTLVKDGKMAVDNKGLFAPWKADGRAAISLADMMAMSSGLEFNEDYGDVADVTRMLYLEPDMAGFAEAKPLVAEVGKVFTYSSGTAVMLSRLWQDAIGDKGKALTWPRTALFQPLGMHSAVLETDEQGTFVGSSYLYATAHDWARFGQFLLQGGVWNGNQVLPAGFVDWMREPAPASKVYGKGQLWIEAPGDEKKPGAGVAAGLPKDTYWMEGHDGQTVTIIPSEQLVVVRLGLTPAKLGYRPQTMVGAVVTALH

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
12 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
13 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
18 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
19 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
20 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
21 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
22 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
23 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
24 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
25 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
26 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
27 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
28 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
29 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
30 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
31 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
32 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
33 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
34 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
35 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
36 2643221557 Ensifer sp. Root558 Isolate Unclassified
37 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
38 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
39 2643221607 Rhizobium sp. Root73 Isolate Unclassified
40 2643221610 Ensifer sp. Root74 Isolate Unclassified
41 2643221618 Ensifer sp. Root231 Isolate Unclassified
42 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
43 2643221626 Ensifer sp. Root31 Isolate Unclassified
44 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
45 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
46 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
47 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
48 2643221655 Ensifer sp. Root1252 Isolate Unclassified
49 2643221659 Ensifer sp. Root127 Isolate Unclassified
50 2643221668 Ensifer sp. Root423 Isolate Unclassified
51 2643221675 Ensifer sp. Root1298 Isolate Unclassified
52 2643221680 Ensifer sp. Root1312 Isolate Unclassified
53 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
54 2643221688 Rhizobium sp. Root482 Isolate Unclassified
55 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
56 2643221698 Ensifer sp. Root142 Isolate Unclassified
57 2643221712 Ensifer sp. Root258 Isolate Unclassified
58 2643221718 Rhizobium sp. Root268 Isolate Unclassified
59 2643221719 Rhizobium sp. Root274 Isolate Unclassified
60 2643221723 Ensifer sp. Root278 Isolate Unclassified
61 2643221726 Ensifer sp. Root954 Isolate Unclassified
62 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
63 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
64 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
65 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
66 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
67 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
68 2738543024 Aminobacter sp. AP02 Isolate Unclassified
69 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
70 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
71 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
72 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
73 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
74 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
75 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
76 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
77 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
78 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
79 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
80 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
81 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
82 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
83 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
84 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
85 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
86 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
87 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
88 2844163670 Ensifer sp. 1H6 Isolate Unclassified
89 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
90 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
91 2854911287 Brucella lupini LUP21 Isolate Unclassified
92 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
93 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
94 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
95 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
96 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
97 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
98 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
99 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
100 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
101 2857558681 Duganella sp. R-74565 Isolate Unclassified
102 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
103 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
104 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
105 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
106 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
107 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
108 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
109 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
110 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
111 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
112 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
113 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
114 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
115 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
116 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
117 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
118 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
119 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
120 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
121 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
122 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
123 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
124 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
125 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
126 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
127 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
128 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
129 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
130 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
131 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
132 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
133 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
134 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
135 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
136 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
137 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
138 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
139 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
140 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
141 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
142 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
143 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
144 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
145 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
146 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
147 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
148 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
149 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
150 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
151 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
152 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
153 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
154 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
155 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
