F463819

General Info

Members Datasets Scaffolds Average Seq Length
561 370 440 278

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10011135|Ga0105249_100111351
Length 321
Sequence MRSDAQGVHGRGRKSMKRGLAAIVAPSWQIDSGRKPHRSTELQERANMTAKTTLVLGGTGKTGRRIAEQLAARKVPVRIGSRSATPAFDWDNRSSWAAALANVDAVYISYYPDLAAPGATDAIRAFSDLAVRSGVRRLVLLSGRGEQEAQRCEEIVKQSGVQWTVLRCSWFNQNFSENYLLEPILAGEVALPAPNVGEPFVDADDIADVAVAALTDDKHAGKLYELTGPRLLTFADAIAEIARASGREIRYVQVSMDDYVVALEQAQLPPQFVGLIKYLFTEVLDGRNAHLTDGVQRALGRAPRDFTEYARRAAASGAWKG

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
7 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2643221591 Devosia sp. Root685 Isolate Unclassified
10 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
11 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2738541278 Niastella sp. CF465 Isolate Unclassified
13 2738541283 Pedobacter sp. OK701 Isolate Unclassified
14 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
15 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
16 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
17 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
18 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
19 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
20 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
21 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
22 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
23 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
24 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
25 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
26 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
27 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
28 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
29 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
30 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
31 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
32 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
33 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
34 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
35 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
36 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
37 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
38 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
39 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
40 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
41 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
42 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
43 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
44 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
45 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
46 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
47 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
48 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
49 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
50 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
51 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
52 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
53 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
54 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
55 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
56 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
57 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
58 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
59 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
60 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
61 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
62 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
63 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
64 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
65 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
66 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
67 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
68 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
69 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
70 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
71 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
72 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
73 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
74 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
75 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
76 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
77 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
78 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
79 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
80 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
81 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
82 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
83 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
84 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
85 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
86 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
87 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
88 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
89 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
90 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
91 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
92 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
93 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
94 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
95 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
96 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
97 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
98 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
99 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
100 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
101 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
102 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
103 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
104 3004167301 Mesorhizobium loti 582 Isolate Unclassified
105 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
106 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
107 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
108 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
109 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
110 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
111 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
112 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
115 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
116 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
117 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
118 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
119 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
120 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
121 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
124 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
