F463851
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 331 | 1122 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0004026|Ga0495592_0004026_2495_3562 |
| Length | 355 |
| Sequence | MPKPTGLEADRTQWRRDTIRRSEGMKKFVNDPKDYVAEMLEGLALANPGTLKYVPEYNLIMRADAPQENKVSIVQGSGSGHEPAHVMSVGKGMLDAACPGDVFAAPPTDFVYETVKRVASPKGVLLLVNNYTGDRMAFEMAEELSQAEGVTARTLFIDDDVAVQDSTYTVGRRGVAGNFFVMKAVGAAAERGADLDEVYRIGEKVNSVARTMGMALTACTPPAKGSPLFDLPDDSVEMGVGIHGEPGRKREKLQSADAMVGELVSAVVDDLPYTSGDRVALMVNGLGGTPIGELYLVYGRAHKQLAERGIEIRRSYVGEYCTSLDMAGASVTLVRLDDEISELLADPAEIPIRVF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 95 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 155 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 162 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 163 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 186 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 187 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 190 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 191 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 192 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 193 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 194 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 261 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 299 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 300 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 301 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 302 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 303 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 309 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 310 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 311 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 312 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 313 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 314 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 315 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 316 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 317 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 318 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 319 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 320 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 321 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 322 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 323 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 324 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 325 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 326 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 327 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 328 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 329 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 330 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 331 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.27 |
| Metatranscriptomes | 4.63 |
| Isolates | 4.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.6 |
| Nodule | 0 |
| Rhizoplane | 8.38 |
| Rhizosphere | 85.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495592_0004026 | 3300046454 | Bacteria | 10673 |
| 2 | Ga0065714_10080967 | 3300005288 | Bacteria | 2403 |
| 3 | Ga0070658_10102568 | 3300005327 | Bacteria | 2366 |
| 4 | Ga0070658_10296537 | 3300005327 | Bacteria | 1378 |
| 5 | Ga0070683_100017307 | 3300005329 | Bacteria | 6369 |
| 6 | Ga0070683_100112825 | 3300005329 | Bacteria | 2565 |
| 7 | Ga0070690_100235314 | 3300005330 | Bacteria | 1290 |
| 8 | Ga0068869_100058366 | 3300005334 | Bacteria | 2821 |
| 9 | Ga0068869_100089919 | 3300005334 | Bacteria | 2307 |
| 10 | Ga0070682_100014644 | 3300005337 | Bacteria | 4534 |
| 11 | Ga0070682_100032623 | 3300005337 | Bacteria | 3160 |
| 12 | Ga0070660_100084106 | 3300005339 | Bacteria | 2501 |
| 13 | Ga0070660_100376862 | 3300005339 | Bacteria | 1171 |
| 14 | Ga0070689_100038801 | 3300005340 | Bacteria | 3644 |
| 15 | Ga0070691_10000828 | 3300005341 | Bacteria | 12441 |
| 16 | Ga0070687_100131896 | 3300005343 | Bacteria | 1443 |
| 17 | Ga0070668_100023598 | 3300005347 | Bacteria | 4654 |
| 18 | Ga0070668_100182528 | 3300005347 | Bacteria | 1715 |
| 19 | Ga0070675_100005384 | 3300005354 | Bacteria | 9783 |
| 20 | Ga0070675_100043381 | 3300005354 | Bacteria | 3675 |
| 21 | Ga0070671_100035464 | 3300005355 | Bacteria | 4132 |
| 22 | Ga0070671_100146179 | 3300005355 | Bacteria | 1995 |
| 23 | Ga0070673_100038792 | 3300005364 | Bacteria | 3640 |
| 24 | Ga0070673_100106244 | 3300005364 | Bacteria | 2321 |
| 25 | Ga0070659_100136760 | 3300005366 | Bacteria | 1993 |
| 26 | Ga0070667_100302682 | 3300005367 | Bacteria | 1440 |
| 27 | Ga0070667_100390872 | 3300005367 | Bacteria | 1265 |
| 28 | Ga0070709_10042311 | 3300005434 | Bacteria | 2812 |
| 29 | Ga0070714_100015651 | 3300005435 | Bacteria | 6105 |
| 30 | Ga0070714_100036504 | 3300005435 | Bacteria | 4122 |
| 31 | Ga0070714_100325864 | 3300005435 | Bacteria | 1437 |
| 32 | Ga0070713_100010449 | 3300005436 | Bacteria | 6704 |
| 33 | Ga0070701_10024707 | 3300005438 | Bacteria | 2909 |
| 34 | Ga0070711_100187622 | 3300005439 | Bacteria | 1587 |
| 35 | Ga0070705_100054337 | 3300005440 | Bacteria | 2349 |
| 36 | Ga0070705_100105449 | 3300005440 | Bacteria | 1790 |
| 37 | Ga0070700_100122568 | 3300005441 | Bacteria | 1744 |
| 38 | Ga0070700_100245097 | 3300005441 | Bacteria | 1282 |
| 39 | Ga0070663_100007546 | 3300005455 | Bacteria | 6627 |
| 40 | Ga0070663_100057414 | 3300005455 | Bacteria | 2792 |
| 41 | Ga0070663_100186574 | 3300005455 | Bacteria | 1612 |
| 42 | Ga0070663_100193331 | 3300005455 | Bacteria | 1584 |
| 43 | Ga0070678_100040375 | 3300005456 | Bacteria | 3302 |
| 44 | Ga0070678_100100708 | 3300005456 | Bacteria | 2238 |
| 45 | Ga0070678_100135495 | 3300005456 | Bacteria | 1963 |
| 46 | Ga0070678_100445962 | 3300005456 | Bacteria | 1133 |
| 47 | Ga0070662_100046219 | 3300005457 | Bacteria | 3128 |
| 48 | Ga0070662_100122494 | 3300005457 | Bacteria | 1995 |
| 49 | Ga0070681_10004201 | 3300005458 | Bacteria | 13643 |
| 50 | Ga0070681_10018476 | 3300005458 | Bacteria | 6968 |
| 51 | Ga0070681_10342075 | 3300005458 | Bacteria | 1406 |
| 52 | Ga0070685_10026770 | 3300005466 | Bacteria | 3180 |
| 53 | Ga0070685_10039015 | 3300005466 | Bacteria | 2696 |
| 54 | Ga0070679_100111997 | 3300005530 | Bacteria | 2715 |
| 55 | Ga0070679_100315792 | 3300005530 | Bacteria | 1512 |
| 56 | Ga0070684_100041783 | 3300005535 | Bacteria | 3955 |
| 57 | Ga0070684_100081265 | 3300005535 | Bacteria | 2867 |
| 58 | Ga0070684_100104381 | 3300005535 | Bacteria | 2535 |
| 59 | Ga0068853_100012990 | 3300005539 | Bacteria | 6789 |
| 60 | Ga0070686_100357063 | 3300005544 | Bacteria | 1100 |
| 61 | Ga0070665_100051114 | 3300005548 | Bacteria | 4146 |
| 62 | Ga0070665_100075636 | 3300005548 | Bacteria | 3374 |
| 63 | Ga0070665_100105433 | 3300005548 | Bacteria | 2821 |
| 64 | Ga0070665_100180965 | 3300005548 | Bacteria | 2109 |
| 65 | Ga0070704_100140042 | 3300005549 | Bacteria | 1887 |
| 66 | Ga0068855_100219519 | 3300005563 | Bacteria | 2132 |
