F463851

General Info

Members Datasets Scaffolds Average Seq Length
561 331 1122 330

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0004026|Ga0495592_0004026_2495_3562
Length 355
Sequence MPKPTGLEADRTQWRRDTIRRSEGMKKFVNDPKDYVAEMLEGLALANPGTLKYVPEYNLIMRADAPQENKVSIVQGSGSGHEPAHVMSVGKGMLDAACPGDVFAAPPTDFVYETVKRVASPKGVLLLVNNYTGDRMAFEMAEELSQAEGVTARTLFIDDDVAVQDSTYTVGRRGVAGNFFVMKAVGAAAERGADLDEVYRIGEKVNSVARTMGMALTACTPPAKGSPLFDLPDDSVEMGVGIHGEPGRKREKLQSADAMVGELVSAVVDDLPYTSGDRVALMVNGLGGTPIGELYLVYGRAHKQLAERGIEIRRSYVGEYCTSLDMAGASVTLVRLDDEISELLADPAEIPIRVF

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
163 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
183 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
298 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2643221575 Microbacterium sp. Root61 Isolate Unclassified
310 2643221616 Leifsonia sp. Root227 Isolate Unclassified
311 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
312 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
313 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
314 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
315 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
316 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
317 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
318 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
319 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
320 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
321 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
322 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
323 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
324 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
325 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
326 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
327 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
328 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
329 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
330 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
331 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.27
Metatranscriptomes 4.63
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 8.38
Rhizosphere 85.03
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0004026 3300046454 Bacteria 10673
2 Ga0065714_10080967 3300005288 Bacteria 2403
3 Ga0070658_10102568 3300005327 Bacteria 2366
4 Ga0070658_10296537 3300005327 Bacteria 1378
5 Ga0070683_100017307 3300005329 Bacteria 6369
6 Ga0070683_100112825 3300005329 Bacteria 2565
7 Ga0070690_100235314 3300005330 Bacteria 1290
8 Ga0068869_100058366 3300005334 Bacteria 2821
9 Ga0068869_100089919 3300005334 Bacteria 2307
10 Ga0070682_100014644 3300005337 Bacteria 4534
11 Ga0070682_100032623 3300005337 Bacteria 3160
12 Ga0070660_100084106 3300005339 Bacteria 2501
13 Ga0070660_100376862 3300005339 Bacteria 1171
14 Ga0070689_100038801 3300005340 Bacteria 3644
15 Ga0070691_10000828 3300005341 Bacteria 12441
16 Ga0070687_100131896 3300005343 Bacteria 1443
17 Ga0070668_100023598 3300005347 Bacteria 4654
18 Ga0070668_100182528 3300005347 Bacteria 1715
19 Ga0070675_100005384 3300005354 Bacteria 9783
20 Ga0070675_100043381 3300005354 Bacteria 3675
21 Ga0070671_100035464 3300005355 Bacteria 4132
22 Ga0070671_100146179 3300005355 Bacteria 1995
23 Ga0070673_100038792 3300005364 Bacteria 3640
24 Ga0070673_100106244 3300005364 Bacteria 2321
25 Ga0070659_100136760 3300005366 Bacteria 1993
26 Ga0070667_100302682 3300005367 Bacteria 1440
27 Ga0070667_100390872 3300005367 Bacteria 1265
28 Ga0070709_10042311 3300005434 Bacteria 2812
29 Ga0070714_100015651 3300005435 Bacteria 6105
30 Ga0070714_100036504 3300005435 Bacteria 4122
31 Ga0070714_100325864 3300005435 Bacteria 1437
32 Ga0070713_100010449 3300005436 Bacteria 6704
33 Ga0070701_10024707 3300005438 Bacteria 2909
34 Ga0070711_100187622 3300005439 Bacteria 1587
35 Ga0070705_100054337 3300005440 Bacteria 2349
36 Ga0070705_100105449 3300005440 Bacteria 1790
37 Ga0070700_100122568 3300005441 Bacteria 1744
38 Ga0070700_100245097 3300005441 Bacteria 1282
39 Ga0070663_100007546 3300005455 Bacteria 6627
40 Ga0070663_100057414 3300005455 Bacteria 2792
41 Ga0070663_100186574 3300005455 Bacteria 1612
42 Ga0070663_100193331 3300005455 Bacteria 1584
43 Ga0070678_100040375 3300005456 Bacteria 3302
44 Ga0070678_100100708 3300005456 Bacteria 2238
45 Ga0070678_100135495 3300005456 Bacteria 1963
46 Ga0070678_100445962 3300005456 Bacteria 1133
47 Ga0070662_100046219 3300005457 Bacteria 3128
48 Ga0070662_100122494 3300005457 Bacteria 1995
49 Ga0070681_10004201 3300005458 Bacteria 13643
50 Ga0070681_10018476 3300005458 Bacteria 6968
51 Ga0070681_10342075 3300005458 Bacteria 1406
52 Ga0070685_10026770 3300005466 Bacteria 3180
53 Ga0070685_10039015 3300005466 Bacteria 2696
54 Ga0070679_100111997 3300005530 Bacteria 2715
55 Ga0070679_100315792 3300005530 Bacteria 1512
56 Ga0070684_100041783 3300005535 Bacteria 3955
57 Ga0070684_100081265 3300005535 Bacteria 2867
58 Ga0070684_100104381 3300005535 Bacteria 2535
59 Ga0068853_100012990 3300005539 Bacteria 6789
60 Ga0070686_100357063 3300005544 Bacteria 1100
61 Ga0070665_100051114 3300005548 Bacteria 4146
62 Ga0070665_100075636 3300005548 Bacteria 3374
63 Ga0070665_100105433 3300005548 Bacteria 2821
64 Ga0070665_100180965 3300005548 Bacteria 2109
65 Ga0070704_100140042 3300005549 Bacteria 1887
66 Ga0068855_100219519 3300005563 Bacteria 2132