125 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
126 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
127 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
128 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
129 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
130 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
131 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
132 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
133 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
134 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
135 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
136 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
137 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
138 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
139 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
140 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
141 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
142 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
143 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
144 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
145 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
146 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
147 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
148 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
149 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
150 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
151 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
152 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
153 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
154 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
155 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
156 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
157 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
158 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
159 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
160 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
161 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
162 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
163 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
164 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
165 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
166 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
167 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
168 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
169 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
170 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
171 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
172 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
173 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
174 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
175 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
176 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
177 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
178 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
179 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
180 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
181 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
182 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
183 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
184 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
185 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
186 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
187 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
188 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
189 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
192 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
193 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
194 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
195 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
196 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
197 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
198 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
199 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
200 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
201 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
202 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
203 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
204 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
205 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
206 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
207 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
208 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
209 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
210 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
212 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
213 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
215 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
258 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
259 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
260 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
261 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
262 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
263 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
264 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
265 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
266 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
267 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
268 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
272 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
273 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
274 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
275 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
276 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
277 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
278 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
285 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
286 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
287 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
288 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
289 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
292 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
293 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
296 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
297 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
298 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
299 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
351 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
352 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
356 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
357 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
361 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
362 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
363 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
364 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
365 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
366 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
367 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
368 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
369 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
370 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.25
Metatranscriptomes 0
Isolates 21.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 15.51
Rhizoplane 3.57
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 9.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1002552 3300002705 Bacteria 6461
2 JGI25165J46597_1000026 3300003214 Bacteria 332550
3 rootH2_10104731 3300003320 Bacteria 11033
4 rootL2_10180492 3300003322 Bacteria 5802
5 rootH1_10012489 3300003323 Bacteria 43167
6 rootH1_10021689 3300003316 Bacteria 3758
7 rootH1_10021689 3300003323 Bacteria 15210
8 rootH1_10187891 3300003323 Unclassified 1734
9 rootH1_10227275 3300003323 Bacteria 2515
10 JGI25407J50210_10004157 3300003373 Bacteria 3521
11 JGI25407J50210_10011663 3300003373 Bacteria 2248
12 JGI25407J50210_10022204 3300003373 Bacteria 1650
13 Ga0055542_1000473 3300003762 Bacteria 37513
14 Ga0055529_1001655 3300003763 Bacteria 5854
15 Ga0065712_10082544 3300005290 Bacteria 2907
16 Ga0065715_10128603 3300005293 Bacteria 2061
17 Ga0070658_10076306 3300005327 Bacteria 2749
18 Ga0070676_10010283 3300005328 Bacteria 5075
19 Ga0070683_100067103 3300005329 Bacteria 3341
20 Ga0070683_100137070 3300005329 Bacteria 2318
21 Ga0070690_100006140 3300005330 Bacteria 6802
22 Ga0070670_100009861 3300005331 Bacteria 8155
23 Ga0068869_100002787 3300005334 Bacteria 10594
24 Ga0068869_100028738 3300005334 Bacteria 3889
25 Ga0070680_100189436 3300005336 Bacteria 1733
26 Ga0070682_100127922 3300005337 Bacteria 1715
27 Ga0068868_100049635 3300005338 Bacteria 3294
28 Ga0068868_100049640 3300005338 Bacteria 3293
29 Ga0070660_100125724 3300005339 Bacteria 2049
30 Ga0070660_100140145 3300005339 Bacteria 1940
31 Ga0070689_100075146 3300005340 Bacteria 2645
32 Ga0070687_100018497 3300005343 Bacteria 3225
33 Ga0070661_100007403 3300005344 Bacteria 7565
34 Ga0070668_100005944 3300005347 Bacteria 9047
35 Ga0070669_100011049 3300005353 Bacteria 6406
36 Ga0070669_100020002 3300005353 Bacteria 4781
37 Ga0070675_100002518 3300005354 Bacteria 13713
38 Ga0070674_100088685 3300005356 Bacteria 2227
39 Ga0070674_100092916 3300005356 Bacteria 2182
40 Ga0070674_100165844 3300005356 Bacteria 1680
41 Ga0070674_100389487 3300005356 Bacteria 1136
42 Ga0070673_100025386 3300005364 Bacteria 4361
43 Ga0070688_100004849 3300005365 Bacteria 7036
44 Ga0070667_100082885 3300005367 Bacteria 2746
45 Ga0070667_100334346 3300005367 Bacteria 1369
46 Ga0070713_100040187 3300005436 Bacteria 3802
47 Ga0070701_10020022 3300005438 Bacteria 3169
48 Ga0070705_100088107 3300005440 Bacteria 1926
49 Ga0070700_100022039 3300005441 Unclassified 3710
50 Ga0070694_100400832 3300005444 Bacteria 1074
51 Ga0070663_100132341 3300005455 Bacteria 1895
52 Ga0070678_100071123 3300005456 Bacteria 2604
53 Ga0070662_100039171 3300005457 Bacteria 3371
54 Ga0070662_100039549 3300005457 Bacteria 3354
55 Ga0070681_10160932 3300005458 Bacteria 2169
56 Ga0068867_100100155 3300005459 Bacteria 2212
57 Ga0070685_10009455 3300005466 Bacteria 5038
58 Ga0070698_100003228 3300005471 Bacteria 17962
59 Ga0070698_100072879 3300005471 Bacteria 3441
60 Ga0070699_100147370 3300005518 Bacteria 2080
61 Ga0070684_100010188 3300005535 Bacteria 7436
62 Ga0070672_100010935 3300005543 Bacteria 6314
63 Ga0070672_100173110 3300005543 Bacteria 1796
64 Ga0070686_100007507 3300005544 Bacteria 6085
65 Ga0070695_100169473 3300005545 Bacteria 1539
66 Ga0070665_100012693 3300005548 Bacteria 8483
67 Ga0070665_100039829 3300005548 Bacteria 4723
68 Ga0070665_100412923 3300005548 Bacteria 1358
69 Ga0068855_100340500 3300005563 Bacteria 1654
70 Ga0070664_100005964 3300005564 Bacteria 9847
71 Ga0068857_100035283 3300005577 Bacteria 4429
72 Ga0068857_100185146 3300005577 Unclassified 1895
73 Ga0068854_100019648 3300005578 Bacteria 4556
74 Ga0068856_100370172 3300005614 Unclassified 1452
75 Ga0070702_100085373 3300005615 Bacteria 1901
76 Ga0068852_100255914 3300005616 Bacteria 1679
77 Ga0068852_100334360 3300005616 Bacteria 1474
78 Ga0068859_100025859 3300005617 Bacteria 5889
79 Ga0068859_100578468 3300005617 Bacteria 1217
80 Ga0068864_100024780 3300005618 Bacteria 5047
81 Ga0068864_100034972 3300005618 Bacteria 4275
82 Ga0068861_100002604 3300005719 Bacteria 11806
83 Ga0068861_100007839 3300005719 Bacteria 7343
84 Ga0068861_100066402 3300005719 Bacteria 2781
85 Ga0068861_100298170 3300005719 Bacteria 1395
86 Ga0068851_10083992 3300005834 Bacteria 1667
87 Ga0068870_10018877 3300005840 Bacteria 3337
88 Ga0068863_100001023 3300005841 Bacteria 27929
89 Ga0068863_100060176 3300005841 Bacteria 3592
90 Ga0068858_100015994 3300005842 Bacteria 7046
91 Ga0068858_100318037 3300005842 Bacteria 1487
92 Ga0068858_100459549 3300005842 Bacteria 1227
93 Ga0068860_100066066 3300005843 Bacteria 3435
94 Ga0068860_100153874 3300005843 Bacteria 2216
95 Ga0068862_100089013 3300005844 Bacteria 2686
96 Ga0068862_100089388 3300005844 Bacteria 2681
97 Ga0068862_100215210 3300005844 Bacteria 1737
98 Ga0081455_10013145 3300005937 Bacteria 8205
99 Ga0081455_10032134 3300005937 Bacteria 4735
100 Ga0081455_10068537 3300005937 Bacteria 2952
101 Ga0081455_10129356 3300005937 Bacteria 1976
102 Ga0081538_10000559 3300005981 Bacteria 41262
103 Ga0081538_10001509 3300005981 Bacteria 23875
104 Ga0081538_10001884 3300005981 Bacteria 21119
105 Ga0081538_10003620 3300005981 Bacteria 14523
106 Ga0081538_10003778 3300005981 Bacteria 14173
107 Ga0081538_10008061 3300005981 Bacteria 9002
108 Ga0081538_10008819 3300005981 Bacteria 8496
109 Ga0081538_10008969 3300005981 Bacteria 8403
110 Ga0081538_10010342 3300005981 Bacteria 7655
111 Ga0081538_10010553 3300005981 Bacteria 7570
112 Ga0081538_10012245 3300005981 Bacteria 6889
113 Ga0081538_10014515 3300005981 Bacteria 6163
114 Ga0081538_10018279 3300005981 Bacteria 5276
115 Ga0081538_10031455 3300005981 Bacteria 3579
116 Ga0081538_10032783 3300005981 Bacteria 3472
117 Ga0081538_10032913 3300005981 Bacteria 3462
118 Ga0081538_10040191 3300005981 Bacteria 2987
119 Ga0081538_10041576 3300005981 Bacteria 2915
120 Ga0081538_10055888 3300005981 Bacteria 2318
121 Ga0081538_10068170 3300005981 Bacteria 1980
122 Ga0081540_1000101 3300005983 Bacteria 91600
123 Ga0075365_10018565 3300006038 Bacteria 4278
124 Ga0075365_10022986 3300006038 Bacteria 3915
125 Ga0075368_10003550 3300006042 Bacteria 5224
126 Ga0075432_10022816 3300006058 Bacteria 2142
127 Ga0070712_100089402 3300006175 Bacteria 2253
128 Ga0075428_100001163 3300006844 Bacteria 28189
129 Ga0075428_100011795 3300006844 Bacteria 9728
130 Ga0075428_100014375 3300006844 Bacteria 8797
131 Ga0075428_100055347 3300006844 Bacteria 4346
132 Ga0075428_100082771 3300006844 Bacteria 3501