| 67 | Ga0070664_100023388 | 3300005564 | Bacteria | 5103 |
| 68 | Ga0070664_100420087 | 3300005564 | Bacteria | 1225 |
| 69 | Ga0068857_100102440 | 3300005577 | Bacteria | 2569 |
| 70 | Ga0068854_100073519 | 3300005578 | Bacteria | 2505 |
| 71 | Ga0068856_100066637 | 3300005614 | Bacteria | 3557 |
| 72 | Ga0070702_100115888 | 3300005615 | Bacteria | 1669 |
| 73 | Ga0068852_100121089 | 3300005616 | Bacteria | 2396 |
| 74 | Ga0068852_100183387 | 3300005616 | Bacteria | 1970 |
| 75 | Ga0068859_100075295 | 3300005617 | Bacteria | 3416 |
| 76 | Ga0068859_100428828 | 3300005617 | Bacteria | 1418 |
| 77 | Ga0068864_100014736 | 3300005618 | Bacteria | 6494 |
| 78 | Ga0068864_100172930 | 3300005618 | Bacteria | 1970 |
| 79 | Ga0068861_100096650 | 3300005719 | Bacteria | 2341 |
| 80 | Ga0068870_10001853 | 3300005840 | Bacteria | 8699 |
| 81 | Ga0068863_100064802 | 3300005841 | Bacteria | 3456 |
| 82 | Ga0068862_100281433 | 3300005844 | Bacteria | 1524 |
| 83 | Ga0081455_10014945 | 3300005937 | Bacteria | 7562 |
| 84 | Ga0081455_10035706 | 3300005937 | Bacteria | 4438 |
| 85 | Ga0081540_1002567 | 3300005983 | Bacteria | 14736 |
| 86 | Ga0081540_1012342 | 3300005983 | Bacteria | 5636 |
| 87 | Ga0081540_1030483 | 3300005983 | Bacteria | 2986 |
| 88 | Ga0070717_10028793 | 3300006028 | Bacteria | 4450 |
| 89 | Ga0075432_10012930 | 3300006058 | Bacteria | 2836 |
| 90 | Ga0075432_10020206 | 3300006058 | Bacteria | 2277 |
| 91 | Ga0070716_100292748 | 3300006173 | Bacteria | 1129 |
| 92 | Ga0070712_100009188 | 3300006175 | Bacteria | 6225 |
| 93 | Ga0070712_100225515 | 3300006175 | Bacteria | 1485 |
| 94 | Ga0068871_100018601 | 3300006358 | Bacteria | 5286 |
| 95 | Ga0075428_100073841 | 3300006844 | Bacteria | 3725 |
| 96 | Ga0075430_100006226 | 3300006846 | Bacteria | 10066 |
| 97 | Ga0075430_100247019 | 3300006846 | Bacteria | 1479 |
| 98 | Ga0075431_100026085 | 3300006847 | Bacteria | 5992 |
| 99 | Ga0075431_100036609 | 3300006847 | Bacteria | 5054 |
| 100 | Ga0075431_100421680 | 3300006847 | Bacteria | 1334 |
| 101 | Ga0075433_10001181 | 3300006852 | Bacteria | 18990 |
| 102 | Ga0075433_10032100 | 3300006852 | Bacteria | 4495 |
| 103 | Ga0075434_100001152 | 3300006871 | Bacteria | 21846 |
| 104 | Ga0075434_100011561 | 3300006871 | Bacteria | 8332 |
| 105 | Ga0075434_100019484 | 3300006871 | Bacteria | 6567 |
| 106 | Ga0075434_100073584 | 3300006871 | Bacteria | 3409 |
| 107 | Ga0075436_100008639 | 3300006914 | Bacteria | 6963 |
| 108 | Ga0075436_100051082 | 3300006914 | Bacteria | 2853 |
| 109 | Ga0075436_100110945 | 3300006914 | Bacteria | 1914 |
| 110 | Ga0097620_100075295 | 3300006931 | Bacteria | 3416 |
| 111 | Ga0097620_100428842 | 3300006931 | Bacteria | 1418 |
| 112 | Ga0075435_100000430 | 3300007076 | Bacteria | 25677 |
| 113 | Ga0075435_100011622 | 3300007076 | Bacteria | 6489 |
| 114 | Ga0105244_10084698 | 3300009036 | Bacteria | 1565 |
| 115 | Ga0111539_10009937 | 3300009094 | Bacteria | 12001 |
| 116 | Ga0111539_10041004 | 3300009094 | Bacteria | 5570 |
| 117 | Ga0111539_10295721 | 3300009094 | Bacteria | 1884 |
| 118 | Ga0105245_10061258 | 3300009098 | Bacteria | 3392 |
| 119 | Ga0105245_10442142 | 3300009098 | Bacteria | 1307 |
| 120 | Ga0105247_10064566 | 3300009101 | Bacteria | 2275 |
| 121 | Ga0114129_10133259 | 3300009147 | Bacteria | 3411 |
| 122 | Ga0114129_10535686 | 3300009147 | Bacteria | 1525 |
| 123 | Ga0105241_10128982 | 3300009174 | Bacteria | 2045 |
| 124 | Ga0105242_10075134 | 3300009176 | Bacteria | 2813 |
| 125 | Ga0105248_10031371 | 3300009177 | Bacteria | 5941 |
| 126 | Ga0105248_10123097 | 3300009177 | Bacteria | 2926 |
| 127 | Ga0105237_10566480 | 3300009545 | Bacteria | 1143 |
| 128 | Ga0105249_10009782 | 3300009553 | Bacteria | 8399 |
| 129 | Ga0105239_10120161 | 3300010375 | Bacteria | 2917 |
| 130 | Ga0105246_10004017 | 3300011119 | Bacteria | 8933 |
| 131 | Ga0105246_10044393 | 3300011119 | Bacteria | 3021 |
| 132 | Ga0105246_10189834 | 3300011119 | Bacteria | 1589 |
| 133 | Ga0157373_10037512 | 3300013100 | Bacteria | 3474 |
| 134 | Ga0157371_10045836 | 3300013102 | Bacteria | 3111 |
| 135 | Ga0157370_10204883 | 3300013104 | Bacteria | 1829 |
| 136 | Ga0157369_10000926 | 3300013105 | Bacteria | 37311 |
| 137 | Ga0157369_10017095 | 3300013105 | Bacteria | 8150 |
| 138 | Ga0157374_10028671 | 3300013296 | Bacteria | 5030 |
| 139 | Ga0157374_10037231 | 3300013296 | Bacteria | 4463 |
| 140 | Ga0163162_10232129 | 3300013306 | Bacteria | 1975 |
| 141 | Ga0163162_10359371 | 3300013306 | Bacteria | 1589 |
| 142 | Ga0163162_10590108 | 3300013306 | Bacteria | 1238 |
| 143 | Ga0157372_10029942 | 3300013307 | Bacteria | 5949 |
| 144 | Ga0157380_10146898 | 3300014326 | Bacteria | 2033 |
| 145 | Ga0157379_10019892 | 3300014968 | Bacteria | 5931 |
| 146 | Ga0157379_10279600 | 3300014968 | Bacteria | 1519 |
| 147 | Ga0157376_10180769 | 3300014969 | Bacteria | 1928 |
| 148 | Ga0157376_10309978 | 3300014969 | Bacteria | 1497 |
| 149 | Ga0163161_10232891 | 3300017792 | Bacteria | 1430 |
| 150 | Ga0206356_11122267 | 3300020070 | Bacteria | 2717 |
| 151 | Ga0206356_11320489 | 3300020070 | Bacteria | 3492 |
| 152 | Ga0206356_11498757 | 3300020070 | Bacteria | 3958 |
| 153 | Ga0206349_1110273 | 3300020075 | Bacteria | 3979 |
| 154 | Ga0206349_1530387 | 3300020075 | Bacteria | 1441 |
| 155 | Ga0206351_10309671 | 3300020077 | Bacteria | 1440 |
| 156 | Ga0206351_10908197 | 3300020077 | Bacteria | 1801 |
| 157 | Ga0206352_10083294 | 3300020078 | Bacteria | 3743 |
| 158 | Ga0206350_10030584 | 3300020080 | Bacteria | 2230 |
| 159 | Ga0206350_10571440 | 3300020080 | Bacteria | 1740 |
| 160 | Ga0206350_10886141 | 3300020080 | Bacteria | 1606 |
| 161 | Ga0206350_11275337 | 3300020080 | Bacteria | 2112 |
| 162 | Ga0206354_10524397 | 3300020081 | Bacteria | 3702 |
| 163 | Ga0206354_10625737 | 3300020081 | Bacteria | 1768 |
| 164 | Ga0206353_11315474 | 3300020082 | Bacteria | 1303 |
| 165 | Ga0213876_10060842 | 3300021384 | Bacteria | 1992 |
| 166 | Ga0213875_10000280 | 3300021388 | Bacteria | 50096 |
| 167 | Ga0224712_10001097 | 3300022467 | Bacteria | 5982 |
| 168 | Ga0224712_10003165 | 3300022467 | Bacteria | 4219 |
| 169 | Ga0224712_10003266 | 3300022467 | Bacteria | 4179 |
| 170 | Ga0224712_10010573 | 3300022467 | Bacteria | 2828 |
| 171 | Ga0224712_10022190 | 3300022467 | Bacteria | 2184 |
| 172 | Ga0224712_10056144 | 3300022467 | Bacteria | 1551 |
| 173 | Ga0224572_1008914 | 3300024225 | Bacteria | 1863 |
| 174 | Ga0207656_10027823 | 3300025321 | Bacteria | 2315 |
| 175 | Ga0207692_10025216 | 3300025898 | Bacteria | 2774 |
| 176 | Ga0207710_10035200 | 3300025900 | Bacteria | 2203 |
| 177 | Ga0207710_10054682 | 3300025900 | Bacteria | 1798 |
| 178 | Ga0207688_10002125 | 3300025901 | Bacteria | 10644 |
| 179 | Ga0207688_10009265 | 3300025901 | Bacteria | 5365 |
| 180 | Ga0207647_10123300 | 3300025904 | Bacteria | 1527 |
| 181 | Ga0207699_10015242 | 3300025906 | Bacteria | 3988 |
| 182 | Ga0207643_10000272 | 3300025908 | Bacteria | 36101 |
| 183 | Ga0207643_10079334 | 3300025908 | Bacteria | 1900 |
| 184 | Ga0207705_10033800 | 3300025909 | Bacteria | 3654 |