67 Ga0070664_100023388 3300005564 Bacteria 5103
68 Ga0070664_100420087 3300005564 Bacteria 1225
69 Ga0068857_100102440 3300005577 Bacteria 2569
70 Ga0068854_100073519 3300005578 Bacteria 2505
71 Ga0068856_100066637 3300005614 Bacteria 3557
72 Ga0070702_100115888 3300005615 Bacteria 1669
73 Ga0068852_100121089 3300005616 Bacteria 2396
74 Ga0068852_100183387 3300005616 Bacteria 1970
75 Ga0068859_100075295 3300005617 Bacteria 3416
76 Ga0068859_100428828 3300005617 Bacteria 1418
77 Ga0068864_100014736 3300005618 Bacteria 6494
78 Ga0068864_100172930 3300005618 Bacteria 1970
79 Ga0068861_100096650 3300005719 Bacteria 2341
80 Ga0068870_10001853 3300005840 Bacteria 8699
81 Ga0068863_100064802 3300005841 Bacteria 3456
82 Ga0068862_100281433 3300005844 Bacteria 1524
83 Ga0081455_10014945 3300005937 Bacteria 7562
84 Ga0081455_10035706 3300005937 Bacteria 4438
85 Ga0081540_1002567 3300005983 Bacteria 14736
86 Ga0081540_1012342 3300005983 Bacteria 5636
87 Ga0081540_1030483 3300005983 Bacteria 2986
88 Ga0070717_10028793 3300006028 Bacteria 4450
89 Ga0075432_10012930 3300006058 Bacteria 2836
90 Ga0075432_10020206 3300006058 Bacteria 2277
91 Ga0070716_100292748 3300006173 Bacteria 1129
92 Ga0070712_100009188 3300006175 Bacteria 6225
93 Ga0070712_100225515 3300006175 Bacteria 1485
94 Ga0068871_100018601 3300006358 Bacteria 5286
95 Ga0075428_100073841 3300006844 Bacteria 3725
96 Ga0075430_100006226 3300006846 Bacteria 10066
97 Ga0075430_100247019 3300006846 Bacteria 1479
98 Ga0075431_100026085 3300006847 Bacteria 5992
99 Ga0075431_100036609 3300006847 Bacteria 5054
100 Ga0075431_100421680 3300006847 Bacteria 1334
101 Ga0075433_10001181 3300006852 Bacteria 18990
102 Ga0075433_10032100 3300006852 Bacteria 4495
103 Ga0075434_100001152 3300006871 Bacteria 21846
104 Ga0075434_100011561 3300006871 Bacteria 8332
105 Ga0075434_100019484 3300006871 Bacteria 6567
106 Ga0075434_100073584 3300006871 Bacteria 3409
107 Ga0075436_100008639 3300006914 Bacteria 6963
108 Ga0075436_100051082 3300006914 Bacteria 2853
109 Ga0075436_100110945 3300006914 Bacteria 1914
110 Ga0097620_100075295 3300006931 Bacteria 3416
111 Ga0097620_100428842 3300006931 Bacteria 1418
112 Ga0075435_100000430 3300007076 Bacteria 25677
113 Ga0075435_100011622 3300007076 Bacteria 6489
114 Ga0105244_10084698 3300009036 Bacteria 1565
115 Ga0111539_10009937 3300009094 Bacteria 12001
116 Ga0111539_10041004 3300009094 Bacteria 5570
117 Ga0111539_10295721 3300009094 Bacteria 1884
118 Ga0105245_10061258 3300009098 Bacteria 3392
119 Ga0105245_10442142 3300009098 Bacteria 1307
120 Ga0105247_10064566 3300009101 Bacteria 2275
121 Ga0114129_10133259 3300009147 Bacteria 3411
122 Ga0114129_10535686 3300009147 Bacteria 1525
123 Ga0105241_10128982 3300009174 Bacteria 2045
124 Ga0105242_10075134 3300009176 Bacteria 2813
125 Ga0105248_10031371 3300009177 Bacteria 5941
126 Ga0105248_10123097 3300009177 Bacteria 2926
127 Ga0105237_10566480 3300009545 Bacteria 1143
128 Ga0105249_10009782 3300009553 Bacteria 8399
129 Ga0105239_10120161 3300010375 Bacteria 2917
130 Ga0105246_10004017 3300011119 Bacteria 8933
131 Ga0105246_10044393 3300011119 Bacteria 3021
132 Ga0105246_10189834 3300011119 Bacteria 1589
133 Ga0157373_10037512 3300013100 Bacteria 3474
134 Ga0157371_10045836 3300013102 Bacteria 3111
135 Ga0157370_10204883 3300013104 Bacteria 1829
136 Ga0157369_10000926 3300013105 Bacteria 37311
137 Ga0157369_10017095 3300013105 Bacteria 8150
138 Ga0157374_10028671 3300013296 Bacteria 5030
139 Ga0157374_10037231 3300013296 Bacteria 4463
140 Ga0163162_10232129 3300013306 Bacteria 1975
141 Ga0163162_10359371 3300013306 Bacteria 1589
142 Ga0163162_10590108 3300013306 Bacteria 1238
143 Ga0157372_10029942 3300013307 Bacteria 5949
144 Ga0157380_10146898 3300014326 Bacteria 2033
145 Ga0157379_10019892 3300014968 Bacteria 5931
146 Ga0157379_10279600 3300014968 Bacteria 1519
147 Ga0157376_10180769 3300014969 Bacteria 1928
148 Ga0157376_10309978 3300014969 Bacteria 1497
149 Ga0163161_10232891 3300017792 Bacteria 1430
150 Ga0206356_11122267 3300020070 Bacteria 2717
151 Ga0206356_11320489 3300020070 Bacteria 3492
152 Ga0206356_11498757 3300020070 Bacteria 3958
153 Ga0206349_1110273 3300020075 Bacteria 3979
154 Ga0206349_1530387 3300020075 Bacteria 1441
155 Ga0206351_10309671 3300020077 Bacteria 1440
156 Ga0206351_10908197 3300020077 Bacteria 1801
157 Ga0206352_10083294 3300020078 Bacteria 3743
158 Ga0206350_10030584 3300020080 Bacteria 2230
159 Ga0206350_10571440 3300020080 Bacteria 1740
160 Ga0206350_10886141 3300020080 Bacteria 1606
161 Ga0206350_11275337 3300020080 Bacteria 2112
162 Ga0206354_10524397 3300020081 Bacteria 3702
163 Ga0206354_10625737 3300020081 Bacteria 1768
164 Ga0206353_11315474 3300020082 Bacteria 1303
165 Ga0213876_10060842 3300021384 Bacteria 1992
166 Ga0213875_10000280 3300021388 Bacteria 50096
167 Ga0224712_10001097 3300022467 Bacteria 5982
168 Ga0224712_10003165 3300022467 Bacteria 4219
169 Ga0224712_10003266 3300022467 Bacteria 4179
170 Ga0224712_10010573 3300022467 Bacteria 2828
171 Ga0224712_10022190 3300022467 Bacteria 2184
172 Ga0224712_10056144 3300022467 Bacteria 1551
173 Ga0224572_1008914 3300024225 Bacteria 1863
174 Ga0207656_10027823 3300025321 Bacteria 2315
175 Ga0207692_10025216 3300025898 Bacteria 2774
176 Ga0207710_10035200 3300025900 Bacteria 2203
177 Ga0207710_10054682 3300025900 Bacteria 1798
178 Ga0207688_10002125 3300025901 Bacteria 10644
179 Ga0207688_10009265 3300025901 Bacteria 5365