133 Ga0075428_100085192 3300006844 Bacteria 3447
134 Ga0075428_100244461 3300006844 Bacteria 1935
135 Ga0075430_100000472 3300006846 Bacteria 30098
136 Ga0075430_100021254 3300006846 Bacteria 5518
137 Ga0075430_100058097 3300006846 Bacteria 3252
138 Ga0075431_100000107 3300006847 Bacteria 53071
139 Ga0075431_100000216 3300006847 Bacteria 42716
140 Ga0075431_100000239 3300006847 Bacteria 41273
141 Ga0075431_100021756 3300006847 Bacteria 6557
142 Ga0075431_100025982 3300006847 Bacteria 6002
143 Ga0075431_100077840 3300006847 Bacteria 3422
144 Ga0075431_100114288 3300006847 Bacteria 2787
145 Ga0075431_100611911 3300006847 Bacteria 1072
146 Ga0075433_10021771 3300006852 Bacteria 5378
147 Ga0075433_10367204 3300006852 Bacteria 1271
148 Ga0075434_100002761 3300006871 Bacteria 15529
149 Ga0075429_100004062 3300006880 Bacteria 12539
150 Ga0075429_100013987 3300006880 Bacteria 6955
151 Ga0075429_100046630 3300006880 Bacteria 3771
152 Ga0068865_100146184 3300006881 Bacteria 1788
153 Ga0068865_100152647 3300006881 Bacteria 1754
154 Ga0068865_100163314 3300006881 Bacteria 1701
155 Ga0068865_100170083 3300006881 Unclassified 1670
156 Ga0097620_100025860 3300006931 Bacteria 5889
157 Ga0097620_100578425 3300006931 Bacteria 1217
158 Ga0075435_100017567 3300007076 Bacteria 5418
159 Ga0111539_10067716 3300009094 Bacteria 4216
160 Ga0111539_10307662 3300009094 Bacteria 1844
161 Ga0111539_10336699 3300009094 Bacteria 1756
162 Ga0114129_10050595 3300009147 Bacteria 5836
163 Ga0114129_10052398 3300009147 Bacteria 5726
164 Ga0114129_10378782 3300009147 Bacteria 1869
165 Ga0114129_10687529 3300009147 Bacteria 1316
166 Ga0105243_10177504 3300009148 Bacteria 1850
167 Ga0105242_10182913 3300009176 Bacteria 1850
168 Ga0105248_10016575 3300009177 Bacteria 8114
169 Ga0105248_10105441 3300009177 Bacteria 3178
170 Ga0105248_10330142 3300009177 Unclassified 1718
171 Ga0105237_10000088 3300009545 Bacteria 124518
172 Ga0105249_10011135 3300009553 Bacteria 7901
173 Ga0105249_10145461 3300009553 Bacteria 2277
174 Ga0157370_10004615 3300013104 Bacteria 15750
175 Ga0157374_10043889 3300013296 Bacteria 4131
176 Ga0163162_10010239 3300013306 Bacteria 9109
177 Ga0157375_10007150 3300013308 Bacteria 9758
178 Ga0157375_10069680 3300013308 Bacteria 3524
179 Ga0163163_10013951 3300014325 Bacteria 7373
180 Ga0163163_10046228 3300014325 Bacteria 4276
181 Ga0157380_10190935 3300014326 Bacteria 1808
182 Ga0182008_10000894 3300014497 Bacteria 20715
183 Ga0182008_10041905 3300014497 Bacteria 2282
184 Ga0157379_10104996 3300014968 Bacteria 2535
185 Ga0182006_1000947 3300015261 Bacteria 19348
186 Ga0182006_1018233 3300015261 Bacteria 2968
187 Ga0183361_10016 3300016635 Bacteria 163785
188 Ga0163161_10045179 3300017792 Bacteria 3175
189 Ga0163161_10092682 3300017792 Bacteria 2237
190 Ga0163161_10163225 3300017792 Bacteria 1700
191 Ga0213875_10002459 3300021388 Bacteria 11062
192 Ga0209026_1000032 3300025250 Bacteria 322378
193 Ga0209148_1000317 3300025254 Bacteria 67724
194 Ga0209759_1000168 3300025256 Bacteria 111106
195 Ga0209233_1000030 3300025261 Bacteria 636702
196 Ga0209455_1000152 3300025272 Bacteria 125942
197 Ga0207426_1008984 3300025302 Bacteria 3983
198 Ga0207642_10196764 3300025899 Bacteria 1110
199 Ga0207710_10028164 3300025900 Bacteria 2438
200 Ga0207688_10008061 3300025901 Bacteria 5731
201 Ga0207680_10033053 3300025903 Bacteria 2947
202 Ga0207699_10004374 3300025906 Bacteria 6757
203 Ga0207645_10023677 3300025907 Bacteria 3987
204 Ga0207645_10132361 3300025907 Bacteria 1623
205 Ga0207671_10008464 3300025914 Bacteria 8721
206 Ga0207663_10341085 3300025916 Bacteria 1132
207 Ga0207662_10029647 3300025918 Bacteria 3171
208 Ga0207657_10045375 3300025919 Bacteria 3858
209 Ga0207659_10005151 3300025926 Bacteria 7926
210 Ga0207659_10117163 3300025926 Bacteria 2035
211 Ga0207687_10006385 3300025927 Bacteria 7791
212 Ga0207700_10316456 3300025928 Bacteria 1351
213 Ga0207644_10177718 3300025931 Bacteria 1666
214 Ga0207690_10337932 3300025932 Bacteria 1188
215 Ga0207706_10045278 3300025933 Bacteria 3899
216 Ga0207706_10066553 3300025933 Bacteria 3171
217 Ga0207706_10262498 3300025933 Bacteria 1508
218 Ga0207709_10301980 3300025935 Bacteria 1191
219 Ga0207670_10011881 3300025936 Bacteria 5071
220 Ga0207669_10012363 3300025937 Bacteria 4194
221 Ga0207669_10047566 3300025937 Bacteria 2542
222 Ga0207669_10329113 3300025937 Bacteria 1172
223 Ga0207704_10180509 3300025938 Bacteria 1525
224 Ga0207704_10391439 3300025938 Bacteria 1094
225 Ga0207704_10487356 3300025938 Unclassified 991
226 Ga0207691_10018770 3300025940 Bacteria 6550
227 Ga0207711_10059808 3300025941 Bacteria 3281
228 Ga0207711_10099579 3300025941 Bacteria 2570
229 Ga0207711_10220425 3300025941 Unclassified 1735
230 Ga0207711_10690431 3300025941 Bacteria 952
231 Ga0207689_10006072 3300025942 Bacteria 10683
232 Ga0207689_10023841 3300025942 Bacteria 5134
233 Ga0207679_10008919 3300025945 Bacteria 6402
234 Ga0207679_10018203 3300025945 Bacteria 4702
235 Ga0207651_10037440 3300025960 Bacteria 3178
236 Ga0207712_10007575 3300025961 Bacteria 6860
237 Ga0207712_10023423 3300025961 Bacteria 4074
238 Ga0207712_10080527 3300025961 Bacteria 2369
239 Ga0207712_10138699 3300025961 Unclassified 1863
240 Ga0207668_10260309 3300025972 Unclassified 1413
241 Ga0207640_10195915 3300025981 Bacteria 1527
242 Ga0207640_10416393 3300025981 Bacteria 1098
243 Ga0207677_10013042 3300026023 Bacteria 4801
244 Ga0207677_10058880 3300026023 Bacteria 2647
245 Ga0207703_10035381 3300026035 Bacteria 3968
246 Ga0207703_10274038 3300026035 Bacteria 1530
247 Ga0207703_10385327 3300026035 Bacteria 1298
248 Ga0207678_10009174 3300026067 Bacteria 8707
249 Ga0207708_10040415 3300026075 Unclassified 3556
250 Ga0207708_10188031 3300026075 Bacteria 1642
251 Ga0207641_10053990 3300026088 Bacteria 3408
252 Ga0207641_10529040 3300026088 Bacteria 1147
253 Ga0207648_10112781 3300026089 Bacteria 2387
254 Ga0207674_10074131 3300026116 Bacteria 3416
255 Ga0207675_100001666 3300026118 Bacteria 22229
256 Ga0207675_100025300 3300026118 Bacteria 5524
257 Ga0207675_100200419 3300026118 Bacteria 1917
258 Ga0207683_10057284 3300026121 Bacteria 3420
259 Ga0207698_10247882 3300026142 Bacteria 1628
260 Ga0207698_10308417 3300026142 Bacteria 1477
261 Ga0207428_10005530 3300027907 Bacteria 11774
262 Ga0207428_10084225 3300027907 Bacteria 2478
263 Ga0207428_10470848 3300027907 Bacteria 915
264 Ga0268266_10020894 3300028379 Bacteria 5581
265 Ga0268266_10021229 3300028379 Bacteria 5532
266 Ga0268266_10047421 3300028379 Bacteria 3680
267 Ga0268266_10182874 3300028379 Bacteria 1910
268 Ga0268266_10389394 3300028379 Bacteria 1316
269 Ga0268265_10073028 3300028380 Bacteria 2678
270 Ga0268265_10120252 3300028380 Bacteria 2162
271 Ga0268265_10173433 3300028380 Bacteria 1845
272 Ga0268264_10260509 3300028381 Unclassified 1615
273 Ga0307515_10020916 3300028794 Bacteria 11632
274 Ga0307513_10001099 3300031456 Bacteria 39148
275 Ga0307408_100053577 3300031548 Bacteria 2914
276 Ga0316575_10000466 3300031665 Bacteria 11615
277 Ga0316579_10000459 3300031691 Bacteria 13120