| 185 | Ga0207705_10117286 | 3300025909 | Bacteria | 1972 |
| 186 | Ga0207654_10031383 | 3300025911 | Bacteria | 2925 |
| 187 | Ga0207707_10005491 | 3300025912 | Bacteria | 11084 |
| 188 | Ga0207707_10318210 | 3300025912 | Bacteria | 1344 |
| 189 | Ga0207695_10129593 | 3300025913 | Bacteria | 2481 |
| 190 | Ga0207693_10012817 | 3300025915 | Bacteria | 6763 |
| 191 | Ga0207693_10196775 | 3300025915 | Bacteria | 1585 |
| 192 | Ga0207663_10062260 | 3300025916 | Bacteria | 2371 |
| 193 | Ga0207663_10329021 | 3300025916 | Bacteria | 1150 |
| 194 | Ga0207660_10014624 | 3300025917 | Bacteria | 5167 |
| 195 | Ga0207662_10024054 | 3300025918 | Bacteria | 3505 |
| 196 | Ga0207657_10018442 | 3300025919 | Bacteria | 6661 |
| 197 | Ga0207649_10019310 | 3300025920 | Bacteria | 3893 |
| 198 | Ga0207652_10017405 | 3300025921 | Bacteria | 5882 |
| 199 | Ga0207650_10016646 | 3300025925 | Bacteria | 5139 |
| 200 | Ga0207659_10002628 | 3300025926 | Bacteria | 10696 |
| 201 | Ga0207659_10120901 | 3300025926 | Bacteria | 2007 |
| 202 | Ga0207687_10017977 | 3300025927 | Bacteria | 4665 |
| 203 | Ga0207687_10212134 | 3300025927 | Bacteria | 1520 |
| 204 | Ga0207687_10237740 | 3300025927 | Bacteria | 1442 |
| 205 | Ga0207700_10080947 | 3300025928 | Bacteria | 2534 |
| 206 | Ga0207664_10128948 | 3300025929 | Bacteria | 2127 |
| 207 | Ga0207644_10030697 | 3300025931 | Bacteria | 3739 |
| 208 | Ga0207644_10123945 | 3300025931 | Bacteria | 1970 |
| 209 | Ga0207690_10113025 | 3300025932 | Bacteria | 1959 |
| 210 | Ga0207706_10016978 | 3300025933 | Bacteria | 6567 |
| 211 | Ga0207706_10226172 | 3300025933 | Bacteria | 1637 |
| 212 | Ga0207670_10058275 | 3300025936 | Bacteria | 2623 |
| 213 | Ga0207670_10211797 | 3300025936 | Bacteria | 1478 |
| 214 | Ga0207691_10097354 | 3300025940 | Bacteria | 2630 |
| 215 | Ga0207691_10135619 | 3300025940 | Bacteria | 2171 |
| 216 | Ga0207711_10169118 | 3300025941 | Bacteria | 1983 |
| 217 | Ga0207711_10229073 | 3300025941 | Bacteria | 1701 |
| 218 | Ga0207689_10005539 | 3300025942 | Bacteria | 11275 |
| 219 | Ga0207689_10155806 | 3300025942 | Bacteria | 1883 |
| 220 | Ga0207661_10012376 | 3300025944 | Bacteria | 6197 |
| 221 | Ga0207661_10020785 | 3300025944 | Bacteria | 4912 |
| 222 | Ga0207661_10047429 | 3300025944 | Bacteria | 3410 |
| 223 | Ga0207661_10087117 | 3300025944 | Bacteria | 2593 |
| 224 | Ga0207661_10096637 | 3300025944 | Bacteria | 2472 |
| 225 | Ga0207679_10008711 | 3300025945 | Bacteria | 6470 |
| 226 | Ga0207679_10114622 | 3300025945 | Bacteria | 2134 |
| 227 | Ga0207667_10083233 | 3300025949 | Bacteria | 3313 |
| 228 | Ga0207667_10185970 | 3300025949 | Bacteria | 2133 |
| 229 | Ga0207651_10010784 | 3300025960 | Bacteria | 5081 |
| 230 | Ga0207651_10110801 | 3300025960 | Bacteria | 2060 |
| 231 | Ga0207712_10064075 | 3300025961 | Bacteria | 2619 |
| 232 | Ga0207668_10021667 | 3300025972 | Bacteria | 4102 |
| 233 | Ga0207640_10415158 | 3300025981 | Bacteria | 1100 |
| 234 | Ga0207658_10082049 | 3300025986 | Bacteria | 2475 |
| 235 | Ga0207639_10011282 | 3300026041 | Bacteria | 6200 |
| 236 | Ga0207639_10019319 | 3300026041 | Bacteria | 4859 |
| 237 | Ga0207678_10000085 | 3300026067 | Bacteria | 76854 |
| 238 | Ga0207678_10246149 | 3300026067 | Bacteria | 1531 |
| 239 | Ga0207708_10013218 | 3300026075 | Bacteria | 6163 |
| 240 | Ga0207708_10286025 | 3300026075 | Bacteria | 1337 |
| 241 | Ga0207702_10005959 | 3300026078 | Bacteria | 10588 |
| 242 | Ga0207702_10014020 | 3300026078 | Bacteria | 6657 |
| 243 | Ga0207702_10112638 | 3300026078 | Bacteria | 2421 |
| 244 | Ga0207641_10031739 | 3300026088 | Bacteria | 4382 |
| 245 | Ga0207641_10043882 | 3300026088 | Bacteria | 3758 |
| 246 | Ga0207648_10135111 | 3300026089 | Bacteria | 2172 |
| 247 | Ga0207648_10309663 | 3300026089 | Bacteria | 1417 |
| 248 | Ga0207676_10009110 | 3300026095 | Bacteria | 7069 |
| 249 | Ga0207674_10027261 | 3300026116 | Bacteria | 6048 |
| 250 | Ga0207674_10080804 | 3300026116 | Bacteria | 3254 |
| 251 | Ga0207674_10269267 | 3300026116 | Bacteria | 1651 |
| 252 | Ga0207675_100134418 | 3300026118 | Bacteria | 2346 |
| 253 | Ga0207675_100154993 | 3300026118 | Bacteria | 2183 |
| 254 | Ga0207675_100202620 | 3300026118 | Bacteria | 1906 |
| 255 | Ga0207683_10000055 | 3300026121 | Bacteria | 84901 |
| 256 | Ga0207683_10091885 | 3300026121 | Bacteria | 2704 |
| 257 | Ga0207683_10139305 | 3300026121 | Bacteria | 2185 |
| 258 | Ga0207698_10010967 | 3300026142 | Bacteria | 5856 |
| 259 | Ga0207698_10011320 | 3300026142 | Bacteria | 5777 |
| 260 | Ga0207698_10164092 | 3300026142 | Bacteria | 1947 |
| 261 | Ga0207428_10015563 | 3300027907 | Bacteria | 6575 |
| 262 | Ga0207428_10019475 | 3300027907 | Bacteria | 5786 |
| 263 | Ga0207428_10040108 | 3300027907 | Bacteria | 3800 |
| 264 | Ga0207428_10161720 | 3300027907 | Bacteria | 1700 |
| 265 | Ga0268266_10087486 | 3300028379 | Bacteria | 2726 |
| 266 | Ga0268265_10067404 | 3300028380 | Bacteria | 2771 |
| 267 | Ga0268265_10204054 | 3300028380 | Bacteria | 1717 |
| 268 | Ga0268264_10198287 | 3300028381 | Bacteria | 1835 |
| 269 | Ga0268264_10300593 | 3300028381 | Bacteria | 1511 |
| 270 | Ga0307515_10000591 | 3300028794 | Bacteria | 84816 |
| 271 | Ga0307515_10221864 | 3300028794 | Bacteria | 1706 |
| 272 | Ga0265338_10000363 | 3300028800 | Bacteria | 81934 |
| 273 | Ga0265338_10013249 | 3300028800 | Bacteria | 9329 |
| 274 | Ga0265316_10024684 | 3300031344 | Bacteria | 5029 |
| 275 | Ga0265316_10105824 | 3300031344 | Bacteria | 2134 |
| 276 | Ga0307513_10002345 | 3300031456 | Bacteria | 26347 |
| 277 | Ga0316575_10020220 | 3300031665 | Bacteria | 2553 |
| 278 | Ga0316578_10056703 | 3300031728 | Bacteria | 2301 |
| 279 | Ga0307516_10000462 | 3300031730 | Bacteria | 53659 |
| 280 | Ga0307413_10066560 | 3300031824 | Bacteria | 2249 |
| 281 | Ga0307410_10085347 | 3300031852 | Bacteria | 2228 |
| 282 | Ga0307410_10089421 | 3300031852 | Bacteria | 2182 |
| 283 | Ga0307414_10194207 | 3300032004 | Bacteria | 1645 |
| 284 | Ga0307411_10044661 | 3300032005 | Bacteria | 2845 |
| 285 | Ga0316583_10005170 | 3300032133 | Bacteria | 4679 |
| 286 | Ga0316593_10051607 | 3300032168 | Bacteria | 1391 |
| 287 | Ga0316586_1000406 | 3300033527 | Bacteria | 4117 |
| 288 | Ga0316587_1004221 | 3300033529 | Bacteria | 2076 |
| 289 | Ga0316596_1037748 | 3300033541 | Bacteria | 1264 |
| 290 | Ga0316214_1001689 | 3300033545 | Bacteria | 2624 |
| 291 | Ga0373923_0002226 | 3300035111 | Bacteria | 5905 |
| 292 | Ga0373923_0073219 | 3300035111 | Bacteria | 1475 |
| 293 | Ga0373953_0006530 | 3300035117 | Bacteria | 3849 |
| 294 | Ga0373956_0014570 | 3300035119 | Bacteria | 3287 |
| 295 | Ga0373957_0033627 | 3300035120 | Bacteria | 1894 |
| 296 | Ga0316574_0019936 | 3300035398 | Bacteria | 3964 |
| 297 | Ga0373935_0014488 | 3300035692 | Bacteria | 4758 |
| 298 | Ga0373933_0004469 | 3300035724 | Bacteria | 7669 |
| 299 | Ga0316582_0029221 | 3300036647 | Bacteria | 3347 |
| 300 | Ga0316582_0217999 | 3300036647 | Bacteria | 1304 |
| 301 | Ga0316584_0032971 | 3300036712 | Bacteria | 3834 |
| 302 | Ga0395900_0120889 | 3300037418 | Bacteria | 2687 |