180 Ga0207647_10123300 3300025904 Bacteria 1527
181 Ga0207699_10015242 3300025906 Bacteria 3988
182 Ga0207643_10000272 3300025908 Bacteria 36101
183 Ga0207643_10079334 3300025908 Bacteria 1900
184 Ga0207705_10033800 3300025909 Bacteria 3654
185 Ga0207705_10117286 3300025909 Bacteria 1972
186 Ga0207654_10031383 3300025911 Bacteria 2925
187 Ga0207707_10005491 3300025912 Bacteria 11084
188 Ga0207707_10318210 3300025912 Bacteria 1344
189 Ga0207695_10129593 3300025913 Bacteria 2481
190 Ga0207693_10012817 3300025915 Bacteria 6763
191 Ga0207693_10196775 3300025915 Bacteria 1585
192 Ga0207663_10062260 3300025916 Bacteria 2371
193 Ga0207663_10329021 3300025916 Bacteria 1150
194 Ga0207660_10014624 3300025917 Bacteria 5167
195 Ga0207662_10024054 3300025918 Bacteria 3505
196 Ga0207657_10018442 3300025919 Bacteria 6661
197 Ga0207649_10019310 3300025920 Bacteria 3893
198 Ga0207652_10017405 3300025921 Bacteria 5882
199 Ga0207650_10016646 3300025925 Bacteria 5139
200 Ga0207659_10002628 3300025926 Bacteria 10696
201 Ga0207659_10120901 3300025926 Bacteria 2007
202 Ga0207687_10017977 3300025927 Bacteria 4665
203 Ga0207687_10212134 3300025927 Bacteria 1520
204 Ga0207687_10237740 3300025927 Bacteria 1442
205 Ga0207700_10080947 3300025928 Bacteria 2534
206 Ga0207664_10128948 3300025929 Bacteria 2127
207 Ga0207644_10030697 3300025931 Bacteria 3739
208 Ga0207644_10123945 3300025931 Bacteria 1970
209 Ga0207690_10113025 3300025932 Bacteria 1959
210 Ga0207706_10016978 3300025933 Bacteria 6567
211 Ga0207706_10226172 3300025933 Bacteria 1637
212 Ga0207670_10058275 3300025936 Bacteria 2623
213 Ga0207670_10211797 3300025936 Bacteria 1478
214 Ga0207691_10097354 3300025940 Bacteria 2630
215 Ga0207691_10135619 3300025940 Bacteria 2171
216 Ga0207711_10169118 3300025941 Bacteria 1983
217 Ga0207711_10229073 3300025941 Bacteria 1701
218 Ga0207689_10005539 3300025942 Bacteria 11275
219 Ga0207689_10155806 3300025942 Bacteria 1883
220 Ga0207661_10012376 3300025944 Bacteria 6197
221 Ga0207661_10020785 3300025944 Bacteria 4912
222 Ga0207661_10047429 3300025944 Bacteria 3410
223 Ga0207661_10087117 3300025944 Bacteria 2593
224 Ga0207661_10096637 3300025944 Bacteria 2472
225 Ga0207679_10008711 3300025945 Bacteria 6470
226 Ga0207679_10114622 3300025945 Bacteria 2134
227 Ga0207667_10083233 3300025949 Bacteria 3313
228 Ga0207667_10185970 3300025949 Bacteria 2133
229 Ga0207651_10010784 3300025960 Bacteria 5081
230 Ga0207651_10110801 3300025960 Bacteria 2060
231 Ga0207712_10064075 3300025961 Bacteria 2619
232 Ga0207668_10021667 3300025972 Bacteria 4102
233 Ga0207640_10415158 3300025981 Bacteria 1100
234 Ga0207658_10082049 3300025986 Bacteria 2475
235 Ga0207639_10011282 3300026041 Bacteria 6200
236 Ga0207639_10019319 3300026041 Bacteria 4859
237 Ga0207678_10000085 3300026067 Bacteria 76854
238 Ga0207678_10246149 3300026067 Bacteria 1531
239 Ga0207708_10013218 3300026075 Bacteria 6163
240 Ga0207708_10286025 3300026075 Bacteria 1337
241 Ga0207702_10005959 3300026078 Bacteria 10588
242 Ga0207702_10014020 3300026078 Bacteria 6657
243 Ga0207702_10112638 3300026078 Bacteria 2421
244 Ga0207641_10031739 3300026088 Bacteria 4382
245 Ga0207641_10043882 3300026088 Bacteria 3758
246 Ga0207648_10135111 3300026089 Bacteria 2172
247 Ga0207648_10309663 3300026089 Bacteria 1417
248 Ga0207676_10009110 3300026095 Bacteria 7069
249 Ga0207674_10027261 3300026116 Bacteria 6048
250 Ga0207674_10080804 3300026116 Bacteria 3254
251 Ga0207674_10269267 3300026116 Bacteria 1651
252 Ga0207675_100134418 3300026118 Bacteria 2346
253 Ga0207675_100154993 3300026118 Bacteria 2183
254 Ga0207675_100202620 3300026118 Bacteria 1906
255 Ga0207683_10000055 3300026121 Bacteria 84901
256 Ga0207683_10091885 3300026121 Bacteria 2704
257 Ga0207683_10139305 3300026121 Bacteria 2185
258 Ga0207698_10010967 3300026142 Bacteria 5856
259 Ga0207698_10011320 3300026142 Bacteria 5777
260 Ga0207698_10164092 3300026142 Bacteria 1947
261 Ga0207428_10015563 3300027907 Bacteria 6575
262 Ga0207428_10019475 3300027907 Bacteria 5786
263 Ga0207428_10040108 3300027907 Bacteria 3800
264 Ga0207428_10161720 3300027907 Bacteria 1700
265 Ga0268266_10087486 3300028379 Bacteria 2726
266 Ga0268265_10067404 3300028380 Bacteria 2771
267 Ga0268265_10204054 3300028380 Bacteria 1717
268 Ga0268264_10198287 3300028381 Bacteria 1835
269 Ga0268264_10300593 3300028381 Bacteria 1511
270 Ga0307515_10000591 3300028794 Bacteria 84816
271 Ga0307515_10221864 3300028794 Bacteria 1706
272 Ga0265338_10000363 3300028800 Bacteria 81934
273 Ga0265338_10013249 3300028800 Bacteria 9329
274 Ga0265316_10024684 3300031344 Bacteria 5029
275 Ga0265316_10105824 3300031344 Bacteria 2134
276 Ga0307513_10002345 3300031456 Bacteria 26347
277 Ga0316575_10020220 3300031665 Bacteria 2553
278 Ga0316578_10056703 3300031728 Bacteria 2301
279 Ga0307516_10000462 3300031730 Bacteria 53659
280 Ga0307413_10066560 3300031824 Bacteria 2249
281 Ga0307410_10085347 3300031852 Bacteria 2228
282 Ga0307410_10089421 3300031852 Bacteria 2182
283 Ga0307414_10194207 3300032004 Bacteria 1645
284 Ga0307411_10044661 3300032005 Bacteria 2845
285 Ga0316583_10005170 3300032133 Bacteria 4679
286 Ga0316593_10051607 3300032168 Bacteria 1391
287 Ga0316586_1000406 3300033527 Bacteria 4117
288 Ga0316587_1004221 3300033529 Bacteria 2076
289 Ga0316596_1037748 3300033541 Bacteria 1264
290 Ga0316214_1001689 3300033545 Bacteria 2624
291 Ga0373923_0002226 3300035111 Bacteria 5905
292 Ga0373923_0073219 3300035111 Bacteria 1475