278 Ga0316576_10002017 3300031727 Bacteria 11381
279 Ga0316576_10002226 3300031727 Bacteria 10957
280 Ga0316576_10004642 3300031727 Bacteria 8270
281 Ga0316576_10024145 3300031727 Bacteria 4243
282 Ga0316578_10002236 3300031728 Bacteria 8383
283 Ga0316578_10012723 3300031728 Bacteria 4441
284 Ga0307516_10001605 3300031730 Bacteria 31131
285 Ga0307516_10036170 3300031730 Bacteria 4944
286 Ga0307405_10196285 3300031731 Bacteria 1462
287 Ga0316577_10000053 3300031733 Bacteria 26968
288 Ga0316577_10021228 3300031733 Bacteria 3602
289 Ga0316577_10100525 3300031733 Bacteria 1621
290 Ga0316577_10171070 3300031733 Bacteria 1226
291 Ga0307406_10154338 3300031901 Bacteria 1642
292 Ga0307406_10157283 3300031901 Bacteria 1629
293 Ga0307406_10433281 3300031901 Bacteria 1050
294 Ga0307407_10030143 3300031903 Bacteria 2923
295 Ga0307407_10177111 3300031903 Bacteria 1410
296 Ga0307407_10235378 3300031903 Bacteria 1246
297 Ga0307409_100021812 3300031995 Bacteria 4400
298 Ga0307409_100060888 3300031995 Bacteria 2946
299 Ga0307409_100209714 3300031995 Bacteria 1750
300 Ga0307409_100494207 3300031995 Bacteria 1190
301 Ga0307416_100051196 3300032002 Bacteria 3297
302 Ga0307416_100118792 3300032002 Bacteria 2350
303 Ga0307416_100121692 3300032002 Bacteria 2327
304 Ga0307416_100140286 3300032002 Bacteria 2195
305 Ga0307416_100183621 3300032002 Bacteria 1963
306 Ga0307416_100288870 3300032002 Bacteria 1622
307 Ga0307416_100428583 3300032002 Bacteria 1369
308 Ga0307416_100762345 3300032002 Bacteria 1061
309 Ga0307414_10051950 3300032004 Bacteria 2849
310 Ga0307411_10020972 3300032005 Bacteria 3812
311 Ga0307411_10031237 3300032005 Bacteria 3274
312 Ga0307411_10339369 3300032005 Bacteria 1220
313 Ga0307411_10353583 3300032005 Bacteria 1199
314 Ga0307415_100093379 3300032126 Bacteria 2185
315 Ga0307415_100182048 3300032126 Bacteria 1650
316 Ga0307415_100300147 3300032126 Bacteria 1330
317 Ga0307415_100305534 3300032126 Bacteria 1320
318 Ga0316583_10038113 3300032133 Bacteria 1704
319 Ga0316585_10002691 3300032137 Bacteria 4819
320 Ga0316580_10000334 3300032139 Bacteria 10353
321 Ga0316580_10081140 3300032139 Bacteria 992
322 Ga0373939_0103532 3300035114 Bacteria 981
323 Ga0316574_0000030 3300035398 Bacteria 35704
324 Ga0316574_0137036 3300035398 Bacteria 1576
325 Ga0395900_0004358 3300037418 Bacteria 15013
326 Ga0395900_0335496 3300037418 Bacteria 1489
327 Ga0395898_0012921 3300037466 Bacteria 8612
328 Ga0395905_0014771 3300037471 Bacteria 7445
329 Ga0436364_0153720 3300037853 Bacteria 21422
330 Ga0395901_0004634 3300038443 Bacteria 13874
331 Ga0395901_0418758 3300038443 Bacteria 1374
332 Ga0400488_11610 3300038741 Bacteria 38726
333 Ga0400488_39954 3300038741 Bacteria 1005
334 Ga0400483_032129 3300039062 Bacteria 24359
335 Ga0400483_101132 3300039062 Bacteria 5059
336 Ga0400483_111906 3300039062 Bacteria 2761
337 Ga0400483_174725 3300039062 Bacteria 16447
338 Ga0400483_196417 3300039062 Bacteria 1533
339 Ga0400483_221339 3300039062 Bacteria 2317
340 Ga0400483_284434 3300039062 Bacteria 2657
341 Ga0400489_76699 3300039093 Bacteria 3044
342 Ga0451791_0857751 3300041451 Bacteria 1519
343 Ga0451807_0661688 3300041486 Bacteria 1371
344 Ga0451853_2264629 3300041512 Bacteria 2046
345 Ga0439458_0064922 3300042157 Bacteria 916
346 Ga0466972_0000035 3300044658 Bacteria 147516
347 Ga0466965_0155388 3300044683 Bacteria 1197
348 Ga0466970_0013485 3300044765 Bacteria 4190
349 Ga0466959_0192297 3300045049 Bacteria 1424
350 Ga0451576_0022238 3300045051 Bacteria 6879
351 Ga0495603_0164985 3300046455 Bacteria 1284
352 Ga0495629_0092135 3300046459 Bacteria 2115
353 Ga0495664_0124816 3300046477 Bacteria 1557
354 Ga0495594_0080065 3300046499 Bacteria 1824
355 Ga0495643_0093533 3300046522 Bacteria 1548
356 Ga0495648_0080002 3300046524 Bacteria 1863
357 Ga0495652_0250020 3300046529 Bacteria 1314
358 Ga0495667_0084524 3300046559 Bacteria 2060
359 Ga0495668_0098943 3300046616 Bacteria 1596
360 Ga0495625_0034942 3300046660 Bacteria 3707
361 Ga0495670_0074961 3300046691 Bacteria 1717
362 Ga0495675_0107414 3300047444 Bacteria 1744
363 Ga0495686_0104935 3300047472 Bacteria 1701
364 Ga0496100_0002990 3300048903 Bacteria 8705
365 Ga0496100_0004837 3300048903 Bacteria 7194
366 Ga0496101_0004338 3300048904 Bacteria 8900
367 Ga0496101_0498368 3300048904 Bacteria 962
368 Ga0496104_0008888 3300048907 Bacteria 8927
369 Ga0496104_0026081 3300048907 Bacteria 5391
370 Ga0496104_0611564 3300048907 Bacteria 1000
371 Ga0496105_0001822 3300048908 Bacteria 15267
372 Ga0496106_0009349 3300048909 Bacteria 7246
373 Ga0496107_0007236 3300048910 Bacteria 7647
374 Ga0496112_0095517 3300048915 Bacteria 2943
375 Ga0496112_0097580 3300048915 Bacteria 2909
376 Ga0496112_0169958 3300048915 Bacteria 2145
377 Ga0496114_0000312 3300048917 Bacteria 35518
378 Ga0496114_0162502 3300048917 Bacteria 1943
379 Ga0496115_0003011 3300048918 Bacteria 12095
380 Ga0496115_0016805 3300048918 Bacteria 5578
381 Ga0496115_0185690 3300048918 Bacteria 1718
382 Ga0496118_0190301 3300048921 Unclassified 1228
383 Ga0496119_0020754 3300048922 Bacteria 4774
384 Ga0496120_0020735 3300048923 Bacteria 4169
385 Ga0496122_0000817 3300048925 Bacteria 59596
386 Ga0496123_0005275 3300048926 Bacteria 13103
387 Ga0496125_0253392 3300048928 Bacteria 1109
388 Ga0496126_0161560 3300048929 Bacteria 1914
389 Ga0501036_0099387 3300049572 Bacteria 2461
390 Ga0501036_0169419 3300049572 Bacteria 1840
391 Ga0501036_0340408 3300049572 Bacteria 1253
392 Ga0501039_0037508 3300049575 Bacteria 3741
393 Ga0501041_0464197 3300049577 Bacteria 804
394 Ga0501042_0089710 3300049578 Bacteria 2206
395 Ga0501072_0022939 3300049588 Bacteria 4845
396 Ga0501076_0067234 3300049592 Bacteria 2862
397 Ga0501077_0112707 3300049593 Bacteria 1724
398 Ga0501225_0002424 3300049705 Bacteria 5760
399 Ga0501079_0191436 3300049741 Bacteria 1596
400 Ga0501080_0112227 3300049742 Bacteria 2527
401 Ga0501081_0021444 3300049743 Bacteria 4311
402 Ga0501083_0407487 3300049744 Bacteria 885
403 Ga0501045_0068729 3300049824 Bacteria 2603
404 nmdc:mga03n38_27801_c1 3300050490 Bacteria 2350
405 nmdc:mga00v17_80675_c1 3300050491 Bacteria 2030
406 nmdc:mga0yw44_165147_c1 3300050492 Bacteria 1451
407 nmdc:mga0yw44_22118_c1 3300050492 Bacteria 3559
408 nmdc:mga07m45_14362_c1 3300050496 Bacteria 4216
409 nmdc:mga05p37_164682_c1 3300050507 Bacteria 2707
410 nmdc:mga05p37_22020_c1 3300050507 Bacteria 7723
411 nmdc:mga09592_11080_c1 3300050508 Bacteria 7338
412 nmdc:mga09592_2341_c1 3300050508 Bacteria 15290
413 nmdc:mga09592_4281_c1 3300050508 Bacteria 11533
414 nmdc:mga09592_52389_c1 3300050508 Bacteria 3445
415 nmdc:mga0qj67_10772_c1 3300050509 Bacteria 6838
416 nmdc:mga0qj67_257601_c1 3300050509 Bacteria 1415
417 nmdc:mga0qj67_602_c1 3300050509 Bacteria 24564
418 nmdc:mga0qj67_8928_c1 3300050509 Bacteria 7436
419 nmdc:mga06r32_1130_c1 3300050510 Bacteria 23940
420 nmdc:mga06r32_116_c1 3300050510 Bacteria 57202
421 nmdc:mga06r32_12490_c1 3300050510 Bacteria 7665
422 nmdc:mga06r32_6037_c1 3300050510 Bacteria 10895
423 nmdc:mga06r32_9327_c1 3300050510 Bacteria 8848