| 303 | Ga0395898_0002776 | 3300037466 | Bacteria | 20131 |
| 304 | Ga0395898_0130948 | 3300037466 | Bacteria | 2403 |
| 305 | Ga0436364_0919152 | 3300037853 | Bacteria | 2486 |
| 306 | Ga0436364_1341190 | 3300037853 | Bacteria | 236154 |
| 307 | Ga0395901_0029862 | 3300038443 | Bacteria | 5614 |
| 308 | Ga0436365_0334427 | 3300039437 | Bacteria | 5197 |
| 309 | Ga0451789_0032208 | 3300041443 | Bacteria | 3080 |
| 310 | Ga0451793_0030040 | 3300041452 | Bacteria | 12686 |
| 311 | Ga0451797_1115352 | 3300041453 | Bacteria | 1376 |
| 312 | Ga0451839_0236779 | 3300041496 | Bacteria | 1275 |
| 313 | Ga0451841_0237529 | 3300041498 | Bacteria | 7098 |
| 314 | Ga0451851_1320871 | 3300041507 | Bacteria | 1705 |
| 315 | Ga0451843_0118424 | 3300041509 | Bacteria | 7658 |
| 316 | Ga0451853_0450880 | 3300041512 | Bacteria | 5781 |
| 317 | Ga0439448_0008180 | 3300042005 | Bacteria | 3056 |
| 318 | Ga0439458_0013952 | 3300042157 | Bacteria | 1811 |
| 319 | Ga0439459_0006401 | 3300042438 | Bacteria | 1961 |
| 320 | Ga0439440_0035155 | 3300042993 | Bacteria | 1201 |
| 321 | Ga0466972_0040491 | 3300044658 | Bacteria | 2270 |
| 322 | Ga0466963_0010993 | 3300044694 | Bacteria | 5503 |
| 323 | Ga0466968_0011387 | 3300044735 | Bacteria | 3463 |
| 324 | Ga0466960_0021680 | 3300044901 | Bacteria | 2864 |
| 325 | Ga0466959_0079753 | 3300045049 | Bacteria | 2360 |
| 326 | Ga0466958_0344662 | 3300045836 | Bacteria | 959 |
| 327 | Ga0466967_0015880 | 3300045976 | Bacteria | 5918 |
| 328 | Ga0495592_0006249 | 3300046454 | Bacteria | 8862 |
| 329 | Ga0495603_0047957 | 3300046455 | Bacteria | 2543 |
| 330 | Ga0495603_0104275 | 3300046455 | Bacteria | 1655 |
| 331 | Ga0495629_0007646 | 3300046459 | Bacteria | 7958 |
| 332 | Ga0495638_0075549 | 3300046460 | Bacteria | 2053 |
| 333 | Ga0495638_0182544 | 3300046460 | Bacteria | 1196 |
| 334 | Ga0495651_0014677 | 3300046462 | Bacteria | 6058 |
| 335 | Ga0495651_0075745 | 3300046462 | Bacteria | 2550 |
| 336 | Ga0495582_0106588 | 3300046473 | Bacteria | 1572 |
| 337 | Ga0495639_0087058 | 3300046475 | Bacteria | 1462 |
| 338 | Ga0495585_0085288 | 3300046492 | Bacteria | 1707 |
| 339 | Ga0495585_0091949 | 3300046492 | Bacteria | 1633 |
| 340 | Ga0495594_0046950 | 3300046499 | Bacteria | 2372 |
| 341 | Ga0495606_0001378 | 3300046507 | Bacteria | 32860 |
| 342 | Ga0495608_0051094 | 3300046511 | Bacteria | 2741 |
| 343 | Ga0495618_0016192 | 3300046514 | Bacteria | 4558 |
| 344 | Ga0495628_0018212 | 3300046516 | Bacteria | 5823 |
| 345 | Ga0495643_0002411 | 3300046522 | Bacteria | 14864 |
| 346 | Ga0495648_0009360 | 3300046524 | Bacteria | 7605 |
| 347 | Ga0495652_0042759 | 3300046529 | Bacteria | 3906 |
| 348 | Ga0495652_0095546 | 3300046529 | Bacteria | 2422 |
| 349 | Ga0495652_0117070 | 3300046529 | Bacteria | 2132 |
| 350 | Ga0495640_0005145 | 3300046533 | Bacteria | 10395 |
| 351 | Ga0495640_0039489 | 3300046533 | Bacteria | 3311 |
| 352 | Ga0495587_0015410 | 3300046536 | Bacteria | 4774 |
| 353 | Ga0495645_0013131 | 3300046543 | Bacteria | 5854 |
| 354 | Ga0495668_0000259 | 3300046616 | Bacteria | 74862 |
| 355 | Ga0495668_0015766 | 3300046616 | Bacteria | 4405 |
| 356 | Ga0495668_0028818 | 3300046616 | Bacteria | 3138 |
| 357 | Ga0495634_0127206 | 3300046642 | Bacteria | 1627 |
| 358 | Ga0495625_0003277 | 3300046660 | Bacteria | 16357 |
| 359 | Ga0495625_0034789 | 3300046660 | Bacteria | 3716 |
| 360 | Ga0495635_0006142 | 3300046663 | Bacteria | 8379 |
| 361 | Ga0495588_0017797 | 3300046674 | Bacteria | 3457 |
| 362 | Ga0495657_0004887 | 3300046675 | Bacteria | 10674 |
| 363 | Ga0495623_0035366 | 3300046679 | Bacteria | 3202 |
| 364 | Ga0495646_0176776 | 3300046680 | Bacteria | 1173 |
| 365 | Ga0495613_0261109 | 3300046689 | Bacteria | 1206 |
| 366 | Ga0495624_0014418 | 3300046690 | Bacteria | 5364 |
| 367 | Ga0495624_0200566 | 3300046690 | Bacteria | 1212 |
| 368 | Ga0495670_0160817 | 3300046691 | Bacteria | 1180 |
| 369 | Ga0495600_0002515 | 3300046809 | Bacteria | 10534 |
| 370 | Ga0495600_0043220 | 3300046809 | Bacteria | 2938 |
| 371 | Ga0495600_0167287 | 3300046809 | Bacteria | 1420 |
| 372 | Ga0495581_0039554 | 3300047315 | Bacteria | 2730 |
| 373 | Ga0495604_0012352 | 3300047317 | Bacteria | 6790 |
| 374 | Ga0495604_0019070 | 3300047317 | Bacteria | 5493 |
| 375 | Ga0495674_0025041 | 3300047319 | Bacteria | 5476 |
| 376 | Ga0495674_0103000 | 3300047319 | Bacteria | 2427 |
| 377 | Ga0495672_0002205 | 3300047320 | Bacteria | 18139 |
| 378 | Ga0495672_0026724 | 3300047320 | Bacteria | 3678 |
| 379 | Ga0495676_0014471 | 3300047321 | Bacteria | 7060 |
| 380 | Ga0495676_0029978 | 3300047321 | Bacteria | 4624 |
| 381 | Ga0495676_0203596 | 3300047321 | Bacteria | 1374 |
| 382 | Ga0495680_0139248 | 3300047322 | Bacteria | 1776 |
| 383 | Ga0495673_0030246 | 3300047469 | Bacteria | 2546 |
| 384 | Ga0495686_0030384 | 3300047472 | Bacteria | 3509 |
| 385 | Ga0495686_0120900 | 3300047472 | Bacteria | 1561 |
| 386 | Ga0495602_0018715 | 3300048088 | Bacteria | 6903 |
| 387 | Ga0495614_0045857 | 3300048089 | Bacteria | 1874 |
| 388 | Ga0495614_0106900 | 3300048089 | Bacteria | 1227 |
| 389 | Ga0495626_0001026 | 3300048091 | Bacteria | 24018 |
| 390 | Ga0496100_0031015 | 3300048903 | Bacteria | 3320 |
| 391 | Ga0496100_0214621 | 3300048903 | Bacteria | 1409 |
| 392 | Ga0496101_0137921 | 3300048904 | Bacteria | 1857 |
| 393 | Ga0496102_0040385 | 3300048905 | Bacteria | 4220 |
| 394 | Ga0496102_0047188 | 3300048905 | Bacteria | 3913 |
| 395 | Ga0496102_0053460 | 3300048905 | Bacteria | 3681 |
| 396 | Ga0496102_0079680 | 3300048905 | Bacteria | 3016 |
| 397 | Ga0496102_0142123 | 3300048905 | Bacteria | 2251 |
| 398 | Ga0496102_0226216 | 3300048905 | Bacteria | 1764 |
| 399 | Ga0496103_0155989 | 3300048906 | Bacteria | 1463 |
| 400 | Ga0496104_0011609 | 3300048907 | Bacteria | 7895 |
| 401 | Ga0496104_0013023 | 3300048907 | Bacteria | 7490 |
| 402 | Ga0496104_0014360 | 3300048907 | Bacteria | 7154 |
| 403 | Ga0496104_0098347 | 3300048907 | Bacteria | 2801 |
| 404 | Ga0496105_0000927 | 3300048908 | Bacteria | 19975 |
| 405 | Ga0496105_0034846 | 3300048908 | Bacteria | 4142 |
| 406 | Ga0496106_0020841 | 3300048909 | Bacteria | 4864 |
| 407 | Ga0496106_0047070 | 3300048909 | Bacteria | 3244 |
| 408 | Ga0496106_0082233 | 3300048909 | Bacteria | 2475 |
| 409 | Ga0496107_0150447 | 3300048910 | Bacteria | 1721 |
| 410 | Ga0496108_0026896 | 3300048911 | Bacteria | 4747 |
| 411 | Ga0496108_0042385 | 3300048911 | Bacteria | 3799 |
| 412 | Ga0496108_0080932 | 3300048911 | Bacteria | 2752 |
| 413 | Ga0496108_0472884 | 3300048911 | Bacteria | 1095 |
| 414 | Ga0496109_0001511 | 3300048912 | Bacteria | 19346 |
| 415 | Ga0496109_0067077 | 3300048912 | Bacteria | 3286 |
| 416 | Ga0496109_0111227 | 3300048912 | Bacteria | 2547 |
| 417 | Ga0496110_0003449 | 3300048913 | Bacteria | 12109 |
| 418 | Ga0496110_0011802 | 3300048913 | Bacteria | 7171 |
| 419 | Ga0496110_0062166 | 3300048913 | Bacteria | 3297 |
| 420 | Ga0496111_0007346 | 3300048914 | Bacteria | 7212 |
| 421 | Ga0496111_0008407 | 3300048914 | Bacteria | 6828 |
| 422 | Ga0496111_0018397 | 3300048914 | Bacteria | 4840 |