293 Ga0373953_0006530 3300035117 Bacteria 3849
294 Ga0373956_0014570 3300035119 Bacteria 3287
295 Ga0373957_0033627 3300035120 Bacteria 1894
296 Ga0316574_0019936 3300035398 Bacteria 3964
297 Ga0373935_0014488 3300035692 Bacteria 4758
298 Ga0373933_0004469 3300035724 Bacteria 7669
299 Ga0316582_0029221 3300036647 Bacteria 3347
300 Ga0316582_0217999 3300036647 Bacteria 1304
301 Ga0316584_0032971 3300036712 Bacteria 3834
302 Ga0395900_0120889 3300037418 Bacteria 2687
303 Ga0395898_0002776 3300037466 Bacteria 20131
304 Ga0395898_0130948 3300037466 Bacteria 2403
305 Ga0436364_0919152 3300037853 Bacteria 2486
306 Ga0436364_1341190 3300037853 Bacteria 236154
307 Ga0395901_0029862 3300038443 Bacteria 5614
308 Ga0436365_0334427 3300039437 Bacteria 5197
309 Ga0451789_0032208 3300041443 Bacteria 3080
310 Ga0451793_0030040 3300041452 Bacteria 12686
311 Ga0451797_1115352 3300041453 Bacteria 1376
312 Ga0451839_0236779 3300041496 Bacteria 1275
313 Ga0451841_0237529 3300041498 Bacteria 7098
314 Ga0451851_1320871 3300041507 Bacteria 1705
315 Ga0451843_0118424 3300041509 Bacteria 7658
316 Ga0451853_0450880 3300041512 Bacteria 5781
317 Ga0439448_0008180 3300042005 Bacteria 3056
318 Ga0439458_0013952 3300042157 Bacteria 1811
319 Ga0439459_0006401 3300042438 Bacteria 1961
320 Ga0439440_0035155 3300042993 Bacteria 1201
321 Ga0466972_0040491 3300044658 Bacteria 2270
322 Ga0466963_0010993 3300044694 Bacteria 5503
323 Ga0466968_0011387 3300044735 Bacteria 3463
324 Ga0466960_0021680 3300044901 Bacteria 2864
325 Ga0466959_0079753 3300045049 Bacteria 2360
326 Ga0466958_0344662 3300045836 Bacteria 959
327 Ga0466967_0015880 3300045976 Bacteria 5918
328 Ga0495592_0006249 3300046454 Bacteria 8862
329 Ga0495603_0047957 3300046455 Bacteria 2543
330 Ga0495603_0104275 3300046455 Bacteria 1655
331 Ga0495629_0007646 3300046459 Bacteria 7958
332 Ga0495638_0075549 3300046460 Bacteria 2053
333 Ga0495638_0182544 3300046460 Bacteria 1196
334 Ga0495651_0014677 3300046462 Bacteria 6058
335 Ga0495651_0075745 3300046462 Bacteria 2550
336 Ga0495582_0106588 3300046473 Bacteria 1572
337 Ga0495639_0087058 3300046475 Bacteria 1462
338 Ga0495585_0085288 3300046492 Bacteria 1707
339 Ga0495585_0091949 3300046492 Bacteria 1633
340 Ga0495594_0046950 3300046499 Bacteria 2372
341 Ga0495606_0001378 3300046507 Bacteria 32860
342 Ga0495608_0051094 3300046511 Bacteria 2741
343 Ga0495618_0016192 3300046514 Bacteria 4558
344 Ga0495628_0018212 3300046516 Bacteria 5823
345 Ga0495643_0002411 3300046522 Bacteria 14864
346 Ga0495648_0009360 3300046524 Bacteria 7605
347 Ga0495652_0042759 3300046529 Bacteria 3906
348 Ga0495652_0095546 3300046529 Bacteria 2422
349 Ga0495652_0117070 3300046529 Bacteria 2132
350 Ga0495640_0005145 3300046533 Bacteria 10395
351 Ga0495640_0039489 3300046533 Bacteria 3311
352 Ga0495587_0015410 3300046536 Bacteria 4774
353 Ga0495645_0013131 3300046543 Bacteria 5854
354 Ga0495668_0000259 3300046616 Bacteria 74862
355 Ga0495668_0015766 3300046616 Bacteria 4405
356 Ga0495668_0028818 3300046616 Bacteria 3138
357 Ga0495634_0127206 3300046642 Bacteria 1627
358 Ga0495625_0003277 3300046660 Bacteria 16357
359 Ga0495625_0034789 3300046660 Bacteria 3716
360 Ga0495635_0006142 3300046663 Bacteria 8379
361 Ga0495588_0017797 3300046674 Bacteria 3457
362 Ga0495657_0004887 3300046675 Bacteria 10674
363 Ga0495623_0035366 3300046679 Bacteria 3202
364 Ga0495646_0176776 3300046680 Bacteria 1173
365 Ga0495613_0261109 3300046689 Bacteria 1206
366 Ga0495624_0014418 3300046690 Bacteria 5364
367 Ga0495624_0200566 3300046690 Bacteria 1212
368 Ga0495670_0160817 3300046691 Bacteria 1180
369 Ga0495600_0002515 3300046809 Bacteria 10534
370 Ga0495600_0043220 3300046809 Bacteria 2938
371 Ga0495600_0167287 3300046809 Bacteria 1420
372 Ga0495581_0039554 3300047315 Bacteria 2730
373 Ga0495604_0012352 3300047317 Bacteria 6790
374 Ga0495604_0019070 3300047317 Bacteria 5493
375 Ga0495674_0025041 3300047319 Bacteria 5476
376 Ga0495674_0103000 3300047319 Bacteria 2427
377 Ga0495672_0002205 3300047320 Bacteria 18139
378 Ga0495672_0026724 3300047320 Bacteria 3678
379 Ga0495676_0014471 3300047321 Bacteria 7060
380 Ga0495676_0029978 3300047321 Bacteria 4624
381 Ga0495676_0203596 3300047321 Bacteria 1374
382 Ga0495680_0139248 3300047322 Bacteria 1776
383 Ga0495673_0030246 3300047469 Bacteria 2546
384 Ga0495686_0030384 3300047472 Bacteria 3509
385 Ga0495686_0120900 3300047472 Bacteria 1561
386 Ga0495602_0018715 3300048088 Bacteria 6903
387 Ga0495614_0045857 3300048089 Bacteria 1874
388 Ga0495614_0106900 3300048089 Bacteria 1227
389 Ga0495626_0001026 3300048091 Bacteria 24018
390 Ga0496100_0031015 3300048903 Bacteria 3320
391 Ga0496100_0214621 3300048903 Bacteria 1409
392 Ga0496101_0137921 3300048904 Bacteria 1857
393 Ga0496102_0040385 3300048905 Bacteria 4220
394 Ga0496102_0047188 3300048905 Bacteria 3913
395 Ga0496102_0053460 3300048905 Bacteria 3681
396 Ga0496102_0079680 3300048905 Bacteria 3016
397 Ga0496102_0142123 3300048905 Bacteria 2251
398 Ga0496102_0226216 3300048905 Bacteria 1764
399 Ga0496103_0155989 3300048906 Bacteria 1463
400 Ga0496104_0011609 3300048907 Bacteria 7895
401 Ga0496104_0013023 3300048907 Bacteria 7490
402 Ga0496104_0014360 3300048907 Bacteria 7154
403 Ga0496104_0098347 3300048907 Bacteria 2801
404 Ga0496105_0000927 3300048908 Bacteria 19975
405 Ga0496105_0034846 3300048908 Bacteria 4142
406 Ga0496106_0020841 3300048909 Bacteria 4864
407 Ga0496106_0047070 3300048909 Bacteria 3244