424 nmdc:mga08y16_184644_c1 3300050511 Bacteria 2165
425 nmdc:mga08y16_418_c1 3300050511 Bacteria 39105
426 nmdc:mga0n895_15147_c1 3300050512 Bacteria 7027
427 nmdc:mga0n895_271732_c1 3300050512 Bacteria 1719
428 nmdc:mga0rr50_5728_c1 3300050513 Bacteria 7450
429 nmdc:mga0a205_20462_c1 3300050515 Bacteria 6243
430 Ga0500610_0018828 3300053079 Bacteria 3347
431 Ga0500650_0057953 3300053098 Unclassified 1806
432 Ga0500555_000046 3300053103 Bacteria 63092
433 Ga0500568_0087844 3300053139 Bacteria 1175
434 Ga0500616_0045846 3300053153 Bacteria 2327
435 Ga0500620_000145 3300053155 Bacteria 14299
436 Ga0500620_008011 3300053155 Bacteria 2645
437 Ga0500627_0066617 3300053158 Bacteria 1590
438 Ga0500611_005589 3300053727 Bacteria 1780
439 Ga0501082_0093507 3300060353 Bacteria 2598
440 Ga0530510_0022642 3300061734 Bacteria 4476

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0464197 Ga0501041_0464197_16_759 219
2 3300049744 Ga0501083_0407487 Ga0501083_0407487_18_761 220
3 3300039062 Ga0400483_111906 Ga0400483_111906_142_969 241
4 3300039062 Ga0400483_284434 Ga0400483_284434_1132_1959 241
5 3300049572 Ga0501036_0340408 Ga0501036_0340408_367_1221 253
6 3300050511 nmdc:mga08y16_184644_c1 nmdc:mga08y16_184644_c1_206_973 254
7 3300039062 Ga0400483_196417 Ga0400483_196417_329_1162 256
8 3300053103 Ga0500555_000046 Ga0500555_000046_29132_29968 256
9 3300031727 Ga0316576_10024145 Ga0316576_100241453 258
10 3300031733 Ga0316577_10100525 Ga0316577_101005252 258
11 3300039062 Ga0400483_032129 Ga0400483_032129_126_953 258
12 3300039062 Ga0400483_174725 Ga0400483_174725_14110_14937 258
13 3300038741 Ga0400488_11610 Ga0400488_11610_3376_4203 260
14 3300005981 Ga0081538_10008969 Ga0081538_100089693 263
15 3300046529 Ga0495652_0250020 Ga0495652_0250020_61_900 264
16 iso_pu_bacteria 8056207758 8056214617 264
17 3300006038 Ga0075365_10022986 Ga0075365_100229862 265
18 3300046455 Ga0495603_0164985 Ga0495603_0164985_13_867 265
19 3300009147 Ga0114129_10052398 Ga0114129_100523985 266
20 3300005981 Ga0081538_10001884 Ga0081538_1000188427 267
21 3300038741 Ga0400488_39954 Ga0400488_39954_64_867 267
22 3300003323 rootH1_10187891 rootH1_101878913 268
23 3300005937 Ga0081455_10129356 Ga0081455_101293562 268
24 3300005983 Ga0081540_1000101 Ga0081540_10001015 268
25 3300041486 Ga0451807_0661688 Ga0451807_0661688_316_1131 268
26 iso_pu_bacteria 2937861824 2937867957 268
27 3300005327 Ga0070658_10076306 Ga0070658_100763062 269
28 3300005334 Ga0068869_100028738 Ga0068869_1000287383 269
29 3300005338 Ga0068868_100049640 Ga0068868_1000496402 269
30 3300005339 Ga0070660_100140145 Ga0070660_1001401452 269
31 3300005441 Ga0070700_100022039 Ga0070700_1000220393 269
32 3300005455 Ga0070663_100132341 Ga0070663_1001323411 269
33 3300005563 Ga0068855_100340500 Ga0068855_1003405002 269
34 3300005577 Ga0068857_100185146 Ga0068857_1001851462 269
35 3300005578 Ga0068854_100019648 Ga0068854_1000196482 269
36 3300005614 Ga0068856_100370172 Ga0068856_1003701722 269
37 3300005615 Ga0070702_100085373 Ga0070702_1000853732 269
38 3300005616 Ga0068852_100334360 Ga0068852_1003343602 269
39 3300005617 Ga0068859_100578468 Ga0068859_1005784682 269
40 3300005618 Ga0068864_100034972 Ga0068864_1000349723 269
41 3300005719 Ga0068861_100066402 Ga0068861_1000664022 269
42 3300005834 Ga0068851_10083992 Ga0068851_100839922 269
43 3300005842 Ga0068858_100459549 Ga0068858_1004595492 269
44 3300005843 Ga0068860_100153874 Ga0068860_1001538742 269
45 3300005844 Ga0068862_100089388 Ga0068862_1000893881 269
46 3300006881 Ga0068865_100170083 Ga0068865_1001700832 269
47 3300006931 Ga0097620_100578425 Ga0097620_1005784252 269
48 3300009553 Ga0105249_10145461 Ga0105249_101454612 269
49 3300025899 Ga0207642_10196764 Ga0207642_101967642 269
50 3300025901 Ga0207688_10008061 Ga0207688_100080613 269
51 3300025919 Ga0207657_10045375 Ga0207657_100453752 269
52 3300025926 Ga0207659_10117163 Ga0207659_101171632 269
53 3300025927 Ga0207687_10006385 Ga0207687_100063854 269
54 3300025932 Ga0207690_10337932 Ga0207690_103379321 269
55 3300025933 Ga0207706_10045278 Ga0207706_100452781 269
56 3300025935 Ga0207709_10301980 Ga0207709_103019802 269
57 3300025938 Ga0207704_10391439 Ga0207704_103914392 269
58 3300025942 Ga0207689_10023841 Ga0207689_100238411 269
59 3300025945 Ga0207679_10018203 Ga0207679_100182034 269
60 3300025961 Ga0207712_10138699 Ga0207712_101386992 269
61 3300025972 Ga0207668_10260309 Ga0207668_102603092 269
62 3300026023 Ga0207677_10013042 Ga0207677_100130422 269
63 3300026035 Ga0207703_10385327 Ga0207703_103853272 269
64 3300026067 Ga0207678_10009174 Ga0207678_100091749 269
65 3300026075 Ga0207708_10040415 Ga0207708_100404152 269
66 3300026118 Ga0207675_100200419 Ga0207675_1002004192 269
67 3300026142 Ga0207698_10247882 Ga0207698_102478821 269
68 3300028380 Ga0268265_10073028 Ga0268265_100730282 269
69 3300028381 Ga0268264_10260509 Ga0268264_102605092 269
70 iso_pu_bacteria 2862290372 2862290528 269
71 iso_pu_bacteria 8003856774 8003857088 269
72 3300003322 rootL2_10180492 rootL2_101804922 270
73 3300005937 Ga0081455_10013145 Ga0081455_100131453 270
74 3300025302 Ga0207426_1008984 Ga0207426_10089842 270
75 3300037853 Ga0436364_0153720 Ga0436364_0153720_9487_10320 270
76 3300046459 Ga0495629_0092135 Ga0495629_0092135_851_1711 270
77 iso_pu_bacteria 2513237166 2514047753 270
78 iso_pu_bacteria 2515154129 2515721584 270
79 iso_pu_bacteria 2643221591 2643963399 270
80 iso_pu_bacteria 2767802112 2768647835 270
81 iso_pu_bacteria 2856349417 2856350083 270
82 iso_pu_bacteria 2871488783 2871494693 270
83 iso_pu_bacteria 2878753008 2878759827 270
84 iso_pu_bacteria 2881155292 2881160343 270
85 iso_pu_bacteria 2881853255 2881853475 270
86 iso_pu_bacteria 2881861095 2881864851 270
87 iso_pu_bacteria 2882912400 2882915711 270
88 iso_pu_bacteria 2885318864 2885322388 270
89 iso_pu_bacteria 2885342637 2885349454 270
90 iso_pu_bacteria 2896109856 2896112482 270
91 iso_pu_bacteria 2903492973 2903494051 270
92 iso_pu_bacteria 2924784321 2924790470 270
93 iso_pu_bacteria 2961127735 2961129149 270
94 iso_pu_bacteria 2961170736 2961177724 270
95 iso_pu_bacteria 2967996073 2968002189 270
96 iso_pu_bacteria 2968003550 2968009423 270
97 iso_pu_bacteria 2970503327 2970510402 270
98 iso_pu_bacteria 2977821940 2977828349 270
99 iso_pu_bacteria 2977828996 2977831713 270
100 iso_pu_bacteria 2979808191 2979815275 270
101 iso_pu_bacteria 8004374579 8004381325 270
102 3300005471 Ga0070698_100003228 Ga0070698_10000322816 271
103 3300005937 Ga0081455_10068537 Ga0081455_100685374 271
104 3300005981 Ga0081538_10000559 Ga0081538_1000055939 271
105 3300005981 Ga0081538_10001509 Ga0081538_1000150918 271
106 3300009177 Ga0105248_10330142 Ga0105248_103301422 271
107 3300025941 Ga0207711_10220425 Ga0207711_102204251 271
108 3300032126 Ga0307415_100182048 Ga0307415_1001820481 271
109 iso_pu_bacteria 2512875016 2512933316 271
110 iso_pu_bacteria 2588253730 2588519384 271
111 iso_pu_bacteria 2837268691 2837268729 271
112 iso_pu_bacteria 2856320880 2856321389 271
113 iso_pu_bacteria 2869278585 2869285326 271