| 423 | Ga0496111_0155240 | 3300048914 | Bacteria | 1698 |
| 424 | Ga0496112_0003978 | 3300048915 | Bacteria | 12380 |
| 425 | Ga0496112_0062905 | 3300048915 | Bacteria | 3661 |
| 426 | Ga0496113_0011810 | 3300048916 | Bacteria | 5849 |
| 427 | Ga0496113_0063862 | 3300048916 | Bacteria | 2783 |
| 428 | Ga0496113_0136061 | 3300048916 | Bacteria | 1931 |
| 429 | Ga0496114_0034760 | 3300048917 | Bacteria | 4160 |
| 430 | Ga0496114_0198342 | 3300048917 | Bacteria | 1757 |
| 431 | Ga0496114_0218882 | 3300048917 | Bacteria | 1671 |
| 432 | Ga0496115_0091549 | 3300048918 | Bacteria | 2485 |
| 433 | Ga0496115_0106812 | 3300048918 | Bacteria | 2298 |
| 434 | Ga0496117_0000174 | 3300048920 | Bacteria | 132648 |
| 435 | Ga0496122_0032905 | 3300048925 | Bacteria | 4275 |
| 436 | Ga0496123_0073882 | 3300048926 | Bacteria | 2113 |
| 437 | Ga0496124_0104757 | 3300048927 | Bacteria | 2287 |
| 438 | Ga0496125_0000626 | 3300048928 | Bacteria | 59339 |
| 439 | Ga0501031_0027582 | 3300049568 | Bacteria | 3702 |
| 440 | Ga0501031_0046642 | 3300049568 | Bacteria | 2825 |
| 441 | Ga0501031_0070725 | 3300049568 | Bacteria | 2273 |
| 442 | Ga0501031_0137996 | 3300049568 | Bacteria | 1593 |
| 443 | Ga0501031_0280182 | 3300049568 | Bacteria | 1082 |
| 444 | Ga0501032_0034512 | 3300049569 | Bacteria | 3462 |
| 445 | Ga0501033_0081401 | 3300049570 | Bacteria | 2374 |
| 446 | Ga0501034_0042162 | 3300049571 | Bacteria | 4619 |
| 447 | Ga0501034_0521513 | 3300049571 | Bacteria | 1100 |
| 448 | Ga0501036_0066730 | 3300049572 | Bacteria | 3044 |
| 449 | Ga0501036_0072659 | 3300049572 | Bacteria | 2908 |
| 450 | Ga0501036_0105330 | 3300049572 | Bacteria | 2385 |
| 451 | Ga0501036_0282730 | 3300049572 | Bacteria | 1388 |
| 452 | Ga0501037_0010114 | 3300049573 | Bacteria | 6922 |
| 453 | Ga0501038_0008164 | 3300049574 | Bacteria | 9635 |
| 454 | Ga0501038_0019423 | 3300049574 | Bacteria | 6124 |
| 455 | Ga0501039_0022056 | 3300049575 | Bacteria | 4887 |
| 456 | Ga0501040_0002787 | 3300049576 | Bacteria | 11263 |
| 457 | Ga0501040_0037829 | 3300049576 | Bacteria | 3280 |
| 458 | Ga0501041_0009739 | 3300049577 | Bacteria | 5662 |
| 459 | Ga0501042_0021679 | 3300049578 | Bacteria | 4480 |
| 460 | Ga0501042_0024525 | 3300049578 | Bacteria | 4231 |
| 461 | Ga0501042_0049708 | 3300049578 | Bacteria | 2992 |
| 462 | Ga0501042_0062708 | 3300049578 | Bacteria | 2656 |
| 463 | Ga0501046_0028293 | 3300049580 | Bacteria | 4566 |
| 464 | Ga0501047_0011530 | 3300049581 | Bacteria | 8366 |
| 465 | Ga0501047_0063248 | 3300049581 | Bacteria | 3570 |
| 466 | Ga0501047_0188719 | 3300049581 | Bacteria | 1925 |
| 467 | Ga0501048_0005570 | 3300049582 | Bacteria | 9582 |
| 468 | Ga0501068_0007149 | 3300049584 | Bacteria | 6180 |
| 469 | Ga0501071_0015782 | 3300049587 | Bacteria | 5188 |
| 470 | Ga0501071_0100724 | 3300049587 | Bacteria | 2129 |
| 471 | Ga0501071_0122746 | 3300049587 | Bacteria | 1926 |
| 472 | Ga0501071_0291955 | 3300049587 | Bacteria | 1235 |
| 473 | Ga0501071_0317249 | 3300049587 | Unclassified | 1183 |
| 474 | Ga0501072_0073004 | 3300049588 | Bacteria | 2712 |
| 475 | Ga0501072_0117529 | 3300049588 | Bacteria | 2118 |
| 476 | Ga0501072_0122385 | 3300049588 | Bacteria | 2073 |
| 477 | Ga0501072_0123972 | 3300049588 | Bacteria | 2058 |
| 478 | Ga0501075_0006385 | 3300049591 | Bacteria | 8115 |
| 479 | Ga0501075_0046991 | 3300049591 | Bacteria | 3244 |
| 480 | Ga0501075_0139360 | 3300049591 | Bacteria | 1848 |
| 481 | Ga0501075_0337203 | 3300049591 | Bacteria | 1149 |
| 482 | Ga0501076_0022931 | 3300049592 | Bacteria | 4804 |
| 483 | Ga0501076_0076989 | 3300049592 | Bacteria | 2675 |
| 484 | Ga0501076_0169419 | 3300049592 | Bacteria | 1780 |
| 485 | Ga0501077_0094412 | 3300049593 | Bacteria | 1896 |
| 486 | Ga0501077_0148005 | 3300049593 | Bacteria | 1490 |
| 487 | Ga0501079_0025405 | 3300049741 | Bacteria | 4544 |
| 488 | Ga0501079_0056528 | 3300049741 | Bacteria | 3028 |
| 489 | Ga0501079_0081749 | 3300049741 | Bacteria | 2498 |
| 490 | Ga0501079_0330970 | 3300049741 | Bacteria | 1193 |
| 491 | Ga0501080_0049624 | 3300049742 | Bacteria | 3906 |
| 492 | Ga0501081_0004636 | 3300049743 | Bacteria | 8833 |
| 493 | Ga0501083_0000229 | 3300049744 | Bacteria | 35953 |
| 494 | Ga0501083_0003466 | 3300049744 | Bacteria | 11030 |
| 495 | Ga0501083_0220068 | 3300049744 | Bacteria | 1237 |
| 496 | Ga0501035_0075833 | 3300049822 | Bacteria | 2974 |
| 497 | Ga0501044_0003175 | 3300049823 | Bacteria | 18559 |
| 498 | Ga0501044_0109417 | 3300049823 | Bacteria | 2772 |
| 499 | Ga0501045_0006353 | 3300049824 | Bacteria | 8178 |
| 500 | nmdc:mga05p37_167264_c1 | 3300050507 | Bacteria | 2683 |
| 501 | nmdc:mga09592_142489_c1 | 3300050508 | Bacteria | 2066 |
| 502 | nmdc:mga09592_83093_c1 | 3300050508 | Bacteria | 2729 |
| 503 | nmdc:mga08y16_101788_c1 | 3300050511 | Bacteria | 2991 |
| 504 | nmdc:mga08y16_53140_c1 | 3300050511 | Bacteria | 4237 |
| 505 | nmdc:mga08y16_67399_c1 | 3300050511 | Bacteria | 3734 |
| 506 | nmdc:mga08y16_85269_c1 | 3300050511 | Bacteria | 3292 |
| 507 | nmdc:mga08y16_93422_c1 | 3300050511 | Bacteria | 3134 |
| 508 | nmdc:mga0n895_13779_c1 | 3300050512 | Bacteria | 7312 |
| 509 | nmdc:mga0n895_221102_c1 | 3300050512 | Bacteria | 1923 |
| 510 | nmdc:mga0n895_2361_c1 | 3300050512 | Bacteria | 14715 |
| 511 | nmdc:mga0rr50_21320_c1 | 3300050513 | Bacteria | 4421 |
| 512 | nmdc:mga0rr50_49518_c1 | 3300050513 | Bacteria | 3110 |
| 513 | nmdc:mga08x19_51648_c1 | 3300050514 | Bacteria | 2642 |
| 514 | nmdc:mga0a205_41605_c1 | 3300050515 | Bacteria | 4426 |
| 515 | nmdc:mga0a205_49752_c1 | 3300050515 | Bacteria | 4047 |
| 516 | nmdc:mga0a205_6275_c1 | 3300050515 | Bacteria | 10731 |
| 517 | Ga0495612_0016832 | 3300053078 | Bacteria | 2929 |
| 518 | Ga0495612_0017755 | 3300053078 | Bacteria | 2849 |
| 519 | Ga0500635_0000472 | 3300053080 | Bacteria | 11439 |
| 520 | Ga0500643_005509 | 3300053087 | Bacteria | 5444 |
| 521 | Ga0500643_008819 | 3300053087 | Bacteria | 3919 |
| 522 | Ga0500556_0000079 | 3300053104 | Bacteria | 91775 |
| 523 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 524 | Ga0500573_0086842 | 3300053140 | Bacteria | 1772 |
| 525 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 526 | Ga0500616_0008517 | 3300053153 | Bacteria | 6358 |
| 527 | Ga0500645_003751 | 3300053730 | Bacteria | 6057 |
| 528 | Ga0501084_0030543 | 3300054114 | Bacteria | 4505 |
| 529 | Ga0501084_0122584 | 3300054114 | Bacteria | 2186 |
| 530 | Ga0501084_0416954 | 3300054114 | Bacteria | 1135 |
| 531 | Ga0587090_011067 | 3300059510 | Bacteria | 1262 |
| 532 | Ga0501082_0010154 | 3300060353 | Bacteria | 8109 |
| 533 | Ga0501082_0020041 | 3300060353 | Bacteria | 5763 |
| 534 | Ga0501082_0033531 | 3300060353 | Bacteria | 4431 |
| 535 | Ga0501082_0087970 | 3300060353 | Bacteria | 2681 |
| 536 | Ga0530510_0006472 | 3300061734 | Bacteria | 8157 |
| 537 | Ga0530510_0010097 | 3300061734 | Bacteria | 6617 |
| 538 | Ga0530510_0342316 | 3300061734 | Bacteria | 1123 |
| 539 | 2643887697 | 2643221575 | Bacteria | 4022601 |
| 540 | 2644095513 | 2643221616 | Bacteria | 4066575 |
| 541 | 2644183382 | 2643221632 | Bacteria | 3406696 |