408 Ga0496106_0082233 3300048909 Bacteria 2475
409 Ga0496107_0150447 3300048910 Bacteria 1721
410 Ga0496108_0026896 3300048911 Bacteria 4747
411 Ga0496108_0042385 3300048911 Bacteria 3799
412 Ga0496108_0080932 3300048911 Bacteria 2752
413 Ga0496108_0472884 3300048911 Bacteria 1095
414 Ga0496109_0001511 3300048912 Bacteria 19346
415 Ga0496109_0067077 3300048912 Bacteria 3286
416 Ga0496109_0111227 3300048912 Bacteria 2547
417 Ga0496110_0003449 3300048913 Bacteria 12109
418 Ga0496110_0011802 3300048913 Bacteria 7171
419 Ga0496110_0062166 3300048913 Bacteria 3297
420 Ga0496111_0007346 3300048914 Bacteria 7212
421 Ga0496111_0008407 3300048914 Bacteria 6828
422 Ga0496111_0018397 3300048914 Bacteria 4840
423 Ga0496111_0155240 3300048914 Bacteria 1698
424 Ga0496112_0003978 3300048915 Bacteria 12380
425 Ga0496112_0062905 3300048915 Bacteria 3661
426 Ga0496113_0011810 3300048916 Bacteria 5849
427 Ga0496113_0063862 3300048916 Bacteria 2783
428 Ga0496113_0136061 3300048916 Bacteria 1931
429 Ga0496114_0034760 3300048917 Bacteria 4160
430 Ga0496114_0198342 3300048917 Bacteria 1757
431 Ga0496114_0218882 3300048917 Bacteria 1671
432 Ga0496115_0091549 3300048918 Bacteria 2485
433 Ga0496115_0106812 3300048918 Bacteria 2298
434 Ga0496117_0000174 3300048920 Bacteria 132648
435 Ga0496122_0032905 3300048925 Bacteria 4275
436 Ga0496123_0073882 3300048926 Bacteria 2113
437 Ga0496124_0104757 3300048927 Bacteria 2287
438 Ga0496125_0000626 3300048928 Bacteria 59339
439 Ga0501031_0027582 3300049568 Bacteria 3702
440 Ga0501031_0046642 3300049568 Bacteria 2825
441 Ga0501031_0070725 3300049568 Bacteria 2273
442 Ga0501031_0137996 3300049568 Bacteria 1593
443 Ga0501031_0280182 3300049568 Bacteria 1082
444 Ga0501032_0034512 3300049569 Bacteria 3462
445 Ga0501033_0081401 3300049570 Bacteria 2374
446 Ga0501034_0042162 3300049571 Bacteria 4619
447 Ga0501034_0521513 3300049571 Bacteria 1100
448 Ga0501036_0066730 3300049572 Bacteria 3044
449 Ga0501036_0072659 3300049572 Bacteria 2908
450 Ga0501036_0105330 3300049572 Bacteria 2385
451 Ga0501036_0282730 3300049572 Bacteria 1388
452 Ga0501037_0010114 3300049573 Bacteria 6922
453 Ga0501038_0008164 3300049574 Bacteria 9635
454 Ga0501038_0019423 3300049574 Bacteria 6124
455 Ga0501039_0022056 3300049575 Bacteria 4887
456 Ga0501040_0002787 3300049576 Bacteria 11263
457 Ga0501040_0037829 3300049576 Bacteria 3280
458 Ga0501041_0009739 3300049577 Bacteria 5662
459 Ga0501042_0021679 3300049578 Bacteria 4480
460 Ga0501042_0024525 3300049578 Bacteria 4231
461 Ga0501042_0049708 3300049578 Bacteria 2992
462 Ga0501042_0062708 3300049578 Bacteria 2656
463 Ga0501046_0028293 3300049580 Bacteria 4566
464 Ga0501047_0011530 3300049581 Bacteria 8366
465 Ga0501047_0063248 3300049581 Bacteria 3570
466 Ga0501047_0188719 3300049581 Bacteria 1925
467 Ga0501048_0005570 3300049582 Bacteria 9582
468 Ga0501068_0007149 3300049584 Bacteria 6180
469 Ga0501071_0015782 3300049587 Bacteria 5188
470 Ga0501071_0100724 3300049587 Bacteria 2129
471 Ga0501071_0122746 3300049587 Bacteria 1926
472 Ga0501071_0291955 3300049587 Bacteria 1235
473 Ga0501071_0317249 3300049587 Unclassified 1183
474 Ga0501072_0073004 3300049588 Bacteria 2712
475 Ga0501072_0117529 3300049588 Bacteria 2118
476 Ga0501072_0122385 3300049588 Bacteria 2073
477 Ga0501072_0123972 3300049588 Bacteria 2058
478 Ga0501075_0006385 3300049591 Bacteria 8115
479 Ga0501075_0046991 3300049591 Bacteria 3244
480 Ga0501075_0139360 3300049591 Bacteria 1848
481 Ga0501075_0337203 3300049591 Bacteria 1149
482 Ga0501076_0022931 3300049592 Bacteria 4804
483 Ga0501076_0076989 3300049592 Bacteria 2675
484 Ga0501076_0169419 3300049592 Bacteria 1780
485 Ga0501077_0094412 3300049593 Bacteria 1896
486 Ga0501077_0148005 3300049593 Bacteria 1490
487 Ga0501079_0025405 3300049741 Bacteria 4544
488 Ga0501079_0056528 3300049741 Bacteria 3028
489 Ga0501079_0081749 3300049741 Bacteria 2498
490 Ga0501079_0330970 3300049741 Bacteria 1193
491 Ga0501080_0049624 3300049742 Bacteria 3906
492 Ga0501081_0004636 3300049743 Bacteria 8833
493 Ga0501083_0000229 3300049744 Bacteria 35953
494 Ga0501083_0003466 3300049744 Bacteria 11030
495 Ga0501083_0220068 3300049744 Bacteria 1237
496 Ga0501035_0075833 3300049822 Bacteria 2974
497 Ga0501044_0003175 3300049823 Bacteria 18559
498 Ga0501044_0109417 3300049823 Bacteria 2772
499 Ga0501045_0006353 3300049824 Bacteria 8178
500 nmdc:mga05p37_167264_c1 3300050507 Bacteria 2683
501 nmdc:mga09592_142489_c1 3300050508 Bacteria 2066
502 nmdc:mga09592_83093_c1 3300050508 Bacteria 2729
503 nmdc:mga08y16_101788_c1 3300050511 Bacteria 2991
504 nmdc:mga08y16_53140_c1 3300050511 Bacteria 4237
505 nmdc:mga08y16_67399_c1 3300050511 Bacteria 3734
506 nmdc:mga08y16_85269_c1 3300050511 Bacteria 3292
507 nmdc:mga08y16_93422_c1 3300050511 Bacteria 3134
508 nmdc:mga0n895_13779_c1 3300050512 Bacteria 7312
509 nmdc:mga0n895_221102_c1 3300050512 Bacteria 1923
510 nmdc:mga0n895_2361_c1 3300050512 Bacteria 14715
511 nmdc:mga0rr50_21320_c1 3300050513 Bacteria 4421
512 nmdc:mga0rr50_49518_c1 3300050513 Bacteria 3110
513 nmdc:mga08x19_51648_c1 3300050514 Bacteria 2642
514 nmdc:mga0a205_41605_c1 3300050515 Bacteria 4426
515 nmdc:mga0a205_49752_c1 3300050515 Bacteria 4047
516 nmdc:mga0a205_6275_c1 3300050515 Bacteria 10731
517 Ga0495612_0016832 3300053078 Bacteria 2929
518 Ga0495612_0017755 3300053078 Bacteria 2849
519 Ga0500635_0000472 3300053080 Bacteria 11439
520 Ga0500643_005509 3300053087 Bacteria 5444