156 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
157 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
158 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
159 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
160 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
161 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
162 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
163 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
164 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
165 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
169 2904424332 Duganella sp. 1411 Isolate Rhizosphere
170 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
171 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
172 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
173 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
174 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
175 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
176 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
177 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
178 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
179 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
180 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
181 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
182 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
183 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
184 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
185 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
186 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
187 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
188 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
189 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
190 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
191 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
192 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
193 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
194 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
195 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
196 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
197 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
198 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
199 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
200 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
201 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
202 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
203 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
204 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
205 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
206 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
207 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
208 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
209 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
210 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
211 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
212 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
213 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
214 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
215 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
216 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
217 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
218 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
219 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
220 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
221 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
222 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
223 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
224 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
225 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
226 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
227 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
228 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
229 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
230 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
231 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
232 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
233 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
234 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
235 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
236 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
237 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
238 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
239 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
240 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
241 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
242 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
243 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
244 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
245 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
246 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
247 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
248 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
249 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
250 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
251 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
252 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
253 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
254 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
255 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
256 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
257 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
258 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
259 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
260 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
261 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
262 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
263 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
264 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
265 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
266 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
267 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
268 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
269 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
270 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
271 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
272 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
273 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
274 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
275 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
276 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
277 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
278 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
279 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
280 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
281 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
282 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
283 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
284 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
285 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
286 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
287 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
288 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
289 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
290 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
291 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
292 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
293 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
294 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
295 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
296 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
297 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
298 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
299 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
300 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
301 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