| 542 | 2644455607 | 2643221681 | Bacteria | 3707866 |
| 543 | 2644506251 | 2643221690 | Bacteria | 4654705 |
| 544 | 2644526245 | 2643221694 | Bacteria | 4392972 |
| 545 | 2644670920 | 2643221722 | Bacteria | 4247614 |
| 546 | 2676481009 | 2675903059 | Bacteria | 8644972 |
| 547 | 2810363214 | 2808606700 | Bacteria | 3482157 |
| 548 | 2816422583 | 2816332119 | Bacteria | 8120218 |
| 549 | 2837272262 | 2837268691 | Bacteria | 7850704 |
| 550 | 2887480047 | 2887478801 | Bacteria | 8972725 |
| 551 | 2896185641 | 2896184354 | Bacteria | 3258548 |
| 552 | 2896256373 | 2896253425 | Bacteria | 3418029 |
| 553 | 2905928472 | 2905926851 | Bacteria | 4423176 |
| 554 | 2909077433 | 2909074476 | Bacteria | 3436050 |
| 555 | 2912758279 | 2912757875 | Bacteria | 7940295 |
| 556 | 2929213597 | 2929212328 | Bacteria | 7708288 |
| 557 | 2939588074 | 2939582691 | Bacteria | 7088898 |
| 558 | 2939660302 | 2939657138 | Bacteria | 3740283 |
| 559 | 2946003572 | 2946003308 | Bacteria | 3857229 |
| 560 | 8001788658 | 8001781756 | Bacteria | 9586736 |
| 561 | 8057346527 | 8057345674 | Bacteria | 4160394 |
| 562 | Ga0495592_0004026 | |||
| 563 | Ga0065714_10080967 | |||
| 564 | Ga0070658_10102568 | |||
| 565 | Ga0070658_10296537 | |||
| 566 | Ga0070683_100017307 | |||
| 567 | Ga0070683_100112825 | |||
| 568 | Ga0070690_100235314 | |||
| 569 | Ga0068869_100058366 | |||
| 570 | Ga0068869_100089919 | |||
| 571 | Ga0070682_100014644 | |||
| 572 | Ga0070682_100032623 | |||
| 573 | Ga0070660_100084106 | |||
| 574 | Ga0070660_100376862 | |||
| 575 | Ga0070689_100038801 | |||
| 576 | Ga0070691_10000828 | |||
| 577 | Ga0070687_100131896 | |||
| 578 | Ga0070668_100023598 | |||
| 579 | Ga0070668_100182528 | |||
| 580 | Ga0070675_100005384 | |||
| 581 | Ga0070675_100043381 | |||
| 582 | Ga0070671_100035464 | |||
| 583 | Ga0070671_100146179 | |||
| 584 | Ga0070673_100038792 | |||
| 585 | Ga0070673_100106244 | |||
| 586 | Ga0070659_100136760 | |||
| 587 | Ga0070667_100302682 | |||
| 588 | Ga0070667_100390872 | |||
| 589 | Ga0070709_10042311 | |||
| 590 | Ga0070714_100015651 | |||
| 591 | Ga0070714_100036504 | |||
| 592 | Ga0070714_100325864 | |||
| 593 | Ga0070713_100010449 | |||
| 594 | Ga0070701_10024707 | |||
| 595 | Ga0070711_100187622 | |||
| 596 | Ga0070705_100054337 | |||
| 597 | Ga0070705_100105449 | |||
| 598 | Ga0070700_100122568 | |||
| 599 | Ga0070700_100245097 | |||
| 600 | Ga0070663_100007546 | |||
| 601 | Ga0070663_100057414 | |||
| 602 | Ga0070663_100186574 | |||
| 603 | Ga0070663_100193331 | |||
| 604 | Ga0070678_100040375 | |||
| 605 | Ga0070678_100100708 | |||
| 606 | Ga0070678_100135495 | |||
| 607 | Ga0070678_100445962 | |||
| 608 | Ga0070662_100046219 | |||
| 609 | Ga0070662_100122494 | |||
| 610 | Ga0070681_10004201 | |||
| 611 | Ga0070681_10018476 | |||
| 612 | Ga0070681_10342075 | |||
| 613 | Ga0070685_10026770 | |||
| 614 | Ga0070685_10039015 | |||
| 615 | Ga0070679_100111997 | |||
| 616 | Ga0070679_100315792 | |||
| 617 | Ga0070684_100041783 | |||
| 618 | Ga0070684_100081265 | |||
| 619 | Ga0070684_100104381 | |||
| 620 | Ga0068853_100012990 | |||
| 621 | Ga0070686_100357063 | |||
| 622 | Ga0070665_100051114 | |||
| 623 | Ga0070665_100075636 | |||
| 624 | Ga0070665_100105433 | |||
| 625 | Ga0070665_100180965 | |||
| 626 | Ga0070704_100140042 | |||
| 627 | Ga0068855_100219519 | |||
| 628 | Ga0070664_100023388 | |||
| 629 | Ga0070664_100420087 | |||
| 630 | Ga0068857_100102440 | |||
| 631 | Ga0068854_100073519 | |||
| 632 | Ga0068856_100066637 | |||
| 633 | Ga0070702_100115888 | |||
| 634 | Ga0068852_100121089 | |||
| 635 | Ga0068852_100183387 | |||
| 636 | Ga0068859_100075295 | |||
| 637 | Ga0068859_100428828 | |||
| 638 | Ga0068864_100014736 | |||
| 639 | Ga0068864_100172930 | |||
| 640 | Ga0068861_100096650 | |||
| 641 | Ga0068870_10001853 | |||
| 642 | Ga0068863_100064802 | |||
| 643 | Ga0068862_100281433 | |||
| 644 | Ga0081455_10014945 | |||
| 645 | Ga0081455_10035706 | |||
| 646 | Ga0081540_1002567 | |||
| 647 | Ga0081540_1012342 | |||
| 648 | Ga0081540_1030483 | |||
| 649 | Ga0070717_10028793 | |||
| 650 | Ga0075432_10012930 | |||
| 651 | Ga0075432_10020206 | |||
| 652 | Ga0070716_100292748 | |||
| 653 | Ga0070712_100009188 | |||
| 654 | Ga0070712_100225515 | |||
| 655 | Ga0068871_100018601 | |||
| 656 | Ga0075428_100073841 | |||
| 657 | Ga0075430_100006226 | |||
| 658 | Ga0075430_100247019 | |||
| 659 | Ga0075431_100026085 | |||
| 660 | Ga0075431_100036609 | |||
| 661 | Ga0075431_100421680 | |||
| 662 | Ga0075433_10001181 | |||
| 663 | Ga0075433_10032100 | |||
| 664 | Ga0075434_100001152 | |||
| 665 | Ga0075434_100011561 | |||
| 666 | Ga0075434_100019484 | |||
| 667 | Ga0075434_100073584 | |||
| 668 | Ga0075436_100008639 | |||
| 669 | Ga0075436_100051082 | |||
| 670 | Ga0075436_100110945 | |||
| 671 | Ga0097620_100075295 | |||
| 672 | Ga0097620_100428842 | |||
| 673 | Ga0075435_100000430 | |||
| 674 | Ga0075435_100011622 | |||
| 675 | Ga0105244_10084698 | |||
| 676 | Ga0111539_10009937 | |||
| 677 | Ga0111539_10041004 | |||
| 678 | Ga0111539_10295721 | |||
| 679 | Ga0105245_10061258 | |||
| 680 | Ga0105245_10442142 | |||
| 681 | Ga0105247_10064566 | |||
| 682 | Ga0114129_10133259 | |||
| 683 | Ga0114129_10535686 | |||
| 684 | Ga0105241_10128982 | |||
| 685 | Ga0105242_10075134 | |||
| 686 | Ga0105248_10031371 | |||
| 687 | Ga0105248_10123097 | |||
| 688 | Ga0105237_10566480 | |||
| 689 | Ga0105249_10009782 | |||
| 690 | Ga0105239_10120161 | |||
| 691 | Ga0105246_10004017 | |||
| 692 | Ga0105246_10044393 | |||
| 693 | Ga0105246_10189834 | |||
| 694 | Ga0157373_10037512 | |||
| 695 | Ga0157371_10045836 | |||
| 696 | Ga0157370_10204883 | |||
| 697 | Ga0157369_10000926 | |||
| 698 | Ga0157369_10017095 | |||
| 699 | Ga0157374_10028671 | |||
| 700 | Ga0157374_10037231 | |||
| 701 | Ga0163162_10232129 | |||
| 702 | Ga0163162_10359371 | |||
| 703 | Ga0163162_10590108 | |||
| 704 | Ga0157372_10029942 | |||
| 705 | Ga0157380_10146898 | |||
| 706 | Ga0157379_10019892 | |||
| 707 | Ga0157379_10279600 | |||
| 708 | Ga0157376_10180769 | |||
| 709 | Ga0157376_10309978 | |||
| 710 | Ga0163161_10232891 | |||
| 711 | Ga0206356_11122267 | |||
| 712 | Ga0206356_11320489 | |||
| 713 | Ga0206356_11498757 | |||
| 714 | Ga0206349_1110273 | |||
| 715 | Ga0206349_1530387 | |||
| 716 | Ga0206351_10309671 | |||
| 717 | Ga0206351_10908197 | |||
| 718 | Ga0206352_10083294 | |||
| 719 | Ga0206350_10030584 | |||
| 720 | Ga0206350_10571440 | |||
| 721 | Ga0206350_10886141 | |||
| 722 | Ga0206350_11275337 | |||
| 723 | Ga0206354_10524397 | |||
| 724 | Ga0206354_10625737 | |||
| 725 | Ga0206353_11315474 | |||
| 726 | Ga0213876_10060842 | |||
| 727 | Ga0213875_10000280 | |||
| 728 | Ga0224712_10001097 | |||
| 729 | Ga0224712_10003165 | |||
| 730 | Ga0224712_10003266 | |||
| 731 | Ga0224712_10010573 | |||
| 732 | Ga0224712_10022190 | |||
| 733 | Ga0224712_10056144 | |||
| 734 | Ga0224572_1008914 | |||
| 735 | Ga0207656_10027823 | |||
| 736 | Ga0207692_10025216 | |||
| 737 | Ga0207710_10035200 | |||
| 738 | Ga0207710_10054682 | |||
| 739 | Ga0207688_10002125 | |||