114 iso_pu_bacteria 2874139085 2874146431 271
115 iso_pu_bacteria 2876363079 2876364431 271
116 iso_pu_bacteria 2878738818 2878741479 271
117 iso_pu_bacteria 2903448605 2903455044 271
118 iso_pu_bacteria 2903521522 2903523416 271
119 iso_pu_bacteria 2903528002 2903531382 271
120 iso_pu_bacteria 2924718760 2924726322 271
121 iso_pu_bacteria 2924762789 2924766648 271
122 iso_pu_bacteria 2924776078 2924779161 271
123 iso_pu_bacteria 2937848649 2937849439 271
124 iso_pu_bacteria 2958034702 2958041031 271
125 iso_pu_bacteria 2958041894 2958057525 271
126 iso_pu_bacteria 2958064165 2958070216 271
127 iso_pu_bacteria 2958144490 2958145412 271
128 iso_pu_bacteria 2963644680 2963645888 271
129 iso_pu_bacteria 2968016561 2968022625 271
130 iso_pu_bacteria 2968083720 2968089398 271
131 iso_pu_bacteria 2970469710 2970475209 271
132 iso_pu_bacteria 2970593180 2970599942 271
133 iso_pu_bacteria 2977922695 2977923717 271
134 iso_pu_bacteria 2977986579 2977989579 271
135 iso_pu_bacteria 2987666974 2987671008 271
136 iso_pu_bacteria 2996348954 2996353364 271
137 iso_pu_bacteria 3004211236 3004212942 271
138 iso_pu_bacteria 3004218560 3004220621 271
139 iso_pu_bacteria 3004275668 3004280046 271
140 iso_pu_bacteria 637000159 637076398 271
141 3300003323 rootH1_10227275 rootH1_102272752 272
142 3300003373 JGI25407J50210_10011663 JGI25407J50210_100116632 272
143 3300003373 JGI25407J50210_10022204 JGI25407J50210_100222041 272
144 3300005436 Ga0070713_100040187 Ga0070713_1000401872 272
145 3300005937 Ga0081455_10032134 Ga0081455_100321342 272
146 3300005981 Ga0081538_10003620 Ga0081538_100036209 272
147 3300005981 Ga0081538_10003778 Ga0081538_1000377815 272
148 3300005981 Ga0081538_10010342 Ga0081538_100103427 272
149 3300005981 Ga0081538_10010553 Ga0081538_100105535 272
150 3300005981 Ga0081538_10012245 Ga0081538_100122453 272
151 3300005981 Ga0081538_10018279 Ga0081538_100182792 272
152 3300005981 Ga0081538_10032783 Ga0081538_100327832 272
153 3300005981 Ga0081538_10032913 Ga0081538_100329133 272
154 3300005981 Ga0081538_10041576 Ga0081538_100415763 272
155 3300005981 Ga0081538_10055888 Ga0081538_100558882 272
156 3300025928 Ga0207700_10316456 Ga0207700_103164561 272
157 3300031901 Ga0307406_10433281 Ga0307406_104332811 272
158 3300031903 Ga0307407_10030143 Ga0307407_100301435 272
159 3300031995 Ga0307409_100021812 Ga0307409_1000218123 272
160 3300031995 Ga0307409_100494207 Ga0307409_1004942071 272
161 3300032002 Ga0307416_100121692 Ga0307416_1001216922 272
162 3300032005 Ga0307411_10031237 Ga0307411_100312372 272
163 3300037418 Ga0395900_0004358 Ga0395900_0004358_13249_14073 272
164 3300037466 Ga0395898_0012921 Ga0395898_0012921_6703_7524 272
165 3300037471 Ga0395905_0014771 Ga0395905_0014771_1205_2029 272
166 3300038443 Ga0395901_0004634 Ga0395901_0004634_6676_7500 272
167 3300046499 Ga0495594_0080065 Ga0495594_0080065_787_1605 272
168 iso_pu_bacteria 2738541283 2738755931 272
169 iso_pu_bacteria 2869162929 2869165095 272
170 iso_pu_bacteria 8033684223 8033691539 272
171 3300003373 JGI25407J50210_10004157 JGI25407J50210_100041574 273
172 3300005337 Ga0070682_100127922 Ga0070682_1001279222 273
173 3300005356 Ga0070674_100092916 Ga0070674_1000929162 273
174 3300005548 Ga0070665_100412923 Ga0070665_1004129231 273
175 3300005841 Ga0068863_100060176 Ga0068863_1000601762 273
176 3300005842 Ga0068858_100318037 Ga0068858_1003180371 273
177 3300005981 Ga0081538_10008819 Ga0081538_1000881911 273
178 3300005981 Ga0081538_10031455 Ga0081538_100314554 273
179 3300006844 Ga0075428_100244461 Ga0075428_1002444612 273
180 3300006846 Ga0075430_100058097 Ga0075430_1000580973 273
181 3300006847 Ga0075431_100000239 Ga0075431_10000023917 273
182 3300006847 Ga0075431_100114288 Ga0075431_1001142882 273
183 3300006852 Ga0075433_10021771 Ga0075433_100217717 273
184 3300006871 Ga0075434_100002761 Ga0075434_10000276115 273
185 3300006881 Ga0068865_100146184 Ga0068865_1001461842 273
186 3300007076 Ga0075435_100017567 Ga0075435_1000175673 273
187 3300009094 Ga0111539_10307662 Ga0111539_103076622 273
188 3300009147 Ga0114129_10378782 Ga0114129_103787822 273
189 3300009147 Ga0114129_10687529 Ga0114129_106875292 273
190 3300014968 Ga0157379_10104996 Ga0157379_101049962 273
191 3300016635 Ga0183361_10016 Ga0183361_10016131 273
192 3300021388 Ga0213875_10002459 Ga0213875_100024592 273
193 3300025937 Ga0207669_10012363 Ga0207669_100123633 273
194 3300025941 Ga0207711_10099579 Ga0207711_100995792 273
195 3300026035 Ga0207703_10274038 Ga0207703_102740382 273
196 3300026088 Ga0207641_10053990 Ga0207641_100539903 273
197 3300028379 Ga0268266_10389394 Ga0268266_103893942 273
198 3300028794 Ga0307515_10020916 Ga0307515_100209167 273
199 3300031727 Ga0316576_10002017 Ga0316576_100020173 273
200 3300031730 Ga0307516_10001605 Ga0307516_100016053 273
201 3300031901 Ga0307406_10157283 Ga0307406_101572832 273
202 3300031903 Ga0307407_10177111 Ga0307407_101771112 273
203 3300031995 Ga0307409_100209714 Ga0307409_1002097141 273
204 3300032002 Ga0307416_100428583 Ga0307416_1004285832 273
205 3300032002 Ga0307416_100762345 Ga0307416_1007623451 273
206 3300032004 Ga0307414_10051950 Ga0307414_100519502 273
207 3300032005 Ga0307411_10353583 Ga0307411_103535832 273
208 3300035398 Ga0316574_0137036 Ga0316574_0137036_689_1537 273
209 3300037418 Ga0395900_0335496 Ga0395900_0335496_92_922 273
210 3300039062 Ga0400483_101132 Ga0400483_101132_1820_2647 273
211 3300046559 Ga0495667_0084524 Ga0495667_0084524_188_1057 273
212 3300047444 Ga0495675_0107414 Ga0495675_0107414_561_1424 273
213 3300048903 Ga0496100_0004837 Ga0496100_0004837_3151_3984 273
214 3300048904 Ga0496101_0004338 Ga0496101_0004338_3710_4543 273
215 3300048907 Ga0496104_0026081 Ga0496104_0026081_124_957 273
216 3300048908 Ga0496105_0001822 Ga0496105_0001822_6309_7142 273
217 3300048909 Ga0496106_0009349 Ga0496106_0009349_3862_4695 273
218 3300048910 Ga0496107_0007236 Ga0496107_0007236_1818_2651 273
219 3300048917 Ga0496114_0000312 Ga0496114_0000312_21323_22156 273
220 3300048918 Ga0496115_0016805 Ga0496115_0016805_4509_5342 273
221 3300048929 Ga0496126_0161560 Ga0496126_0161560_425_1264 273
222 3300049572 Ga0501036_0099387 Ga0501036_0099387_1206_2036 273
223 3300049572 Ga0501036_0169419 Ga0501036_0169419_617_1447 273
224 3300049575 Ga0501039_0037508 Ga0501039_0037508_1205_2035 273
225 3300049578 Ga0501042_0089710 Ga0501042_0089710_343_1173 273
226 3300049588 Ga0501072_0022939 Ga0501072_0022939_2607_3437 273
227 3300049592 Ga0501076_0067234 Ga0501076_0067234_1360_2190 273
228 3300049593 Ga0501077_0112707 Ga0501077_0112707_38_868 273
229 3300049741 Ga0501079_0191436 Ga0501079_0191436_226_1056 273
230 3300049742 Ga0501080_0112227 Ga0501080_0112227_741_1589 273
231 3300049743 Ga0501081_0021444 Ga0501081_0021444_1202_2032 273
232 3300049824 Ga0501045_0068729 Ga0501045_0068729_248_1078 273
233 3300050508 nmdc:mga09592_11080_c1 nmdc:mga09592_11080_c1_2615_3442 273
234 3300050509 nmdc:mga0qj67_10772_c1 nmdc:mga0qj67_10772_c1_5098_6057 273
235 3300050510 nmdc:mga06r32_9327_c1 nmdc:mga06r32_9327_c1_5285_6112 273