521 Ga0500643_008819 3300053087 Bacteria 3919
522 Ga0500556_0000079 3300053104 Bacteria 91775
523 Ga0500642_0000001 3300053130 Bacteria 1468402
524 Ga0500573_0086842 3300053140 Bacteria 1772
525 Ga0500616_0000010 3300053153 Bacteria 761410
526 Ga0500616_0008517 3300053153 Bacteria 6358
527 Ga0500645_003751 3300053730 Bacteria 6057
528 Ga0501084_0030543 3300054114 Bacteria 4505
529 Ga0501084_0122584 3300054114 Bacteria 2186
530 Ga0501084_0416954 3300054114 Bacteria 1135
531 Ga0587090_011067 3300059510 Bacteria 1262
532 Ga0501082_0010154 3300060353 Bacteria 8109
533 Ga0501082_0020041 3300060353 Bacteria 5763
534 Ga0501082_0033531 3300060353 Bacteria 4431
535 Ga0501082_0087970 3300060353 Bacteria 2681
536 Ga0530510_0006472 3300061734 Bacteria 8157
537 Ga0530510_0010097 3300061734 Bacteria 6617
538 Ga0530510_0342316 3300061734 Bacteria 1123
539 2643887697 2643221575 Bacteria 4022601
540 2644095513 2643221616 Bacteria 4066575
541 2644183382 2643221632 Bacteria 3406696
542 2644455607 2643221681 Bacteria 3707866
543 2644506251 2643221690 Bacteria 4654705
544 2644526245 2643221694 Bacteria 4392972
545 2644670920 2643221722 Bacteria 4247614
546 2676481009 2675903059 Bacteria 8644972
547 2810363214 2808606700 Bacteria 3482157
548 2816422583 2816332119 Bacteria 8120218
549 2837272262 2837268691 Bacteria 7850704
550 2887480047 2887478801 Bacteria 8972725
551 2896185641 2896184354 Bacteria 3258548
552 2896256373 2896253425 Bacteria 3418029
553 2905928472 2905926851 Bacteria 4423176
554 2909077433 2909074476 Bacteria 3436050
555 2912758279 2912757875 Bacteria 7940295
556 2929213597 2929212328 Bacteria 7708288
557 2939588074 2939582691 Bacteria 7088898
558 2939660302 2939657138 Bacteria 3740283
559 2946003572 2946003308 Bacteria 3857229
560 8001788658 8001781756 Bacteria 9586736
561 8057346527 8057345674 Bacteria 4160394
562 Ga0495592_0004026
563 Ga0065714_10080967
564 Ga0070658_10102568
565 Ga0070658_10296537
566 Ga0070683_100017307
567 Ga0070683_100112825
568 Ga0070690_100235314
569 Ga0068869_100058366
570 Ga0068869_100089919
571 Ga0070682_100014644
572 Ga0070682_100032623
573 Ga0070660_100084106
574 Ga0070660_100376862
575 Ga0070689_100038801
576 Ga0070691_10000828
577 Ga0070687_100131896
578 Ga0070668_100023598
579 Ga0070668_100182528
580 Ga0070675_100005384
581 Ga0070675_100043381
582 Ga0070671_100035464
583 Ga0070671_100146179
584 Ga0070673_100038792
585 Ga0070673_100106244
586 Ga0070659_100136760
587 Ga0070667_100302682
588 Ga0070667_100390872
589 Ga0070709_10042311
590 Ga0070714_100015651
591 Ga0070714_100036504
592 Ga0070714_100325864
593 Ga0070713_100010449
594 Ga0070701_10024707
595 Ga0070711_100187622
596 Ga0070705_100054337
597 Ga0070705_100105449
598 Ga0070700_100122568
599 Ga0070700_100245097
600 Ga0070663_100007546
601 Ga0070663_100057414
602 Ga0070663_100186574
603 Ga0070663_100193331
604 Ga0070678_100040375
605 Ga0070678_100100708
606 Ga0070678_100135495
607 Ga0070678_100445962
608 Ga0070662_100046219
609 Ga0070662_100122494
610 Ga0070681_10004201
611 Ga0070681_10018476
612 Ga0070681_10342075
613 Ga0070685_10026770
614 Ga0070685_10039015
615 Ga0070679_100111997
616 Ga0070679_100315792
617 Ga0070684_100041783
618 Ga0070684_100081265
619 Ga0070684_100104381
620 Ga0068853_100012990
621 Ga0070686_100357063
622 Ga0070665_100051114
623 Ga0070665_100075636
624 Ga0070665_100105433
625 Ga0070665_100180965
626 Ga0070704_100140042
627 Ga0068855_100219519
628 Ga0070664_100023388
629 Ga0070664_100420087
630 Ga0068857_100102440
631 Ga0068854_100073519
632 Ga0068856_100066637
633 Ga0070702_100115888
634 Ga0068852_100121089
635 Ga0068852_100183387
636 Ga0068859_100075295
637 Ga0068859_100428828
638 Ga0068864_100014736
639 Ga0068864_100172930
640 Ga0068861_100096650
641 Ga0068870_10001853
642 Ga0068863_100064802
643 Ga0068862_100281433
644 Ga0081455_10014945
645 Ga0081455_10035706
646 Ga0081540_1002567
647 Ga0081540_1012342
648 Ga0081540_1030483
649 Ga0070717_10028793
650 Ga0075432_10012930
651 Ga0075432_10020206
652 Ga0070716_100292748
653 Ga0070712_100009188
654 Ga0070712_100225515
655 Ga0068871_100018601
656 Ga0075428_100073841
657 Ga0075430_100006226
658 Ga0075430_100247019
659 Ga0075431_100026085
660 Ga0075431_100036609
661 Ga0075431_100421680
662 Ga0075433_10001181
663 Ga0075433_10032100
664 Ga0075434_100001152
665 Ga0075434_100011561
666 Ga0075434_100019484
667 Ga0075434_100073584
668 Ga0075436_100008639
669 Ga0075436_100051082
670 Ga0075436_100110945
671 Ga0097620_100075295
672 Ga0097620_100428842
673 Ga0075435_100000430
674 Ga0075435_100011622
675 Ga0105244_10084698
676 Ga0111539_10009937
677 Ga0111539_10041004
678 Ga0111539_10295721
679 Ga0105245_10061258
680 Ga0105245_10442142
681 Ga0105247_10064566
682 Ga0114129_10133259
683 Ga0114129_10535686
684 Ga0105241_10128982
685 Ga0105242_10075134
686 Ga0105248_10031371
687 Ga0105248_10123097
688 Ga0105237_10566480
689 Ga0105249_10009782
690 Ga0105239_10120161
691 Ga0105246_10004017
692 Ga0105246_10044393
693 Ga0105246_10189834
694 Ga0157373_10037512
695 Ga0157371_10045836
696 Ga0157370_10204883
697 Ga0157369_10000926
698 Ga0157369_10017095
699 Ga0157374_10028671
700 Ga0157374_10037231
701 Ga0163162_10232129
702 Ga0163162_10359371
703 Ga0163162_10590108
704 Ga0157372_10029942
705 Ga0157380_10146898
706 Ga0157379_10019892
707 Ga0157379_10279600
708 Ga0157376_10180769
709 Ga0157376_10309978
710 Ga0163161_10232891
711 Ga0206356_11122267
712 Ga0206356_11320489