| 740 | Ga0207688_10009265 | |||
| 741 | Ga0207647_10123300 | |||
| 742 | Ga0207699_10015242 | |||
| 743 | Ga0207643_10000272 | |||
| 744 | Ga0207643_10079334 | |||
| 745 | Ga0207705_10033800 | |||
| 746 | Ga0207705_10117286 | |||
| 747 | Ga0207654_10031383 | |||
| 748 | Ga0207707_10005491 | |||
| 749 | Ga0207707_10318210 | |||
| 750 | Ga0207695_10129593 | |||
| 751 | Ga0207693_10012817 | |||
| 752 | Ga0207693_10196775 | |||
| 753 | Ga0207663_10062260 | |||
| 754 | Ga0207663_10329021 | |||
| 755 | Ga0207660_10014624 | |||
| 756 | Ga0207662_10024054 | |||
| 757 | Ga0207657_10018442 | |||
| 758 | Ga0207649_10019310 | |||
| 759 | Ga0207652_10017405 | |||
| 760 | Ga0207650_10016646 | |||
| 761 | Ga0207659_10002628 | |||
| 762 | Ga0207659_10120901 | |||
| 763 | Ga0207687_10017977 | |||
| 764 | Ga0207687_10212134 | |||
| 765 | Ga0207687_10237740 | |||
| 766 | Ga0207700_10080947 | |||
| 767 | Ga0207664_10128948 | |||
| 768 | Ga0207644_10030697 | |||
| 769 | Ga0207644_10123945 | |||
| 770 | Ga0207690_10113025 | |||
| 771 | Ga0207706_10016978 | |||
| 772 | Ga0207706_10226172 | |||
| 773 | Ga0207670_10058275 | |||
| 774 | Ga0207670_10211797 | |||
| 775 | Ga0207691_10097354 | |||
| 776 | Ga0207691_10135619 | |||
| 777 | Ga0207711_10169118 | |||
| 778 | Ga0207711_10229073 | |||
| 779 | Ga0207689_10005539 | |||
| 780 | Ga0207689_10155806 | |||
| 781 | Ga0207661_10012376 | |||
| 782 | Ga0207661_10020785 | |||
| 783 | Ga0207661_10047429 | |||
| 784 | Ga0207661_10087117 | |||
| 785 | Ga0207661_10096637 | |||
| 786 | Ga0207679_10008711 | |||
| 787 | Ga0207679_10114622 | |||
| 788 | Ga0207667_10083233 | |||
| 789 | Ga0207667_10185970 | |||
| 790 | Ga0207651_10010784 | |||
| 791 | Ga0207651_10110801 | |||
| 792 | Ga0207712_10064075 | |||
| 793 | Ga0207668_10021667 | |||
| 794 | Ga0207640_10415158 | |||
| 795 | Ga0207658_10082049 | |||
| 796 | Ga0207639_10011282 | |||
| 797 | Ga0207639_10019319 | |||
| 798 | Ga0207678_10000085 | |||
| 799 | Ga0207678_10246149 | |||
| 800 | Ga0207708_10013218 | |||
| 801 | Ga0207708_10286025 | |||
| 802 | Ga0207702_10005959 | |||
| 803 | Ga0207702_10014020 | |||
| 804 | Ga0207702_10112638 | |||
| 805 | Ga0207641_10031739 | |||
| 806 | Ga0207641_10043882 | |||
| 807 | Ga0207648_10135111 | |||
| 808 | Ga0207648_10309663 | |||
| 809 | Ga0207676_10009110 | |||
| 810 | Ga0207674_10027261 | |||
| 811 | Ga0207674_10080804 | |||
| 812 | Ga0207674_10269267 | |||
| 813 | Ga0207675_100134418 | |||
| 814 | Ga0207675_100154993 | |||
| 815 | Ga0207675_100202620 | |||
| 816 | Ga0207683_10000055 | |||
| 817 | Ga0207683_10091885 | |||
| 818 | Ga0207683_10139305 | |||
| 819 | Ga0207698_10010967 | |||
| 820 | Ga0207698_10011320 | |||
| 821 | Ga0207698_10164092 | |||
| 822 | Ga0207428_10015563 | |||
| 823 | Ga0207428_10019475 | |||
| 824 | Ga0207428_10040108 | |||
| 825 | Ga0207428_10161720 | |||
| 826 | Ga0268266_10087486 | |||
| 827 | Ga0268265_10067404 | |||
| 828 | Ga0268265_10204054 | |||
| 829 | Ga0268264_10198287 | |||
| 830 | Ga0268264_10300593 | |||
| 831 | Ga0307515_10000591 | |||
| 832 | Ga0307515_10221864 | |||
| 833 | Ga0265338_10000363 | |||
| 834 | Ga0265338_10013249 | |||
| 835 | Ga0265316_10024684 | |||
| 836 | Ga0265316_10105824 | |||
| 837 | Ga0307513_10002345 | |||
| 838 | Ga0316575_10020220 | |||
| 839 | Ga0316578_10056703 | |||
| 840 | Ga0307516_10000462 | |||
| 841 | Ga0307413_10066560 | |||
| 842 | Ga0307410_10085347 | |||
| 843 | Ga0307410_10089421 | |||
| 844 | Ga0307414_10194207 | |||
| 845 | Ga0307411_10044661 | |||
| 846 | Ga0316583_10005170 | |||
| 847 | Ga0316593_10051607 | |||
| 848 | Ga0316586_1000406 | |||
| 849 | Ga0316587_1004221 | |||
| 850 | Ga0316596_1037748 | |||
| 851 | Ga0316214_1001689 | |||
| 852 | Ga0373923_0002226 | |||
| 853 | Ga0373923_0073219 | |||
| 854 | Ga0373953_0006530 | |||
| 855 | Ga0373956_0014570 | |||
| 856 | Ga0373957_0033627 | |||
| 857 | Ga0316574_0019936 | |||
| 858 | Ga0373935_0014488 | |||
| 859 | Ga0373933_0004469 | |||
| 860 | Ga0316582_0029221 | |||
| 861 | Ga0316582_0217999 | |||
| 862 | Ga0316584_0032971 | |||
| 863 | Ga0395900_0120889 | |||
| 864 | Ga0395898_0002776 | |||
| 865 | Ga0395898_0130948 | |||
| 866 | Ga0436364_0919152 | |||
| 867 | Ga0436364_1341190 | |||
| 868 | Ga0395901_0029862 | |||
| 869 | Ga0436365_0334427 | |||
| 870 | Ga0451789_0032208 | |||
| 871 | Ga0451793_0030040 | |||
| 872 | Ga0451797_1115352 | |||
| 873 | Ga0451839_0236779 | |||
| 874 | Ga0451841_0237529 | |||
| 875 | Ga0451851_1320871 | |||
| 876 | Ga0451843_0118424 | |||
| 877 | Ga0451853_0450880 | |||
| 878 | Ga0439448_0008180 | |||
| 879 | Ga0439458_0013952 | |||
| 880 | Ga0439459_0006401 | |||
| 881 | Ga0439440_0035155 | |||
| 882 | Ga0466972_0040491 | |||
| 883 | Ga0466963_0010993 | |||
| 884 | Ga0466968_0011387 | |||
| 885 | Ga0466960_0021680 | |||
| 886 | Ga0466959_0079753 | |||
| 887 | Ga0466958_0344662 | |||
| 888 | Ga0466967_0015880 | |||
| 889 | Ga0495592_0006249 | |||
| 890 | Ga0495603_0047957 | |||
| 891 | Ga0495603_0104275 | |||
| 892 | Ga0495629_0007646 | |||
| 893 | Ga0495638_0075549 | |||
| 894 | Ga0495638_0182544 | |||
| 895 | Ga0495651_0014677 | |||
| 896 | Ga0495651_0075745 | |||
| 897 | Ga0495582_0106588 | |||
| 898 | Ga0495639_0087058 | |||
| 899 | Ga0495585_0085288 | |||
| 900 | Ga0495585_0091949 | |||
| 901 | Ga0495594_0046950 | |||
| 902 | Ga0495606_0001378 | |||
| 903 | Ga0495608_0051094 | |||
| 904 | Ga0495618_0016192 | |||
| 905 | Ga0495628_0018212 | |||
| 906 | Ga0495643_0002411 | |||
| 907 | Ga0495648_0009360 | |||
| 908 | Ga0495652_0042759 | |||
| 909 | Ga0495652_0095546 | |||
| 910 | Ga0495652_0117070 | |||
| 911 | Ga0495640_0005145 | |||
| 912 | Ga0495640_0039489 | |||
| 913 | Ga0495587_0015410 | |||
| 914 | Ga0495645_0013131 | |||
| 915 | Ga0495668_0000259 | |||
| 916 | Ga0495668_0015766 | |||
| 917 | Ga0495668_0028818 | |||
| 918 | Ga0495634_0127206 | |||
| 919 | Ga0495625_0003277 | |||
| 920 | Ga0495625_0034789 | |||
| 921 | Ga0495635_0006142 | |||
| 922 | Ga0495588_0017797 | |||
| 923 | Ga0495657_0004887 | |||
| 924 | Ga0495623_0035366 | |||
| 925 | Ga0495646_0176776 | |||
| 926 | Ga0495613_0261109 | |||
| 927 | Ga0495624_0014418 | |||
| 928 | Ga0495624_0200566 | |||
| 929 | Ga0495670_0160817 | |||
| 930 | Ga0495600_0002515 | |||
| 931 | Ga0495600_0043220 | |||
| 932 | Ga0495600_0167287 | |||
| 933 | Ga0495581_0039554 | |||
| 934 | Ga0495604_0012352 | |||
| 935 | Ga0495604_0019070 | |||
| 936 | Ga0495674_0025041 | |||
| 937 | Ga0495674_0103000 | |||
| 938 | Ga0495672_0002205 | |||
| 939 | Ga0495672_0026724 | |||
| 940 | Ga0495676_0014471 | |||
| 941 | Ga0495676_0029978 | |||
| 942 | Ga0495676_0203596 | |||
| 943 | Ga0495680_0139248 | |||
| 944 | Ga0495673_0030246 | |||
| 945 | Ga0495686_0030384 | |||
| 946 | Ga0495686_0120900 | |||
| 947 | Ga0495602_0018715 | |||
| 948 | Ga0495614_0045857 | |||
| 949 | Ga0495614_0106900 | |||
| 950 | Ga0495626_0001026 | |||
| 951 | Ga0496100_0031015 | |||
| 952 | Ga0496100_0214621 | |||
| 953 | Ga0496101_0137921 | |||
| 954 | Ga0496102_0040385 | |||
| 955 | Ga0496102_0047188 | |||
| 956 | Ga0496102_0053460 | |||
| 957 | Ga0496102_0079680 | |||