302 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
303 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
304 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
305 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
306 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
307 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
308 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
309 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
310 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
311 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
312 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
313 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
314 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
315 3004167301 Mesorhizobium loti 582 Isolate Unclassified
316 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
317 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
318 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
319 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
320 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
321 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
322 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
323 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
324 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
325 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
326 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
327 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
328 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
329 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
330 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
331 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
332 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
333 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
334 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
335 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
336 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
337 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
338 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
339 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
340 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
341 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
342 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
343 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
344 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
345 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
346 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
347 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
348 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
349 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
350 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
351 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
352 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
353 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
354 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
355 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
356 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
357 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
358 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
359 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
360 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
361 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
362 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
363 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
364 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
365 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
366 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
368 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
369 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
370 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
371 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
373 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
375 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
378 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
379 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
380 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
385 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
386 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
387 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
388 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
389 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
390 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
391 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
392 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
393 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
394 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
395 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
396 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
397 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
398 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
399 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
400 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
401 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
402 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
403 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
404 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
405 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
406 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
407 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
408 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
409 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
410 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
411 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
412 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
413 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
414 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
415 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
416 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
417 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
418 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
419 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
422 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
423 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
424 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
425 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
428 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
452 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
455 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
456 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
457 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
458 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
459 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
460 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
461 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
462 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
463 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
466 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
467 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
468 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
469 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
470 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
471 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
472 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
473 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
474 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
475 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
476 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
477 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
478 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
479 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
480 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
481 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
482 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
483 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