713 Ga0206356_11498757
714 Ga0206349_1110273
715 Ga0206349_1530387
716 Ga0206351_10309671
717 Ga0206351_10908197
718 Ga0206352_10083294
719 Ga0206350_10030584
720 Ga0206350_10571440
721 Ga0206350_10886141
722 Ga0206350_11275337
723 Ga0206354_10524397
724 Ga0206354_10625737
725 Ga0206353_11315474
726 Ga0213876_10060842
727 Ga0213875_10000280
728 Ga0224712_10001097
729 Ga0224712_10003165
730 Ga0224712_10003266
731 Ga0224712_10010573
732 Ga0224712_10022190
733 Ga0224712_10056144
734 Ga0224572_1008914
735 Ga0207656_10027823
736 Ga0207692_10025216
737 Ga0207710_10035200
738 Ga0207710_10054682
739 Ga0207688_10002125
740 Ga0207688_10009265
741 Ga0207647_10123300
742 Ga0207699_10015242
743 Ga0207643_10000272
744 Ga0207643_10079334
745 Ga0207705_10033800
746 Ga0207705_10117286
747 Ga0207654_10031383
748 Ga0207707_10005491
749 Ga0207707_10318210
750 Ga0207695_10129593
751 Ga0207693_10012817
752 Ga0207693_10196775
753 Ga0207663_10062260
754 Ga0207663_10329021
755 Ga0207660_10014624
756 Ga0207662_10024054
757 Ga0207657_10018442
758 Ga0207649_10019310
759 Ga0207652_10017405
760 Ga0207650_10016646
761 Ga0207659_10002628
762 Ga0207659_10120901
763 Ga0207687_10017977
764 Ga0207687_10212134
765 Ga0207687_10237740
766 Ga0207700_10080947
767 Ga0207664_10128948
768 Ga0207644_10030697
769 Ga0207644_10123945
770 Ga0207690_10113025
771 Ga0207706_10016978
772 Ga0207706_10226172
773 Ga0207670_10058275
774 Ga0207670_10211797
775 Ga0207691_10097354
776 Ga0207691_10135619
777 Ga0207711_10169118
778 Ga0207711_10229073
779 Ga0207689_10005539
780 Ga0207689_10155806
781 Ga0207661_10012376
782 Ga0207661_10020785
783 Ga0207661_10047429
784 Ga0207661_10087117
785 Ga0207661_10096637
786 Ga0207679_10008711
787 Ga0207679_10114622
788 Ga0207667_10083233
789 Ga0207667_10185970
790 Ga0207651_10010784
791 Ga0207651_10110801
792 Ga0207712_10064075
793 Ga0207668_10021667
794 Ga0207640_10415158
795 Ga0207658_10082049
796 Ga0207639_10011282
797 Ga0207639_10019319
798 Ga0207678_10000085
799 Ga0207678_10246149
800 Ga0207708_10013218
801 Ga0207708_10286025
802 Ga0207702_10005959
803 Ga0207702_10014020
804 Ga0207702_10112638
805 Ga0207641_10031739
806 Ga0207641_10043882
807 Ga0207648_10135111
808 Ga0207648_10309663
809 Ga0207676_10009110
810 Ga0207674_10027261
811 Ga0207674_10080804
812 Ga0207674_10269267
813 Ga0207675_100134418
814 Ga0207675_100154993
815 Ga0207675_100202620
816 Ga0207683_10000055
817 Ga0207683_10091885
818 Ga0207683_10139305
819 Ga0207698_10010967
820 Ga0207698_10011320
821 Ga0207698_10164092
822 Ga0207428_10015563
823 Ga0207428_10019475
824 Ga0207428_10040108
825 Ga0207428_10161720
826 Ga0268266_10087486
827 Ga0268265_10067404
828 Ga0268265_10204054
829 Ga0268264_10198287
830 Ga0268264_10300593
831 Ga0307515_10000591
832 Ga0307515_10221864
833 Ga0265338_10000363
834 Ga0265338_10013249
835 Ga0265316_10024684
836 Ga0265316_10105824
837 Ga0307513_10002345
838 Ga0316575_10020220
839 Ga0316578_10056703
840 Ga0307516_10000462
841 Ga0307413_10066560
842 Ga0307410_10085347
843 Ga0307410_10089421
844 Ga0307414_10194207
845 Ga0307411_10044661
846 Ga0316583_10005170
847 Ga0316593_10051607
848 Ga0316586_1000406
849 Ga0316587_1004221
850 Ga0316596_1037748
851 Ga0316214_1001689
852 Ga0373923_0002226
853 Ga0373923_0073219
854 Ga0373953_0006530
855 Ga0373956_0014570
856 Ga0373957_0033627
857 Ga0316574_0019936
858 Ga0373935_0014488
859 Ga0373933_0004469
860 Ga0316582_0029221
861 Ga0316582_0217999
862 Ga0316584_0032971
863 Ga0395900_0120889
864 Ga0395898_0002776
865 Ga0395898_0130948
866 Ga0436364_0919152
867 Ga0436364_1341190
868 Ga0395901_0029862
869 Ga0436365_0334427
870 Ga0451789_0032208
871 Ga0451793_0030040
872 Ga0451797_1115352
873 Ga0451839_0236779
874 Ga0451841_0237529
875 Ga0451851_1320871
876 Ga0451843_0118424
877 Ga0451853_0450880
878 Ga0439448_0008180
879 Ga0439458_0013952
880 Ga0439459_0006401
881 Ga0439440_0035155
882 Ga0466972_0040491
883 Ga0466963_0010993
884 Ga0466968_0011387
885 Ga0466960_0021680
886 Ga0466959_0079753
887 Ga0466958_0344662
888 Ga0466967_0015880
889 Ga0495592_0006249
890 Ga0495603_0047957
891 Ga0495603_0104275
892 Ga0495629_0007646
893 Ga0495638_0075549
894 Ga0495638_0182544
895 Ga0495651_0014677
896 Ga0495651_0075745
897 Ga0495582_0106588
898 Ga0495639_0087058
899 Ga0495585_0085288
900 Ga0495585_0091949
901 Ga0495594_0046950
902 Ga0495606_0001378
903 Ga0495608_0051094
904 Ga0495618_0016192
905 Ga0495628_0018212
906 Ga0495643_0002411
907 Ga0495648_0009360
908 Ga0495652_0042759
909 Ga0495652_0095546
910 Ga0495652_0117070
911 Ga0495640_0005145
912 Ga0495640_0039489
913 Ga0495587_0015410
914 Ga0495645_0013131
915 Ga0495668_0000259
916 Ga0495668_0015766
917 Ga0495668_0028818
918 Ga0495634_0127206
919 Ga0495625_0003277
920 Ga0495625_0034789
921 Ga0495635_0006142
922 Ga0495588_0017797
923 Ga0495657_0004887
924 Ga0495623_0035366
925 Ga0495646_0176776
926 Ga0495613_0261109
927 Ga0495624_0014418
928 Ga0495624_0200566
929 Ga0495670_0160817
930 Ga0495600_0002515
931 Ga0495600_0043220
932 Ga0495600_0167287
933 Ga0495581_0039554
934 Ga0495604_0012352
935 Ga0495604_0019070
936 Ga0495674_0025041
937 Ga0495674_0103000
938 Ga0495672_0002205
939 Ga0495672_0026724
940 Ga0495676_0014471
941 Ga0495676_0029978
942 Ga0495676_0203596
943 Ga0495680_0139248
944 Ga0495673_0030246
945 Ga0495686_0030384
946 Ga0495686_0120900
947 Ga0495602_0018715
948 Ga0495614_0045857
949 Ga0495614_0106900
950 Ga0495626_0001026
951 Ga0496100_0031015
952 Ga0496100_0214621
953 Ga0496101_0137921