| 958 | Ga0496102_0142123 | |||
| 959 | Ga0496102_0226216 | |||
| 960 | Ga0496103_0155989 | |||
| 961 | Ga0496104_0011609 | |||
| 962 | Ga0496104_0013023 | |||
| 963 | Ga0496104_0014360 | |||
| 964 | Ga0496104_0098347 | |||
| 965 | Ga0496105_0000927 | |||
| 966 | Ga0496105_0034846 | |||
| 967 | Ga0496106_0020841 | |||
| 968 | Ga0496106_0047070 | |||
| 969 | Ga0496106_0082233 | |||
| 970 | Ga0496107_0150447 | |||
| 971 | Ga0496108_0026896 | |||
| 972 | Ga0496108_0042385 | |||
| 973 | Ga0496108_0080932 | |||
| 974 | Ga0496108_0472884 | |||
| 975 | Ga0496109_0001511 | |||
| 976 | Ga0496109_0067077 | |||
| 977 | Ga0496109_0111227 | |||
| 978 | Ga0496110_0003449 | |||
| 979 | Ga0496110_0011802 | |||
| 980 | Ga0496110_0062166 | |||
| 981 | Ga0496111_0007346 | |||
| 982 | Ga0496111_0008407 | |||
| 983 | Ga0496111_0018397 | |||
| 984 | Ga0496111_0155240 | |||
| 985 | Ga0496112_0003978 | |||
| 986 | Ga0496112_0062905 | |||
| 987 | Ga0496113_0011810 | |||
| 988 | Ga0496113_0063862 | |||
| 989 | Ga0496113_0136061 | |||
| 990 | Ga0496114_0034760 | |||
| 991 | Ga0496114_0198342 | |||
| 992 | Ga0496114_0218882 | |||
| 993 | Ga0496115_0091549 | |||
| 994 | Ga0496115_0106812 | |||
| 995 | Ga0496117_0000174 | |||
| 996 | Ga0496122_0032905 | |||
| 997 | Ga0496123_0073882 | |||
| 998 | Ga0496124_0104757 | |||
| 999 | Ga0496125_0000626 | |||
| 1000 | Ga0501031_0027582 | |||
| 1001 | Ga0501031_0046642 | |||
| 1002 | Ga0501031_0070725 | |||
| 1003 | Ga0501031_0137996 | |||
| 1004 | Ga0501031_0280182 | |||
| 1005 | Ga0501032_0034512 | |||
| 1006 | Ga0501033_0081401 | |||
| 1007 | Ga0501034_0042162 | |||
| 1008 | Ga0501034_0521513 | |||
| 1009 | Ga0501036_0066730 | |||
| 1010 | Ga0501036_0072659 | |||
| 1011 | Ga0501036_0105330 | |||
| 1012 | Ga0501036_0282730 | |||
| 1013 | Ga0501037_0010114 | |||
| 1014 | Ga0501038_0008164 | |||
| 1015 | Ga0501038_0019423 | |||
| 1016 | Ga0501039_0022056 | |||
| 1017 | Ga0501040_0002787 | |||
| 1018 | Ga0501040_0037829 | |||
| 1019 | Ga0501041_0009739 | |||
| 1020 | Ga0501042_0021679 | |||
| 1021 | Ga0501042_0024525 | |||
| 1022 | Ga0501042_0049708 | |||
| 1023 | Ga0501042_0062708 | |||
| 1024 | Ga0501046_0028293 | |||
| 1025 | Ga0501047_0011530 | |||
| 1026 | Ga0501047_0063248 | |||
| 1027 | Ga0501047_0188719 | |||
| 1028 | Ga0501048_0005570 | |||
| 1029 | Ga0501068_0007149 | |||
| 1030 | Ga0501071_0015782 | |||
| 1031 | Ga0501071_0100724 | |||
| 1032 | Ga0501071_0122746 | |||
| 1033 | Ga0501071_0291955 | |||
| 1034 | Ga0501071_0317249 | |||
| 1035 | Ga0501072_0073004 | |||
| 1036 | Ga0501072_0117529 | |||
| 1037 | Ga0501072_0122385 | |||
| 1038 | Ga0501072_0123972 | |||
| 1039 | Ga0501075_0006385 | |||
| 1040 | Ga0501075_0046991 | |||
| 1041 | Ga0501075_0139360 | |||
| 1042 | Ga0501075_0337203 | |||
| 1043 | Ga0501076_0022931 | |||
| 1044 | Ga0501076_0076989 | |||
| 1045 | Ga0501076_0169419 | |||
| 1046 | Ga0501077_0094412 | |||
| 1047 | Ga0501077_0148005 | |||
| 1048 | Ga0501079_0025405 | |||
| 1049 | Ga0501079_0056528 | |||
| 1050 | Ga0501079_0081749 | |||
| 1051 | Ga0501079_0330970 | |||
| 1052 | Ga0501080_0049624 | |||
| 1053 | Ga0501081_0004636 | |||
| 1054 | Ga0501083_0000229 | |||
| 1055 | Ga0501083_0003466 | |||
| 1056 | Ga0501083_0220068 | |||
| 1057 | Ga0501035_0075833 | |||
| 1058 | Ga0501044_0003175 | |||
| 1059 | Ga0501044_0109417 | |||
| 1060 | Ga0501045_0006353 | |||
| 1061 | nmdc:mga05p37_167264_c1 | |||
| 1062 | nmdc:mga09592_142489_c1 | |||
| 1063 | nmdc:mga09592_83093_c1 | |||
| 1064 | nmdc:mga08y16_101788_c1 | |||
| 1065 | nmdc:mga08y16_53140_c1 | |||
| 1066 | nmdc:mga08y16_67399_c1 | |||
| 1067 | nmdc:mga08y16_85269_c1 | |||
| 1068 | nmdc:mga08y16_93422_c1 | |||
| 1069 | nmdc:mga0n895_13779_c1 | |||
| 1070 | nmdc:mga0n895_221102_c1 | |||
| 1071 | nmdc:mga0n895_2361_c1 | |||
| 1072 | nmdc:mga0rr50_21320_c1 | |||
| 1073 | nmdc:mga0rr50_49518_c1 | |||
| 1074 | nmdc:mga08x19_51648_c1 | |||
| 1075 | nmdc:mga0a205_41605_c1 | |||
| 1076 | nmdc:mga0a205_49752_c1 | |||
| 1077 | nmdc:mga0a205_6275_c1 | |||
| 1078 | Ga0495612_0016832 | |||
| 1079 | Ga0495612_0017755 | |||
| 1080 | Ga0500635_0000472 | |||
| 1081 | Ga0500643_005509 | |||
| 1082 | Ga0500643_008819 | |||
| 1083 | Ga0500556_0000079 | |||
| 1084 | Ga0500642_0000001 | |||
| 1085 | Ga0500573_0086842 | |||
| 1086 | Ga0500616_0000010 | |||
| 1087 | Ga0500616_0008517 | |||
| 1088 | Ga0500645_003751 | |||
| 1089 | Ga0501084_0030543 | |||
| 1090 | Ga0501084_0122584 | |||
| 1091 | Ga0501084_0416954 | |||
| 1092 | Ga0587090_011067 | |||
| 1093 | Ga0501082_0010154 | |||
| 1094 | Ga0501082_0020041 | |||
| 1095 | Ga0501082_0033531 | |||
| 1096 | Ga0501082_0087970 | |||
| 1097 | Ga0530510_0006472 | |||
| 1098 | Ga0530510_0010097 | |||
| 1099 | Ga0530510_0342316 | |||
| 1100 | 2643887697 | |||
| 1101 | 2644095513 | |||
| 1102 | 2644183382 | |||
| 1103 | 2644455607 | |||
| 1104 | 2644506251 | |||
| 1105 | 2644526245 | |||
| 1106 | 2644670920 | |||
| 1107 | 2676481009 | |||
| 1108 | 2810363214 | |||
| 1109 | 2816422583 | |||
| 1110 | 2837272262 | |||
| 1111 | 2887480047 | |||
| 1112 | 2896185641 | |||
| 1113 | 2896256373 | |||
| 1114 | 2905928472 | |||
| 1115 | 2909077433 | |||
| 1116 | 2912758279 | |||
| 1117 | 2929213597 | |||
| 1118 | 2939588074 | |||
| 1119 | 2939660302 | |||
| 1120 | 2946003572 | |||
| 1121 | 8001788658 | |||
| 1122 | 8057346527 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ct4-assembly1.cif.gz_A | structure of dha-kinase subunit dhak from l. lactis | 0.9308 | 2 | 327 |
| 4lry-assembly1.cif.gz_B | crystal structure of the e.coli dhar(n)-dhak(t79l) complex | 0.9278 | 1 | 331 |
| 4lry-assembly1.cif.gz_B | crystal structure of the e.coli dhar(n)-dhak(t79l) complex | 0.9251 | 1 | 331 |
| 3pnk-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak | 0.9232 | 2 | 331 |
| 2iu4-assembly1.cif.gz_A | dihydroxyacetone kinase operon co-activator dha-dhaq | 0.9225 | 14 | 324 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ct4A02 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 | 0.9265 | 186 | 325 | 3.30.1180.20 |
| af_Q2G1Z0_180_322_3.30.1180.20 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 | 0.9215 | 186 | 323 | 3.30.1180.20 |
| af_Q2G1Z0_14_178_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.9173 | 14 | 182 | 3.40.50.10440 |
| af_Q55EE0_214_393_3.30.1180.20 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 | 0.9124 | 186 | 323 | 3.30.1180.20 |
| af_P76015_11_183_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.9073 | 12 | 183 | 3.40.50.10440 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X1QDC1-F1-model_v4 | DhaK domain-containing protein | 0.9757 | 226 | 325 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A424Y9I4-F1-model_v4 | deleted | 0.9739 | 225 | 326 |
|
| AF-A0A353C4Q3-F1-model_v4 | Dihydroxyacetone kinase | 0.9689 | 231 | 325 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A349S427-F1-model_v4 | Dihydroxyacetone kinase subunit DhaK | 0.9688 | 236 | 325 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-X1QDC1-F1-model_v4 | DhaK domain-containing protein | 0.9662 | 226 | 325 |
GO:0004371
GO:0005829 GO:0019563 |