484 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
485 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 37.61
Metatranscriptomes 0.18
Isolates 62.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.73
Nodule 48.84
Rhizoplane 1.25
Rhizosphere 26.74
Stem 0
Stem Tuber 0
Unclassified 14.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1000162 3300002741 Bacteria 55941
2 JGI25159J45721_1000014 3300002987 Bacteria 147809
3 JGI25151J46595_10015065 3300003187 Bacteria 3427
4 JGI25165J46597_1000015 3300003214 Bacteria 380891
5 rootH2_10197352 3300003320 Bacteria 2732
6 rootH1_10215448 3300003323 Bacteria 1670
7 JGI25160J50197_1000020 3300003354 Bacteria 232739
8 Ga0006562J51391_1005784 3300003578 Bacteria 4740
9 Ga0055542_1001100 3300003762 Bacteria 16357
10 Ga0055529_1002096 3300003763 Bacteria 4272
11 Ga0055526_1000018 3300003771 Bacteria 198838
12 Ga0055526_1000053 3300003771 Bacteria 114820
13 Ga0055526_1001900 3300003771 Bacteria 14483
14 Ga0055536_1003582 3300003781 Bacteria 8295
15 Ga0055530_10007721 3300003791 Bacteria 4470
16 Ga0055531_10006756 3300003794 Bacteria 6415
17 Ga0055543_1000047 3300004625 Bacteria 111073
18 Ga0065165_1000013 3300005262 Bacteria 301887
19 Ga0070676_10032287 3300005328 Bacteria 2999
20 Ga0070674_100018865 3300005356 Bacteria 4371
21 Ga0070665_100036237 3300005548 Bacteria 4963
22 Ga0070665_100068339 3300005548 Bacteria 3563
23 Ga0081539_10001091 3300005985 Bacteria 49336
24 Ga0075365_10021788 3300006038 Bacteria 4003
25 Ga0075365_10029474 3300006038 Bacteria 3509
26 Ga0075368_10068261 3300006042 Bacteria 1432
27 Ga0075362_10014991 3300006177 Bacteria 3143
28 Ga0079104_1002321 3300006946 Bacteria 10454
29 Ga0079104_1005270 3300006946 Bacteria 5211
30 Ga0105244_10003338 3300009036 Bacteria 11534
31 Ga0105238_10003321 3300009551 Bacteria 16057
32 Ga0157369_10241576 3300013105 Bacteria 1886
33 Ga0171463_1003 3300013249 Bacteria 695693
34 Ga0183363_1156 3300015690 Bacteria 16690
35 Ga0214544_1001800 3300021320 Bacteria 45046
36 Ga0214542_1000012 3300021321 Bacteria 235800
37 Ga0214543_1000024 3300021327 Bacteria 235745
38 Ga0214543_1000038 3300021327 Bacteria 182106
39 Ga0213872_10000001 3300021361 Bacteria 662532
40 Ga0213872_10000040 3300021361 Bacteria 122419
41 Ga0213872_10000714 3300021361 Bacteria 24970
42 Ga0213872_10000744 3300021361 Bacteria 24091
43 Ga0228711_1000008 3300022739 Bacteria 169893
44 Ga0228710_1000009 3300022740 Bacteria 169770
45 Ga0209436_100915 3300025208 Bacteria 11678
46 Ga0207425_1000847 3300025245 Bacteria 15065
47 Ga0209646_1000222 3300025246 Bacteria 61152
48 Ga0209026_1000025 3300025250 Bacteria 352548
49 Ga0209148_1000128 3300025254 Bacteria 179154
50 Ga0209759_1000121 3300025256 Bacteria 138469
51 Ga0209233_1000010 3300025261 Bacteria 1194329
52 Ga0209455_1000127 3300025272 Bacteria 162518
53 Ga0209130_1000034 3300025284 Bacteria 302439
54 Ga0209676_1000482 3300025292 Bacteria 65372
55 Ga0209025_1000314 3300025294 Bacteria 107720
56 Ga0209025_1008405 3300025294 Bacteria 7437
57 Ga0209025_1039125 3300025294 Bacteria 2074
58 Ga0209564_1000011 3300025295 Bacteria 822327
59 Ga0209564_1000013 3300025295 Bacteria 775755
60 Ga0209564_1000068 3300025295 Bacteria 311171
61 Ga0209758_1001108 3300025297 Bacteria 34770
62 Ga0209758_1018462 3300025297 Bacteria 3415
63 Ga0209050_1000646 3300025298 Bacteria 54050
64 Ga0209256_1001575 3300025299 Bacteria 22398
65 Ga0207426_1000006 3300025302 Bacteria 1025969
66 Ga0209051_1001414 3300025303 Bacteria 20618
67 Ga0209257_1005641 3300025304 Bacteria 8660
68 Ga0207655_1011391 3300025728 Bacteria 5299
69 Ga0207657_10081429 3300025919 Bacteria 2719
70 Ga0207639_10024950 3300026041 Bacteria 4331
71 Ga0207674_10296668 3300026116 Bacteria 1565
72 Ga0209281_1000106 3300027111 Bacteria 219666
73 Ga0209282_1000024 3300027666 Bacteria 170348
74 Ga0265318_10009184 3300028577 Bacteria 4360
75 Ga0307515_10015685 3300028794 Bacteria 13943
76 Ga0307513_10012757 3300031456 Bacteria 10350
77 Ga0265314_10010831 3300031711 Bacteria 7581
78 Ga0265314_10047452 3300031711 Bacteria 3022
79 Ga0307516_10000013 3300031730 Bacteria 217896
80 Ga0307406_10019983 3300031901 Bacteria 3937
81 Ga0307412_10134263 3300031911 Bacteria 1803
82 Ga0315914_1000012 3300031967 Bacteria 169896
83 Ga0307409_100093972 3300031995 Bacteria 2466
84 Ga0315913_1000006 3300033430 Bacteria 169893
85 Ga0315915_1000010 3300033464 Bacteria 240214
86 Ga0373927_0000350 3300035695 Bacteria 36173
87 Ga0395899_0000117 3300037312 Bacteria 130159
88 Ga0395900_0000020 3300037418 Bacteria 353500
89 Ga0395900_0094593 3300037418 Bacteria 3070
90 Ga0395900_0113086 3300037418 Bacteria 2787
91 Ga0395898_0000259 3300037466 Bacteria 130131
92 Ga0395905_0000019 3300037471 Bacteria 353500
93 Ga0395905_0007902 3300037471 Bacteria 10522
94 Ga0395905_0008452 3300037471 Bacteria 10151
95 Ga0395905_0087931 3300037471 Bacteria 2913
96 Ga0395905_0121894 3300037471 Bacteria 2451
97 Ga0395901_0000016 3300038443 Bacteria 354008
98 Ga0395901_0071862 3300038443 Bacteria 3606
99 Ga0436361_0071709 3300039447 Bacteria 10709
100 Ga0436361_0424705 3300039447 Bacteria 4836
101 Ga0436361_0505222 3300039447 Bacteria 10703
102 Ga0436361_0599717 3300039447 Bacteria 43072
103 Ga0436361_0953601 3300039447 Bacteria 68101
104 Ga0436361_1185928 3300039447 Bacteria 172199
105 Ga0439436_0003799 3300041404 Bacteria 4621
106 Ga0439465_0009428 3300041413 Bacteria 3076
107 Ga0450906_001570 3300042145 Bacteria 4992
108 Ga0495617_000355 3300046452 Bacteria 25292
109 Ga0495627_000008 3300046453 Bacteria 572150
110 Ga0495638_0049277 3300046460 Bacteria 2633
111 Ga0495638_0068138 3300046460 Bacteria 2183
112 Ga0495650_0000019 3300046471 Bacteria 533849
113 Ga0495650_0000072 3300046471 Bacteria 257886
114 Ga0495607_0010362 3300046501 Bacteria 6271
115 Ga0495606_0000212 3300046507 Bacteria 103309
116 Ga0495606_0004890 3300046507 Bacteria 13127
117 Ga0495610_0001513 3300046512 Bacteria 20446
118 Ga0495620_0021612 3300046515 Bacteria 3122
119 Ga0495637_0002326 3300046520 Bacteria 10523
120 Ga0495643_0000028 3300046522 Bacteria 262886
121 Ga0495648_0063993 3300046524 Bacteria 2168
122 Ga0495622_0000001 3300046557 Bacteria 365248
123 Ga0495668_0006558 3300046616 Bacteria 7601
124 Ga0495671_0016189 3300046692 Bacteria 3987
125 Ga0495660_0000118 3300046810 Bacteria 85202
126 Ga0495660_0000314 3300046810 Bacteria 43822
127 Ga0495672_0000221 3300047320 Bacteria 81255
128 Ga0495673_0000035 3300047469 Bacteria 316861
129 Ga0496102_0000097 3300048905 Bacteria 124414
130 Ga0496103_0004534 3300048906 Bacteria 8411
131 Ga0496112_0018344 3300048915 Bacteria 6588
132 Ga0496115_0109758 3300048918 Bacteria 2266
133 Ga0496119_0081595 3300048922 Bacteria 1862
134 Ga0496120_0001104 3300048923 Bacteria 35202
135 Ga0496125_0063776 3300048928 Bacteria 2935
136 Ga0496126_0264054 3300048929 Bacteria 1431
137 Ga0495678_000029 3300049459 Bacteria 219803
138 Ga0501031_0000036 3300049568 Bacteria 73760
139 Ga0501031_0013250 3300049568 Bacteria 5381
140 Ga0501032_0000100 3300049569 Bacteria 73505
141 Ga0501033_0000088 3300049570 Bacteria 87638
142 Ga0501033_0002727 3300049570 Bacteria 14814
143 Ga0501034_0000397 3300049571 Bacteria 73511
144 Ga0501034_0028325 3300049571 Bacteria 5699
145 Ga0501034_0180066 3300049571 Bacteria 2078
146 Ga0501034_0250966 3300049571 Bacteria 1714
147 Ga0501036_0000056 3300049572 Bacteria 73511
148 Ga0501036_0135517 3300049572 Bacteria 2078
149 Ga0501037_0000119 3300049573 Bacteria 73510
150 Ga0501037_0000181 3300049573 Bacteria 58438
151 Ga0501037_0024538 3300049573 Bacteria 4459
152 Ga0501037_0059287 3300049573 Bacteria 2792
153 Ga0501037_0109182 3300049573 Bacteria 1993
154 Ga0501038_0000098 3300049574 Bacteria 73471
155 Ga0501038_0139728 3300049574 Bacteria 1982
156 Ga0501038_0160291 3300049574 Bacteria 1828
157 Ga0501039_0000013 3300049575 Bacteria 234418
158 Ga0501039_0085138 3300049575 Bacteria 2462
159 Ga0501039_0174362 3300049575 Bacteria 1691
160 Ga0501040_0004362 3300049576 Bacteria 9195
161 Ga0501042_0021169 3300049578 Bacteria 4529
162 Ga0501043_0000008 3300049579 Bacteria 223654
163 Ga0501043_0001191 3300049579 Bacteria 22880
164 Ga0501043_0056744 3300049579 Bacteria 3076
165 Ga0501046_0064007 3300049580 Bacteria 2871
166 Ga0501046_0115920 3300049580 Bacteria 2042
167 Ga0501046_0129795 3300049580 Bacteria 1912
168 Ga0501047_0003462 3300049581 Bacteria 14913