954 Ga0496102_0040385
955 Ga0496102_0047188
956 Ga0496102_0053460
957 Ga0496102_0079680
958 Ga0496102_0142123
959 Ga0496102_0226216
960 Ga0496103_0155989
961 Ga0496104_0011609
962 Ga0496104_0013023
963 Ga0496104_0014360
964 Ga0496104_0098347
965 Ga0496105_0000927
966 Ga0496105_0034846
967 Ga0496106_0020841
968 Ga0496106_0047070
969 Ga0496106_0082233
970 Ga0496107_0150447
971 Ga0496108_0026896
972 Ga0496108_0042385
973 Ga0496108_0080932
974 Ga0496108_0472884
975 Ga0496109_0001511
976 Ga0496109_0067077
977 Ga0496109_0111227
978 Ga0496110_0003449
979 Ga0496110_0011802
980 Ga0496110_0062166
981 Ga0496111_0007346
982 Ga0496111_0008407
983 Ga0496111_0018397
984 Ga0496111_0155240
985 Ga0496112_0003978
986 Ga0496112_0062905
987 Ga0496113_0011810
988 Ga0496113_0063862
989 Ga0496113_0136061
990 Ga0496114_0034760
991 Ga0496114_0198342
992 Ga0496114_0218882
993 Ga0496115_0091549
994 Ga0496115_0106812
995 Ga0496117_0000174
996 Ga0496122_0032905
997 Ga0496123_0073882
998 Ga0496124_0104757
999 Ga0496125_0000626
1000 Ga0501031_0027582
1001 Ga0501031_0046642
1002 Ga0501031_0070725
1003 Ga0501031_0137996
1004 Ga0501031_0280182
1005 Ga0501032_0034512
1006 Ga0501033_0081401
1007 Ga0501034_0042162
1008 Ga0501034_0521513
1009 Ga0501036_0066730
1010 Ga0501036_0072659
1011 Ga0501036_0105330
1012 Ga0501036_0282730
1013 Ga0501037_0010114
1014 Ga0501038_0008164
1015 Ga0501038_0019423
1016 Ga0501039_0022056
1017 Ga0501040_0002787
1018 Ga0501040_0037829
1019 Ga0501041_0009739
1020 Ga0501042_0021679
1021 Ga0501042_0024525
1022 Ga0501042_0049708
1023 Ga0501042_0062708
1024 Ga0501046_0028293
1025 Ga0501047_0011530
1026 Ga0501047_0063248
1027 Ga0501047_0188719
1028 Ga0501048_0005570
1029 Ga0501068_0007149
1030 Ga0501071_0015782
1031 Ga0501071_0100724
1032 Ga0501071_0122746
1033 Ga0501071_0291955
1034 Ga0501071_0317249
1035 Ga0501072_0073004
1036 Ga0501072_0117529
1037 Ga0501072_0122385
1038 Ga0501072_0123972
1039 Ga0501075_0006385
1040 Ga0501075_0046991
1041 Ga0501075_0139360
1042 Ga0501075_0337203
1043 Ga0501076_0022931
1044 Ga0501076_0076989
1045 Ga0501076_0169419
1046 Ga0501077_0094412
1047 Ga0501077_0148005
1048 Ga0501079_0025405
1049 Ga0501079_0056528
1050 Ga0501079_0081749
1051 Ga0501079_0330970
1052 Ga0501080_0049624
1053 Ga0501081_0004636
1054 Ga0501083_0000229
1055 Ga0501083_0003466
1056 Ga0501083_0220068
1057 Ga0501035_0075833
1058 Ga0501044_0003175
1059 Ga0501044_0109417
1060 Ga0501045_0006353
1061 nmdc:mga05p37_167264_c1
1062 nmdc:mga09592_142489_c1
1063 nmdc:mga09592_83093_c1
1064 nmdc:mga08y16_101788_c1
1065 nmdc:mga08y16_53140_c1
1066 nmdc:mga08y16_67399_c1
1067 nmdc:mga08y16_85269_c1
1068 nmdc:mga08y16_93422_c1
1069 nmdc:mga0n895_13779_c1
1070 nmdc:mga0n895_221102_c1
1071 nmdc:mga0n895_2361_c1
1072 nmdc:mga0rr50_21320_c1
1073 nmdc:mga0rr50_49518_c1
1074 nmdc:mga08x19_51648_c1
1075 nmdc:mga0a205_41605_c1
1076 nmdc:mga0a205_49752_c1
1077 nmdc:mga0a205_6275_c1
1078 Ga0495612_0016832
1079 Ga0495612_0017755
1080 Ga0500635_0000472
1081 Ga0500643_005509
1082 Ga0500643_008819
1083 Ga0500556_0000079
1084 Ga0500642_0000001
1085 Ga0500573_0086842
1086 Ga0500616_0000010
1087 Ga0500616_0008517
1088 Ga0500645_003751
1089 Ga0501084_0030543
1090 Ga0501084_0122584
1091 Ga0501084_0416954
1092 Ga0587090_011067
1093 Ga0501082_0010154
1094 Ga0501082_0020041
1095 Ga0501082_0033531
1096 Ga0501082_0087970
1097 Ga0530510_0006472
1098 Ga0530510_0010097
1099 Ga0530510_0342316
1100 2643887697
1101 2644095513
1102 2644183382
1103 2644455607
1104 2644506251
1105 2644526245
1106 2644670920
1107 2676481009
1108 2810363214
1109 2816422583
1110 2837272262
1111 2887480047
1112 2896185641
1113 2896256373
1114 2905928472
1115 2909077433
1116 2912758279
1117 2929213597
1118 2939588074
1119 2939660302
1120 2946003572
1121 8001788658
1122 8057346527

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02733

Dak1

Dak1 domain

41

352

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ct4-assembly1.cif.gz_A structure of dha-kinase subunit dhak from l. lactis 0.9308 2 327
4lry-assembly1.cif.gz_B crystal structure of the e.coli dhar(n)-dhak(t79l) complex 0.9278 1 331
4lry-assembly1.cif.gz_B crystal structure of the e.coli dhar(n)-dhak(t79l) complex 0.9251 1 331
3pnk-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak 0.9232 2 331
2iu4-assembly1.cif.gz_A dihydroxyacetone kinase operon co-activator dha-dhaq 0.9225 14 324
ID Description Score Start End Superfamily
3ct4A02 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 0.9265 186 325 3.30.1180.20
af_Q2G1Z0_180_322_3.30.1180.20 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 0.9215 186 323 3.30.1180.20
af_Q2G1Z0_14_178_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.9173 14 182 3.40.50.10440
af_Q55EE0_214_393_3.30.1180.20 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 0.9124 186 323 3.30.1180.20
af_P76015_11_183_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.9073 12 183 3.40.50.10440
ID Description Score Start End GO Terms
AF-X1QDC1-F1-model_v4 DhaK domain-containing protein 0.9757 226 325 GO:0004371
GO:0005829
GO:0019563
AF-A0A424Y9I4-F1-model_v4 deleted 0.9739 225 326
AF-A0A353C4Q3-F1-model_v4 Dihydroxyacetone kinase 0.9689 231 325 GO:0004371
GO:0005829
GO:0019563
AF-A0A349S427-F1-model_v4 Dihydroxyacetone kinase subunit DhaK 0.9688 236 325 GO:0004371
GO:0005829
GO:0019563
AF-X1QDC1-F1-model_v4 DhaK domain-containing protein 0.9662 226 325 GO:0004371
GO:0005829
GO:0019563

Map