169 Ga0501047_0004753 3300049581 Bacteria 12775
170 Ga0501047_0053027 3300049581 Bacteria 3920
171 Ga0501047_0211988 3300049581 Bacteria 1795
172 Ga0501069_0000028 3300049585 Bacteria 106038
173 Ga0501069_0001649 3300049585 Bacteria 11086
174 Ga0501069_0031682 3300049585 Bacteria 2910
175 Ga0501069_0048437 3300049585 Bacteria 2360
176 Ga0501070_0000264 3300049586 Bacteria 49510
177 Ga0501070_0000476 3300049586 Bacteria 36484
178 Ga0501070_0033306 3300049586 Bacteria 4311
179 Ga0501070_0037219 3300049586 Bacteria 4062
180 Ga0501070_0061940 3300049586 Bacteria 3099
181 Ga0501070_0082755 3300049586 Bacteria 2656
182 Ga0501073_0009410 3300049589 Bacteria 7216
183 Ga0501074_0000016 3300049590 Bacteria 78666
184 Ga0501080_0000065 3300049742 Bacteria 69171
185 Ga0501080_0003495 3300049742 Bacteria 13843
186 Ga0501280_007780 3300049776 Bacteria 1496
187 Ga0501035_0000011 3300049822 Bacteria 305794
188 Ga0501035_0000053 3300049822 Bacteria 142860
189 Ga0501035_0006304 3300049822 Bacteria 11149
190 Ga0501035_0013336 3300049822 Bacteria 7583
191 Ga0501035_0014017 3300049822 Bacteria 7395
192 Ga0501035_0015327 3300049822 Bacteria 7074
193 Ga0501035_0077630 3300049822 Bacteria 2935
194 Ga0501044_0000011 3300049823 Bacteria 257385
195 Ga0501044_0000214 3300049823 Bacteria 73483
196 Ga0501044_0003679 3300049823 Bacteria 17236
197 Ga0501044_0007800 3300049823 Bacteria 11765
198 Ga0501044_0009668 3300049823 Bacteria 10490
199 Ga0501044_0314277 3300049823 Bacteria 1492
200 Ga0501045_0053563 3300049824 Bacteria 2948
201 nmdc:mga0yw44_2190_c1 3300050492 Bacteria 8219
202 nmdc:mga0yw44_24336_c1 3300050492 Bacteria 3425
203 nmdc:mga0yw44_45557_c1 3300050492 Bacteria 2630
204 nmdc:mga06z11_13235_c1 3300050494 Bacteria 3615
205 Ga0500644_0001357 3300053088 Bacteria 6553
206 Ga0500608_001554 3300053122 Bacteria 8230
207 Ga0500658_0026008 3300053134 Bacteria 2253
208 Ga0500559_0005812 3300053136 Bacteria 5627
209 Ga0500568_0000093 3300053139 Bacteria 83403
210 Ga0500620_000359 3300053155 Bacteria 8467
211 Ga0500622_0000627 3300053156 Bacteria 31781
212 Ga0501082_0040233 3300060353 Bacteria 4033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049776 Ga0501280_007780 Ga0501280_007780_14_1108 354
2 iso_pu_bacteria 2885312484 2885317973 390
3 iso_pu_bacteria 3004167301 3004168921 391
4 3300049586 Ga0501070_0033306 Ga0501070_0033306_11_1216 393
5 3300049571 Ga0501034_0250966 Ga0501034_0250966_19_1251 401
6 3300003320 rootH2_10197352 rootH2_101973523 407
7 3300046501 Ga0495607_0010362 Ga0495607_0010362_2702_3991 414
8 3300028577 Ga0265318_10009184 Ga0265318_100091843 418
9 3300031711 Ga0265314_10047452 Ga0265314_100474523 418
10 3300041413 Ga0439465_0009428 Ga0439465_0009428_554_1858 418
11 3300025246 Ga0209646_1000222 Ga0209646_100022224 420
12 3300047469 Ga0495673_0000035 Ga0495673_0000035_240309_241706 422
13 3300048905 Ga0496102_0000097 Ga0496102_0000097_92271_93617 423
14 iso_pu_bacteria 2878730984 2878736105 423
15 iso_pu_bacteria 2924754689 2924762141 423
16 3300003771 Ga0055526_1000053 Ga0055526_100005311 424
17 3300009036 Ga0105244_10003338 Ga0105244_100033384 424
18 3300025295 Ga0209564_1000011 Ga0209564_100001112 424
19 3300025728 Ga0207655_1011391 Ga0207655_10113914 424
20 3300046471 Ga0495650_0000072 Ga0495650_0000072_102969_104345 424
21 3300046616 Ga0495668_0006558 Ga0495668_0006558_5292_6668 424
22 3300048928 Ga0496125_0063776 Ga0496125_0063776_499_1875 424
23 iso_pu_bacteria 2881861095 2881867297 425
24 iso_pu_bacteria 2970540015 2970547203 427
25 iso_pu_bacteria 2915650412 2915653918 428
26 3300046507 Ga0495606_0000212 Ga0495606_0000212_79858_81264 429
27 3300049586 Ga0501070_0082755 Ga0501070_0082755_240_1616 429
28 3300049822 Ga0501035_0015327 Ga0501035_0015327_59_1435 429
29 iso_pu_bacteria 2513237159 2514001492 429
30 iso_pu_bacteria 2582581306 2585267412 429
31 iso_pu_bacteria 2582581865 2585386480 429
32 iso_pu_bacteria 2643221637 2644209018 429
33 iso_pu_bacteria 2643221688 2644492040 429
34 iso_pu_bacteria 2643221718 2644652548 429
35 iso_pu_bacteria 2842521101 2842521825 429
36 iso_pu_bacteria 2854911287 2854911993 429
37 3300015690 Ga0183363_1156 Ga0183363_11562 430
38 3300025245 Ga0207425_1000847 Ga0207425_10008473 431
39 3300025294 Ga0209025_1008405 Ga0209025_10084056 431
40 3300025297 Ga0209758_1001108 Ga0209758_100110811 431
41 3300031730 Ga0307516_10000013 Ga0307516_10000013135 431
42 iso_pu_bacteria 2582581866 2585393267 431
43 3300031456 Ga0307513_10012757 Ga0307513_100127578 432
44 3300046512 Ga0495610_0001513 Ga0495610_0001513_15266_16657 432
45 3300046522 Ga0495643_0000028 Ga0495643_0000028_127006_128397 432
46 3300046524 Ga0495648_0063993 Ga0495648_0063993_72_1463 432
47 3300046810 Ga0495660_0000118 Ga0495660_0000118_67947_69401 432
48 3300047320 Ga0495672_0000221 Ga0495672_0000221_20246_21637 432
49 3300049459 Ga0495678_000029 Ga0495678_000029_108572_109963 432
50 iso_pu_bacteria 2582581283 2585166360 432
51 iso_pu_bacteria 2643221607 2644050507 432
52 iso_pu_bacteria 2643221636 2644205735 432
53 iso_pu_bacteria 2643221686 2644483425 432
54 iso_pu_bacteria 2643221689 2644499637 432
55 3300003578 Ga0006562J51391_1005784 Ga0006562J51391_10057844 433
56 3300013249 Ga0171463_1003 Ga0171463_1003153 433
57 3300025294 Ga0209025_1039125 Ga0209025_10391252 433
58 3300031911 Ga0307412_10134263 Ga0307412_101342631 433
59 3300042145 Ga0450906_001570 Ga0450906_001570_3607_4956 433
60 3300049581 Ga0501047_0211988 Ga0501047_0211988_49_1467 433
61 3300046557 Ga0495622_0000001 Ga0495622_0000001_240506_241966 434
62 3300049573 Ga0501037_0059287 Ga0501037_0059287_561_1943 434
63 3300049574 Ga0501038_0160291 Ga0501038_0160291_51_1433 434
64 3300049580 Ga0501046_0115920 Ga0501046_0115920_618_2000 434
65 3300049822 Ga0501035_0077630 Ga0501035_0077630_624_2000 434
66 3300049823 Ga0501044_0314277 Ga0501044_0314277_32_1414 434
67 3300002987 JGI25159J45721_1000014 JGI25159J45721_100001467 435
68 3300003187 JGI25151J46595_10015065 JGI25151J46595_100150652 435
69 3300003354 JGI25160J50197_1000020 JGI25160J50197_100002067 435
70 3300003771 Ga0055526_1001900 Ga0055526_10019008 435
71 3300003781 Ga0055536_1003582 Ga0055536_10035824 435
72 3300003791 Ga0055530_10007721 Ga0055530_100077214 435
73 3300003794 Ga0055531_10006756 Ga0055531_100067564 435
74 3300004625 Ga0055543_1000047 Ga0055543_100004730 435
75 3300005262 Ga0065165_1000013 Ga0065165_1000013152 435
76 3300009551 Ga0105238_10003321 Ga0105238_1000332113 435
77 3300025208 Ga0209436_100915 Ga0209436_1009152 435
78 3300025284 Ga0209130_1000034 Ga0209130_1000034148 435
79 3300025292 Ga0209676_1000482 Ga0209676_100048255 435
80 3300025294 Ga0209025_1000314 Ga0209025_10003149 435
81 3300025295 Ga0209564_1000013 Ga0209564_1000013147 435
82 3300025298 Ga0209050_1000646 Ga0209050_100064642 435
83 3300025299 Ga0209256_1001575 Ga0209256_100157512 435
84 3300025302 Ga0207426_1000006 Ga0207426_1000006521 435
85 3300025303 Ga0209051_1001414 Ga0209051_100141414 435
86 3300025304 Ga0209257_1005641 Ga0209257_10056416 435
87 3300026041 Ga0207639_10024950 Ga0207639_100249503 435
88 3300028794 Ga0307515_10015685 Ga0307515_1001568510 435
89 3300037418 Ga0395900_0113086 Ga0395900_0113086_1121_2503 435
90 3300046452 Ga0495617_000355 Ga0495617_000355_22375_23775 435
91 3300048929 Ga0496126_0264054 Ga0496126_0264054_68_1399 435
92 iso_pu_bacteria 2791355253 2793280295 435
93 3300031995 Ga0307409_100093972 Ga0307409_1000939722 436
94 3300037312 Ga0395899_0000117 Ga0395899_0000117_20795_22180 436
95 3300037418 Ga0395900_0000020 Ga0395900_0000020_20795_22180 436
96 3300037466 Ga0395898_0000259 Ga0395898_0000259_20795_22180 436
97 3300037471 Ga0395905_0000019 Ga0395905_0000019_331321_332706 436
98 3300038443 Ga0395901_0000016 Ga0395901_0000016_21303_22688 436
99 3300041404 Ga0439436_0003799 Ga0439436_0003799_2682_4076 436
100 iso_pu_bacteria 2551306087 2551698044 436
101 3300049574 Ga0501038_0139728 Ga0501038_0139728_282_1658 437
102 iso_pu_bacteria 2599185352 2600194404 437
103 iso_pu_bacteria 2643221557 2643803077 437
104 iso_pu_bacteria 2643221610 2644063439 437
105 iso_pu_bacteria 2643221668 2644374722 437
106 iso_pu_bacteria 2643221675 2644414202 437
107 iso_pu_bacteria 2643221680 2644447730 437
108 iso_pu_bacteria 2643221723 2644676068 437
109 iso_pu_bacteria 2643221726 2644690203 437
110 iso_pu_bacteria 2857558681 2857559172 437
111 iso_pu_bacteria 2958158011 2958161512 437
112 iso_pu_bacteria 2643221618 2644107267 438
113 iso_pu_bacteria 2643221626 2644150833 438
114 iso_pu_bacteria 2643221655 2644308662 438
115 iso_pu_bacteria 2643221659 2644335480 438
116 iso_pu_bacteria 2643221698 2644539885 438
117 iso_pu_bacteria 2643221712 2644614603 438
118 iso_pu_bacteria 2657244999 2657681572 438
119 iso_pu_bacteria 2802429268 2804752763 438
120 iso_pu_bacteria 2844163670 2844164585 438
121 iso_pu_bacteria 2920822456 2920825225 438
122 iso_pu_bacteria 2941499720 2941502125 438
123 3300053088 Ga0500644_0001357 Ga0500644_0001357_4961_6379 439
124 iso_pu_bacteria 2508501122 2509108385 439
125 iso_pu_bacteria 2509276019 2509376482 439
126 iso_pu_bacteria 2512875026 2512970672 439
127 iso_pu_bacteria 2513237089 2513604284 439
128 iso_pu_bacteria 2513237156 2513988378 439
129 iso_pu_bacteria 2513237160 2514006367 439
130 iso_pu_bacteria 2515154107 2515609032 439
131 iso_pu_bacteria 2517487022 2517570357 439
132 iso_pu_bacteria 2558860100 2558864450 439
133 iso_pu_bacteria 2802428858 2802720053 439
134 iso_pu_bacteria 2802428859 2802727014 439
135 iso_pu_bacteria 2802428860 2802731983 439
136 iso_pu_bacteria 2802428861 2802739314 439
137 iso_pu_bacteria 2802428862 2802745705 439
138 iso_pu_bacteria 2802428863 2802752306 439
139 iso_pu_bacteria 2850079185 2850081478 439
140 iso_pu_bacteria 2904424332 2904425755 439
141 iso_pu_bacteria 2915980308 2915981464 439
142 iso_pu_bacteria 2916061851 2916064879 439
143 iso_pu_bacteria 2921250672 2921252111 439
144 iso_pu_bacteria 2936996657 2937000719 439
145 iso_pu_bacteria 2937029754 2937030311 439
146 iso_pu_bacteria 2937036028 2937042693 439
147 iso_pu_bacteria 2937078374 2937080251 439
148 iso_pu_bacteria 2937084907 2937088799 439
149 iso_pu_bacteria 2957375807 2957376360 439
150 iso_pu_bacteria 2957437181 2957439380 439
151 iso_pu_bacteria 2960591022 2960592111 439
152 iso_pu_bacteria 2960631154 2960632071 439
153 iso_pu_bacteria 2960680706 2960681646 439
154 iso_pu_bacteria 2960693952 2960694778 439
155 iso_pu_bacteria 2967686174 2967692108 439
156 iso_pu_bacteria 2967728569 2967728970 439
157 iso_pu_bacteria 2970026789 2970028320 439
158 iso_pu_bacteria 2970122695 2970125799 439
159 iso_pu_bacteria 2970143518 2970146705 439
160 iso_pu_bacteria 2977530762 2977534032 439
161 iso_pu_bacteria 2977544691 2977546383 439
162 iso_pu_bacteria 8003999396 8004001821 439
163 iso_pu_bacteria 8018150411 8018153239 439
164 iso_pu_bacteria 8056875544 8056877287 439
165 3300025297 Ga0209758_1018462 Ga0209758_10184622 440
166 3300037471 Ga0395905_0121894 Ga0395905_0121894_729_2111 440
167 3300038443 Ga0395901_0071862 Ga0395901_0071862_607_1989 440
168 3300046453 Ga0495627_000008 Ga0495627_000008_70380_71834 440
169 3300046810 Ga0495660_0000314 Ga0495660_0000314_14526_15980 440
170 iso_pu_bacteria 643692032 643826323 440
171 3300021361 Ga0213872_10000714 Ga0213872_1000071419 441
172 3300039447 Ga0436361_0599717 Ga0436361_0599717_36551_37924 441
173 3300046520 Ga0495637_0002326 Ga0495637_0002326_5652_7052 441
174 3300046692 Ga0495671_0016189 Ga0495671_0016189_1200_2597 441
175 3300053122 Ga0500608_001554 Ga0500608_001554_5487_6911 441
176 3300053156 Ga0500622_0000627 Ga0500622_0000627_20209_21633 441
177 iso_pu_bacteria 2690316117 2692315529 441
178 iso_pu_bacteria 2751185821 2753462039 441
179 iso_pu_bacteria 2791355082 2792585117 441
180 iso_pu_bacteria 2791355094 2792639055 441
181 iso_pu_bacteria 2848992105 2848994436 441
182 iso_pu_bacteria 8049293176 8049295331 441
183 3300003771 Ga0055526_1000018 Ga0055526_1000018102 442
184 3300025295 Ga0209564_1000068 Ga0209564_1000068208 442
185 3300048906 Ga0496103_0004534 Ga0496103_0004534_517_1965 442
186 iso_pu_bacteria 2643221653 2644298681 442
187 iso_pu_bacteria 2643221719 2644656910 442
188 iso_pu_bacteria 2775507049 2776913936 442
189 iso_pu_bacteria 2818991272 2819241392 442
190 iso_pu_bacteria 2889790730 2889792982 442
191 iso_pu_bacteria 2899803654 2899807257 442
192 iso_pu_bacteria 2989776772 2989779216 442
193 iso_pu_bacteria 8005246636 8005248778 442
194 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015168 443
195 3300003323 rootH1_10215448 rootH1_102154481 443
196 3300006946 Ga0079104_1002321 Ga0079104_10023218 443
197 3300006946 Ga0079104_1005270 Ga0079104_10052703 443
198 3300021327 Ga0214543_1000038 Ga0214543_100003855 443
199 3300021361 Ga0213872_10000001 Ga0213872_10000001533 443
200 3300021361 Ga0213872_10000040 Ga0213872_1000004037 443
201 3300021361 Ga0213872_10000744 Ga0213872_1000074412 443
202 3300022739 Ga0228711_1000008 Ga0228711_100000815 443
203 3300022740 Ga0228710_1000009 Ga0228710_100000914 443
204 3300025261 Ga0209233_1000010 Ga0209233_1000010266 443
205 3300027111 Ga0209281_1000106 Ga0209281_1000106217 443
206 3300027666 Ga0209282_1000024 Ga0209282_1000024148 443
207 3300031711 Ga0265314_10010831 Ga0265314_100108314 443
208 3300031967 Ga0315914_1000012 Ga0315914_100001215 443
209 3300033430 Ga0315913_1000006 Ga0315913_100000615 443
210 3300033464 Ga0315915_1000010 Ga0315915_1000010250 443
211 3300035695 Ga0373927_0000350 Ga0373927_0000350_3454_4866 443
212 3300037418 Ga0395900_0094593 Ga0395900_0094593_546_2003 443
213 3300037471 Ga0395905_0007902 Ga0395905_0007902_1660_3108 443
214 3300037471 Ga0395905_0008452 Ga0395905_0008452_5551_6999 443
215 3300039447 Ga0436361_0071709 Ga0436361_0071709_3059_4483 443
216 3300039447 Ga0436361_0424705 Ga0436361_0424705_1931_3355 443
217 3300039447 Ga0436361_0505222 Ga0436361_0505222_7798_9222 443
218 3300039447 Ga0436361_0953601 Ga0436361_0953601_57544_58968 443
219 3300039447 Ga0436361_1185928 Ga0436361_1185928_5840_7264 443
220 3300046471 Ga0495650_0000019 Ga0495650_0000019_71126_72523 443
221 3300046507 Ga0495606_0004890 Ga0495606_0004890_9604_11001 443
222 3300053136 Ga0500559_0005812 Ga0500559_0005812_1099_2556 443
223 iso_pu_bacteria 2856364286 2856369478 444
224 iso_pu_bacteria 2869285874 2869286168 444
225 iso_pu_bacteria 2871429161 2871434601 444
226 iso_pu_bacteria 2874155637 2874158065 444
227 iso_pu_bacteria 2876413966 2876416269 444
228 iso_pu_bacteria 2878745973 2878751734 444
229 iso_pu_bacteria 2881161766 2881167550 444
230 iso_pu_bacteria 2885305155 2885309451 444
231 iso_pu_bacteria 2885326080 2885333504 444
232 iso_pu_bacteria 2885334103 2885337082 444
233 iso_pu_bacteria 2889914905 2889919434 444
234 iso_pu_bacteria 2906308376 2906314132 444
235 iso_pu_bacteria 2989771324 2989774298 444
236 3300021320 Ga0214544_1001800 Ga0214544_10018005 445
237 3300021321 Ga0214542_1000012 Ga0214542_100001277 445
238 3300021327 Ga0214543_1000024 Ga0214543_100002478 445
239 iso_pu_bacteria 2508501127 2509143288 445
240 iso_pu_bacteria 2558860983 2561468359 445
241 iso_pu_bacteria 2738543024 2739307180 445
242 iso_pu_bacteria 2937843397 2937848025 445
243 iso_pu_bacteria 8002285264 8002289027 445
244 3300005548 Ga0070665_100068339 Ga0070665_1000683391 446
245 3300049575 Ga0501039_0174362 Ga0501039_0174362_211_1575 446
246 iso_pu_bacteria 2643221564 2643840028 446
247 iso_pu_bacteria 2996310559 2996314060 446
248 iso_pu_bacteria 2503198000 2503201550 447
249 iso_pu_bacteria 2508501123 2509113153 447
250 iso_pu_bacteria 2509276018 2509367805 447
251 iso_pu_bacteria 2509276022 2509396324 447
252 iso_pu_bacteria 2510065059 2510315483 447
253 iso_pu_bacteria 2512875016 2512931478 447
254 iso_pu_bacteria 2512875024 2512959311 447
255 iso_pu_bacteria 2513237164 2514033642 447
256 iso_pu_bacteria 2513237351 2514589254 447
257 iso_pu_bacteria 2588253730 2588517313 447
258 iso_pu_bacteria 2597489875 2597813213 447
259 iso_pu_bacteria 2643221550 2643771101 447
260 iso_pu_bacteria 2643221551 2643776104 447
261 iso_pu_bacteria 2643221555 2643794551 447
262 iso_pu_bacteria 2643221595 2643984415 447
263 iso_pu_bacteria 2643221627 2644153272 447
264 iso_pu_bacteria 2687453392 2688598462 447
265 iso_pu_bacteria 2721755686 2723575395 447
266 iso_pu_bacteria 2756170246 2756675450 447
267 iso_pu_bacteria 2791355123 2792749257 447
268 iso_pu_bacteria 2841734538 2841739215 447
269 iso_pu_bacteria 2844002411 2844007407 447
270 iso_pu_bacteria 2844009547 2844013720 447
271 iso_pu_bacteria 2856320880 2856327460 447
272 iso_pu_bacteria 2856328259 2856330921 447
273 iso_pu_bacteria 2856334872 2856340739 447
274 iso_pu_bacteria 2856342000 2856344967 447
275 iso_pu_bacteria 2856349417 2856350122 447
276 iso_pu_bacteria 2857367948 2857371798 447
277 iso_pu_bacteria 2869162929 2869169065 447
278 iso_pu_bacteria 2869169390 2869175672 447
279 iso_pu_bacteria 2869234852 2869236541 447
280 iso_pu_bacteria 2869242130 2869245055 447
281 iso_pu_bacteria 2869249662 2869251751 447
282 iso_pu_bacteria 2869256925 2869260280 447
283 iso_pu_bacteria 2869271264 2869272917 447
284 iso_pu_bacteria 2869278585 2869284949 447
285 iso_pu_bacteria 2871435913 2871441157 447
286 iso_pu_bacteria 2871451962 2871454037 447
287 iso_pu_bacteria 2871459585 2871462559 447
288 iso_pu_bacteria 2871466892 2871467858 447
289 iso_pu_bacteria 2871474448 2871480427 447
290 iso_pu_bacteria 2871481445 2871481656 447
291 iso_pu_bacteria 2871488783 2871494527 447
292 iso_pu_bacteria 2874109183 2874112517 447
293 iso_pu_bacteria 2874116593 2874119520 447
294 iso_pu_bacteria 2874123672 2874130617 447
295 iso_pu_bacteria 2874139085 2874145890 447
296 iso_pu_bacteria 2874162495 2874167515 447
297 iso_pu_bacteria 2874168670 2874169879 447
298 iso_pu_bacteria 2876363079 2876368458 447
299 iso_pu_bacteria 2876386047 2876389903 447
300 iso_pu_bacteria 2876399893 2876406559 447
301 iso_pu_bacteria 2876406927 2876408978 447
302 iso_pu_bacteria 2876420981 2876426880 447
303 iso_pu_bacteria 2878738818 2878745233 447
304 iso_pu_bacteria 2878753008 2878758891 447
305 iso_pu_bacteria 2881155292 2881155323 447
306 iso_pu_bacteria 2881845957 2881851716 447
307 iso_pu_bacteria 2881853255 2881858151 447
308 iso_pu_bacteria 2882632389 2882636290 447
309 iso_pu_bacteria 2885318864 2885319972 447
310 iso_pu_bacteria 2885342637 2885349617 447
311 iso_pu_bacteria 2885350715 2885356713 447
312 iso_pu_bacteria 2888337043 2888339441 447
313 iso_pu_bacteria 2888343758 2888346838 447
314 iso_pu_bacteria 2903448605 2903451338 447
315 iso_pu_bacteria 2903492973 2903503870 447
316 iso_pu_bacteria 2903521522 2903527457 447
317 iso_pu_bacteria 2903528002 2903533911 447
318 iso_pu_bacteria 2906363423 2906366392 447
319 iso_pu_bacteria 2906370794 2906373379 447
320 iso_pu_bacteria 2906378014 2906383616 447
321 iso_pu_bacteria 2906386501 2906390738 447
322 iso_pu_bacteria 2906393657 2906398278 447
323 iso_pu_bacteria 2906401398 2906405407 447
324 iso_pu_bacteria 2906408224 2906414047 447
325 iso_pu_bacteria 2922151315 2922152088 447
326 iso_pu_bacteria 2922172374 2922174269 447
327 iso_pu_bacteria 2922178524 2922179620 447
328 iso_pu_bacteria 2924718760 2924724964 447
329 iso_pu_bacteria 2924733363 2924736422 447
330 iso_pu_bacteria 2924748358 2924751624 447
331 iso_pu_bacteria 2924762789 2924764229 447
332 iso_pu_bacteria 2924776078 2924783370 447
333 iso_pu_bacteria 2924784321 2924789095 447
334 iso_pu_bacteria 2937848649 2937853164 447
335 iso_pu_bacteria 2937861824 2937862972 447
336 iso_pu_bacteria 2937868953 2937877198 447
337 iso_pu_bacteria 2937877337 2937882106 447
338 iso_pu_bacteria 2937972304 2937978566 447
339 iso_pu_bacteria 2937980651 2937982962 447
340 iso_pu_bacteria 2958034702 2958040651 447
341 iso_pu_bacteria 2958041894 2958056733 447
342 iso_pu_bacteria 2958064165 2958064359 447
343 iso_pu_bacteria 2958071322 2958078181 447
344 iso_pu_bacteria 2958084443 2958089228 447
345 iso_pu_bacteria 2958108152 2958113948 447
346 iso_pu_bacteria 2958122699 2958124964 447
347 iso_pu_bacteria 2958137437 2958140151 447
348 iso_pu_bacteria 2958144490 2958150522 447
349 iso_pu_bacteria 2961170736 2961176030 447
350 iso_pu_bacteria 2961183825 2961187004 447
351 iso_pu_bacteria 2963644680 2963647735 447
352 iso_pu_bacteria 2965025482 2965031730 447
353 iso_pu_bacteria 2965032056 2965036269 447
354 iso_pu_bacteria 2965040258 2965045753 447
355 iso_pu_bacteria 2965047637 2965050294 447
356 iso_pu_bacteria 2965089291 2965094307 447
357 iso_pu_bacteria 2965102966 2965106568 447
358 iso_pu_bacteria 2965110997 2965116598 447
359 iso_pu_bacteria 2967996073 2968001918 447
360 iso_pu_bacteria 2968003550 2968009058 447
361 iso_pu_bacteria 2968016561 2968018427 447
362 iso_pu_bacteria 2968083720 2968090368 447
363 iso_pu_bacteria 2968138860 2968140918 447
364 iso_pu_bacteria 2970469710 2970471399 447
365 iso_pu_bacteria 2970489779 2970491100 447
366 iso_pu_bacteria 2970503327 2970508696 447
367 iso_pu_bacteria 2970510686 2970514637 447
368 iso_pu_bacteria 2970524798 2970528608 447
369 iso_pu_bacteria 2970532167 2970537883 447
370 iso_pu_bacteria 2970547951 2970552692 447
371 iso_pu_bacteria 2970593180 2970599564 447
372 iso_pu_bacteria 2970619444 2970625444 447
373 iso_pu_bacteria 2970627176 2970630903 447
374 iso_pu_bacteria 2977821940 2977827431 447
375 iso_pu_bacteria 2977828996 2977834893 447
376 iso_pu_bacteria 2977851361 2977853026 447
377 iso_pu_bacteria 2977872689 2977876262 447
378 iso_pu_bacteria 2977898635 2977904925 447
379 iso_pu_bacteria 2977915119 2977920840 447
380 iso_pu_bacteria 2977922695 2977924244 447
381 iso_pu_bacteria 2977935797 2977935862 447
382 iso_pu_bacteria 2977957713 2977959639 447
383 iso_pu_bacteria 2977986579 2977992015 447
384 iso_pu_bacteria 2979764755 2979768378 447
385 iso_pu_bacteria 2979772303 2979774005 447
386 iso_pu_bacteria 2979793036 2979794473 447
387 iso_pu_bacteria 2979808191 2979811656 447
388 iso_pu_bacteria 2987645492 2987649256 447
389 iso_pu_bacteria 2987666974 2987669224 447
390 iso_pu_bacteria 2987673487 2987677073 447
391 iso_pu_bacteria 2996348954 2996350188 447
392 iso_pu_bacteria 2996386984 2996391430 447
393 iso_pu_bacteria 3000135777 3000140640 447
394 iso_pu_bacteria 3004195979 3004200008 447
395 iso_pu_bacteria 3004211236 3004215979 447
396 iso_pu_bacteria 3004218560 3004223729 447
397 iso_pu_bacteria 3004232784 3004233405 447
398 iso_pu_bacteria 3004239961 3004245915 447
399 iso_pu_bacteria 3004248173 3004251062 447
400 iso_pu_bacteria 3004268573 3004274961 447
401 iso_pu_bacteria 3004275668 3004276886 447
402 iso_pu_bacteria 3004334049 3004334336 447
403 iso_pu_bacteria 649633066 649872988 447
404 iso_pu_bacteria 8004300914 8004303552 447
405 iso_pu_bacteria 8004312739 8004314877 447
406 iso_pu_bacteria 8004361976 8004367151 447
407 iso_pu_bacteria 8004374579 8004380412 447
408 iso_pu_bacteria 8004633249 8004633638 447
409 iso_pu_bacteria 8004695233 8004695792 447
410 iso_pu_bacteria 8004727605 8004734504 447
411 iso_pu_bacteria 8055617313 8055620792 447
412 3300005985 Ga0081539_10001091 Ga0081539_1000109117 448
413 3300031901 Ga0307406_10019983 Ga0307406_100199833 448
414 3300046460 Ga0495638_0049277 Ga0495638_0049277_53_1432 448
415 3300049571 Ga0501034_0180066 Ga0501034_0180066_624_2000 448
416 3300049572 Ga0501036_0135517 Ga0501036_0135517_79_1455 448
417 3300049573 Ga0501037_0109182 Ga0501037_0109182_567_1943 448
418 3300049575 Ga0501039_0085138 Ga0501039_0085138_1068_2444 448
419 3300049578 Ga0501042_0021169 Ga0501042_0021169_452_1828 448
420 3300049580 Ga0501046_0064007 Ga0501046_0064007_122_1495 448
421 3300049585 Ga0501069_0048437 Ga0501069_0048437_586_1962 448
422 3300049822 Ga0501035_0013336 Ga0501035_0013336_531_1904 448
423 iso_pu_bacteria 2513237090 2513612740 448
424 iso_pu_bacteria 2599185301 2599936733 448
425 iso_pu_bacteria 2693429783 2694632924 448
426 iso_pu_bacteria 2693429784 2694636040 448
427 iso_pu_bacteria 2857349434 2857351136 448
428 iso_pu_bacteria 2871444079 2871448908 448
429 iso_pu_bacteria 2871495908 2871501381 448
430 iso_pu_bacteria 2874102143 2874107269 448
431 iso_pu_bacteria 2876369609 2876375062 448
432 iso_pu_bacteria 2878760144 2878765361 448
433 iso_pu_bacteria 2878767105 2878773069 448
434 iso_pu_bacteria 2881147464 2881151350 448
435 iso_pu_bacteria 2889010040 2889010713 448
436 iso_pu_bacteria 2889016732 2889017590 448
437 iso_pu_bacteria 2903492973 2903504679 448
438 iso_pu_bacteria 2903540706 2903546192 448
439 iso_pu_bacteria 2906321335 2906327298 448
440 iso_pu_bacteria 2906328253 2906329992 448
441 iso_pu_bacteria 2922130491 2922136972 448
442 iso_pu_bacteria 2922158528 2922162851 448
443 iso_pu_bacteria 2922185730 2922191493 448
444 iso_pu_bacteria 2924726620 2924732683 448
445 iso_pu_bacteria 2937813078 2937815758 448
446 iso_pu_bacteria 2937822353 2937824480 448
447 iso_pu_bacteria 2937994558 2938000050 448
448 iso_pu_bacteria 2938014810 2938017951 448
449 iso_pu_bacteria 2958041894 2958056433 448
450 iso_pu_bacteria 2958115193 2958118475 448
451 iso_pu_bacteria 2958130278 2958130567 448
452 iso_pu_bacteria 2958165035 2958170514 448
453 iso_pu_bacteria 2958179912 2958184772 448
454 iso_pu_bacteria 2961077736 2961082939 448
455 iso_pu_bacteria 2961163497 2961168969 448
456 iso_pu_bacteria 2965018300 2965024256 448
457 iso_pu_bacteria 2965062239 2965066018 448
458 iso_pu_bacteria 2965119406 2965120699 448
459 iso_pu_bacteria 2968091066 2968096380 448
460 iso_pu_bacteria 2968097103 2968098881 448
461 iso_pu_bacteria 2968117919 2968120648 448
462 iso_pu_bacteria 2968128360 2968129200 448
463 iso_pu_bacteria 2968171901 2968177363 448
464 iso_pu_bacteria 2970554993 2970560209 448
465 iso_pu_bacteria 2977843712 2977845993 448
466 iso_pu_bacteria 2977858184 2977864765 448
467 iso_pu_bacteria 2977864932 2977867070 448
468 iso_pu_bacteria 2977942078 2977942765 448
469 iso_pu_bacteria 2979710463 2979717528 448
470 iso_pu_bacteria 2979742915 2979745718 448
471 iso_pu_bacteria 2979779861 2979781685 448
472 iso_pu_bacteria 2987636660 2987638320 448
473 iso_pu_bacteria 2987652177 2987657098 448
474 iso_pu_bacteria 2987659509 2987665000 448
475 iso_pu_bacteria 2996341866 2996347313 448
476 iso_pu_bacteria 3004188549 3004194057 448
477 iso_pu_bacteria 3004203850 3004205436 448
478 iso_pu_bacteria 8004387939 8004393622 448
479 iso_pu_bacteria 8004445564 8004446536 448
480 iso_pu_bacteria 8004640170 8004640801 448
481 iso_pu_bacteria 8004703790 8004709377 448
482 iso_pu_bacteria 8004714634 8004720390 448
483 3300049568 Ga0501031_0013250 Ga0501031_0013250_2371_3747 449
484 3300049570 Ga0501033_0002727 Ga0501033_0002727_2888_4264 449
485 3300049573 Ga0501037_0000181 Ga0501037_0000181_41838_43214 449
486 3300049579 Ga0501043_0000008 Ga0501043_0000008_69555_70931 449
487 3300049579 Ga0501043_0056744 Ga0501043_0056744_613_1989 449
488 3300049581 Ga0501047_0003462 Ga0501047_0003462_11788_13164 449
489 3300049585 Ga0501069_0000028 Ga0501069_0000028_96114_97490 449
490 3300049585 Ga0501069_0031682 Ga0501069_0031682_639_2015 449
491 3300049586 Ga0501070_0000264 Ga0501070_0000264_26551_27927 449
492 3300049586 Ga0501070_0000476 Ga0501070_0000476_15290_16666 449
493 3300049589 Ga0501073_0009410 Ga0501073_0009410_2268_3644 449
494 3300049590 Ga0501074_0000016 Ga0501074_0000016_43795_45171 449
495 3300049742 Ga0501080_0000065 Ga0501080_0000065_2618_3994 449
496 3300049742 Ga0501080_0003495 Ga0501080_0003495_677_2053 449
497 3300049822 Ga0501035_0000011 Ga0501035_0000011_33529_34905 449
498 3300049822 Ga0501035_0006304 Ga0501035_0006304_9527_10903 449
499 3300049823 Ga0501044_0000011 Ga0501044_0000011_19785_21161 449
500 3300049823 Ga0501044_0003679 Ga0501044_0003679_7381_8757 449
501 3300060353 Ga0501082_0040233 Ga0501082_0040233_1531_2907 449
502 iso_pu_bacteria 2643221623 2644129367 449
503 3300049571 Ga0501034_0028325 Ga0501034_0028325_1118_2506 450
504 3300049573 Ga0501037_0024538 Ga0501037_0024538_2178_3575 450
505 3300049581 Ga0501047_0004753 Ga0501047_0004753_2937_4334 450
506 3300049585 Ga0501069_0001649 Ga0501069_0001649_6770_8167 450
507 3300049586 Ga0501070_0037219 Ga0501070_0037219_1627_3024 450
508 3300049822 Ga0501035_0014017 Ga0501035_0014017_4386_5783 450
509 3300049823 Ga0501044_0007800 Ga0501044_0007800_1622_3019 450
510 3300053139 Ga0500568_0000093 Ga0500568_0000093_63552_64928 450
511 iso_pu_bacteria 2513237305 2514420897 450
512 3300003762 Ga0055542_1001100 Ga0055542_10011006 451
513 3300003763 Ga0055529_1002096 Ga0055529_10020963 451
514 3300005328 Ga0070676_10032287 Ga0070676_100322872 451
515 3300005356 Ga0070674_100018865 Ga0070674_1000188654 451
516 3300005548 Ga0070665_100036237 Ga0070665_1000362375 451
517 3300006038 Ga0075365_10021788 Ga0075365_100217883 451
518 3300006038 Ga0075365_10029474 Ga0075365_100294743 451
519 3300006042 Ga0075368_10068261 Ga0075368_100682611 451
520 3300006177 Ga0075362_10014991 Ga0075362_100149912 451
521 3300013105 Ga0157369_10241576 Ga0157369_102415762 451
522 3300025254 Ga0209148_1000128 Ga0209148_10001287 451
523 3300025272 Ga0209455_1000127 Ga0209455_1000127121 451
524 3300025919 Ga0207657_10081429 Ga0207657_100814292 451
525 3300026116 Ga0207674_10296668 Ga0207674_102966681 451
526 3300046460 Ga0495638_0068138 Ga0495638_0068138_415_1899 451
527 3300046515 Ga0495620_0021612 Ga0495620_0021612_60_1448 451
528 3300048915 Ga0496112_0018344 Ga0496112_0018344_3192_4571 451
529 3300048918 Ga0496115_0109758 Ga0496115_0109758_225_1610 451
530 3300049568 Ga0501031_0000036 Ga0501031_0000036_47114_48493 451
531 3300049569 Ga0501032_0000100 Ga0501032_0000100_25312_26691 451
532 3300049570 Ga0501033_0000088 Ga0501033_0000088_46815_48194 451
533 3300049571 Ga0501034_0000397 Ga0501034_0000397_25318_26697 451
534 3300049572 Ga0501036_0000056 Ga0501036_0000056_25318_26697 451
535 3300049573 Ga0501037_0000119 Ga0501037_0000119_25317_26696 451
536 3300049574 Ga0501038_0000098 Ga0501038_0000098_25291_26670 451
537 3300049575 Ga0501039_0000013 Ga0501039_0000013_46815_48194 451
538 3300049576 Ga0501040_0004362 Ga0501040_0004362_1784_3163 451
539 3300049579 Ga0501043_0001191 Ga0501043_0001191_9119_10498 451
540 3300049580 Ga0501046_0129795 Ga0501046_0129795_53_1432 451
541 3300049581 Ga0501047_0053027 Ga0501047_0053027_995_2374 451
542 3300049586 Ga0501070_0061940 Ga0501070_0061940_885_2312 451
543 3300049822 Ga0501035_0000053 Ga0501035_0000053_94667_96046 451
544 3300049823 Ga0501044_0000214 Ga0501044_0000214_46815_48194 451
545 3300049824 Ga0501045_0053563 Ga0501045_0053563_40_1419 451
546 3300050492 nmdc:mga0yw44_2190_c1 nmdc:mga0yw44_2190_c1_403_1782 451
547 3300050492 nmdc:mga0yw44_24336_c1 nmdc:mga0yw44_24336_c1_1614_2993 451
548 3300050492 nmdc:mga0yw44_45557_c1 nmdc:mga0yw44_45557_c1_879_2258 451
549 3300050494 nmdc:mga06z11_13235_c1 nmdc:mga06z11_13235_c1_1398_2777 451
550 3300053134 Ga0500658_0026008 Ga0500658_0026008_807_2186 451
551 3300053155 Ga0500620_000359 Ga0500620_000359_1218_2678 451
552 3300002741 JGI25157J39369_1000162 JGI25157J39369_100016215 452
553 3300025250 Ga0209026_1000025 Ga0209026_1000025151 452
554 3300025256 Ga0209759_1000121 Ga0209759_100012181 452
555 3300037471 Ga0395905_0087931 Ga0395905_0087931_25_1407 452
556 3300048922 Ga0496119_0081595 Ga0496119_0081595_36_1418 452
557 3300048923 Ga0496120_0001104 Ga0496120_0001104_28496_29878 452
558 3300049823 Ga0501044_0009668 Ga0501044_0009668_419_1897 452
559 iso_pu_bacteria 2856314179 2856319514 452
560 iso_pu_bacteria 2878035449 2878040749 452
561 iso_pu_bacteria 2906414383 2906420234 452

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

185

477

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vwq-assembly1.cif.gz_A-2 6-aminohexanoate-dimer hydrolase s112a/g181d/r187a/h266n/d370y mutant complexd with 6-aminohexanoate 0.8663 164 452
3a65-assembly1.cif.gz_A crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/h266n mutant with substrate 0.8657 164 452
8dc1-assembly1.cif.gz_A structural and biochemical characterization of l. interrogans lsa45 reveals a penicillin-binding protein with esterase activity 0.8572 146 450
3a66-assembly1.cif.gz_A-2 crystal structure of 6-aminohexanoate-dimer hydrolase s112a/g181d/h266n/d370y mutant with substrate 0.8429 164 452
3vwn-assembly1.cif.gz_X-2 crystal structure of 6-aminohexanoate-dimer hydrolase g181d/r187g/h266n/d370y mutant 0.8387 147 452
ID Description Score Start End Superfamily
4gb7A00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8071 164 451 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7961 159 450 3.40.710.10
5tgfD00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7809 161 451 3.40.710.10
af_P71981_7_386_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7631 121 451 3.40.710.10
3i7jB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.7616 162 451 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A526YHA2-F1-model_v4 Serine hydrolase 0.9946 158 382 GO:0016787
AF-A0A5Q8C9L0-F1-model_v4 Class C beta-lactamase-related serine hydrolase 0.9921 1 386 GO:0016020
GO:0016787
AF-A0A529VGZ6-F1-model_v4 deleted 0.9904 1 328
AF-A0A526YHA2-F1-model_v4 Serine hydrolase 0.9902 158 382 GO:0016787
AF-A0A5Q8C9L0-F1-model_v4 Class C beta-lactamase-related serine hydrolase 0.9895 1 386 GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
94.32 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map