236 3300050512 nmdc:mga0n895_15147_c1 nmdc:mga0n895_15147_c1_2244_3080 273
237 3300050513 nmdc:mga0rr50_5728_c1 nmdc:mga0rr50_5728_c1_6365_7201 273
238 3300050515 nmdc:mga0a205_20462_c1 nmdc:mga0a205_20462_c1_499_1335 273
239 3300060353 Ga0501082_0093507 Ga0501082_0093507_1225_2055 273
240 3300061734 Ga0530510_0022642 Ga0530510_0022642_2361_3191 273
241 iso_pu_bacteria 2508501127 2509142144 273
242 iso_pu_bacteria 2512875024 2512961416 273
243 iso_pu_bacteria 2513237164 2514036715 273
244 iso_pu_bacteria 2738541278 2738731154 273
245 iso_pu_bacteria 2791355123 2792747832 273
246 iso_pu_bacteria 2841734538 2841737002 273
247 iso_pu_bacteria 2856342000 2856342527 273
248 iso_pu_bacteria 2869234852 2869236267 273
249 iso_pu_bacteria 2869256925 2869263638 273
250 iso_pu_bacteria 2871435913 2871443615 273
251 iso_pu_bacteria 2871466892 2871469519 273
252 iso_pu_bacteria 2871474448 2871479545 273
253 iso_pu_bacteria 2871481445 2871482136 273
254 iso_pu_bacteria 2874109183 2874113799 273
255 iso_pu_bacteria 2874168670 2874176589 273
256 iso_pu_bacteria 2876386047 2876388479 273
257 iso_pu_bacteria 2903513507 2903518673 273
258 iso_pu_bacteria 2906401398 2906405027 273
259 iso_pu_bacteria 2924710171 2924710225 273
260 iso_pu_bacteria 2924741084 2924745586 273
261 iso_pu_bacteria 2937822353 2937827497 273
262 iso_pu_bacteria 2937980651 2937987064 273
263 iso_pu_bacteria 2958071322 2958073283 273
264 iso_pu_bacteria 2958108152 2958113159 273
265 iso_pu_bacteria 2961183825 2961187335 273
266 iso_pu_bacteria 2968138860 2968146001 273
267 iso_pu_bacteria 2970510686 2970511640 273
268 iso_pu_bacteria 2970524798 2970526685 273
269 iso_pu_bacteria 2970540015 2970543454 273
270 iso_pu_bacteria 2970619444 2970623769 273
271 iso_pu_bacteria 2970627176 2970630921 273
272 iso_pu_bacteria 2977851361 2977857418 273
273 iso_pu_bacteria 2977898635 2977899416 273
274 iso_pu_bacteria 2977907340 2977910745 273
275 iso_pu_bacteria 2979764755 2979768443 273
276 iso_pu_bacteria 2979772303 2979773026 273
277 iso_pu_bacteria 2996386984 2996393454 273
278 iso_pu_bacteria 3004167301 3004173909 273
279 iso_pu_bacteria 3004232784 3004233243 273
280 iso_pu_bacteria 3004248173 3004253542 273
281 iso_pu_bacteria 8004312739 8004318747 273
282 iso_pu_bacteria 8004633249 8004634901 273
283 iso_pu_bacteria 8004640170 8004645312 273
284 iso_pu_bacteria 8004727605 8004728096 273
285 iso_pu_bacteria 8055617313 8055618528 273
286 3300005290 Ga0065712_10082544 Ga0065712_100825442 274
287 3300005293 Ga0065715_10128603 Ga0065715_101286034 274
288 3300005329 Ga0070683_100137070 Ga0070683_1001370702 274
289 3300005330 Ga0070690_100006140 Ga0070690_1000061405 274
290 3300005331 Ga0070670_100009861 Ga0070670_1000098615 274
291 3300005334 Ga0068869_100002787 Ga0068869_1000027879 274
292 3300005338 Ga0068868_100049635 Ga0068868_1000496352 274
293 3300005340 Ga0070689_100075146 Ga0070689_1000751462 274
294 3300005343 Ga0070687_100018497 Ga0070687_1000184972 274
295 3300005344 Ga0070661_100007403 Ga0070661_10000740311 274
296 3300005353 Ga0070669_100020002 Ga0070669_1000200023 274
297 3300005354 Ga0070675_100002518 Ga0070675_10000251818 274
298 3300005356 Ga0070674_100389487 Ga0070674_1003894871 274
299 3300005364 Ga0070673_100025386 Ga0070673_1000253865 274
300 3300005365 Ga0070688_100004849 Ga0070688_1000048498 274
301 3300005367 Ga0070667_100082885 Ga0070667_1000828852 274
302 3300005367 Ga0070667_100334346 Ga0070667_1003343462 274
303 3300005438 Ga0070701_10020022 Ga0070701_100200222 274
304 3300005440 Ga0070705_100088107 Ga0070705_1000881074 274
305 3300005444 Ga0070694_100400832 Ga0070694_1004008322 274
306 3300005456 Ga0070678_100071123 Ga0070678_1000711232 274
307 3300005457 Ga0070662_100039171 Ga0070662_1000391714 274
308 3300005459 Ga0068867_100100155 Ga0068867_1001001551 274
309 3300005466 Ga0070685_10009455 Ga0070685_100094555 274
310 3300005535 Ga0070684_100010188 Ga0070684_1000101886 274
311 3300005543 Ga0070672_100010935 Ga0070672_1000109357 274
312 3300005544 Ga0070686_100007507 Ga0070686_1000075072 274
313 3300005545 Ga0070695_100169473 Ga0070695_1001694733 274
314 3300005548 Ga0070665_100039829 Ga0070665_1000398294 274
315 3300005564 Ga0070664_100005964 Ga0070664_1000059648 274
316 3300005577 Ga0068857_100035283 Ga0068857_1000352838 274
317 3300005616 Ga0068852_100255914 Ga0068852_1002559142 274
318 3300005617 Ga0068859_100025859 Ga0068859_1000258595 274
319 3300005618 Ga0068864_100024780 Ga0068864_1000247807 274
320 3300005719 Ga0068861_100002604 Ga0068861_10000260411 274
321 3300005841 Ga0068863_100001023 Ga0068863_10000102330 274
322 3300005842 Ga0068858_100015994 Ga0068858_1000159943 274
323 3300005843 Ga0068860_100066066 Ga0068860_1000660666 274
324 3300005844 Ga0068862_100215210 Ga0068862_1002152101 274
325 3300006844 Ga0075428_100001163 Ga0075428_1000011639 274
326 3300006844 Ga0075428_100011795 Ga0075428_1000117956 274
327 3300006844 Ga0075428_100055347 Ga0075428_1000553472 274
328 3300006844 Ga0075428_100085192 Ga0075428_1000851922 274
329 3300006846 Ga0075430_100000472 Ga0075430_10000047219 274
330 3300006846 Ga0075430_100021254 Ga0075430_1000212548 274
331 3300006847 Ga0075431_100000107 Ga0075431_10000010710 274
332 3300006847 Ga0075431_100000216 Ga0075431_10000021631 274
333 3300006847 Ga0075431_100021756 Ga0075431_1000217566 274
334 3300006847 Ga0075431_100025982 Ga0075431_1000259823 274
335 3300006852 Ga0075433_10367204 Ga0075433_103672042 274
336 3300006880 Ga0075429_100004062 Ga0075429_10000406214 274
337 3300006880 Ga0075429_100013987 Ga0075429_1000139872 274
338 3300006880 Ga0075429_100046630 Ga0075429_1000466302 274
339 3300006931 Ga0097620_100025860 Ga0097620_1000258601 274
340 3300009094 Ga0111539_10336699 Ga0111539_103366992 274
341 3300009176 Ga0105242_10182913 Ga0105242_101829132 274
342 3300009177 Ga0105248_10016575 Ga0105248_100165755 274
343 3300009545 Ga0105237_10000088 Ga0105237_1000008884 274
344 3300009553 Ga0105249_10011135 Ga0105249_100111351 274
345 3300013104 Ga0157370_10004615 Ga0157370_1000461515 274
346 3300013306 Ga0163162_10010239 Ga0163162_100102396 274
347 3300013308 Ga0157375_10007150 Ga0157375_100071505 274
348 3300014325 Ga0163163_10013951 Ga0163163_100139516 274
349 3300014497 Ga0182008_10000894 Ga0182008_1000089419 274
350 3300015261 Ga0182006_1000947 Ga0182006_100094711 274
351 3300017792 Ga0163161_10045179 Ga0163161_100451794 274
352 3300017792 Ga0163161_10092682 Ga0163161_100926822 274
353 3300025903 Ga0207680_10033053 Ga0207680_100330533 274
354 3300025918 Ga0207662_10029647 Ga0207662_100296472 274
355 3300025926 Ga0207659_10005151 Ga0207659_100051516 274
356 3300025931 Ga0207644_10177718 Ga0207644_101777184 274
357 3300025933 Ga0207706_10262498 Ga0207706_102624983 274
358 3300025936 Ga0207670_10011881 Ga0207670_100118814 274
359 3300025937 Ga0207669_10329113 Ga0207669_103291131 274
360 3300025938 Ga0207704_10487356 Ga0207704_104873561 274
361 3300025940 Ga0207691_10018770 Ga0207691_100187705 274
362 3300025941 Ga0207711_10059808 Ga0207711_100598085 274
363 3300025942 Ga0207689_10006072 Ga0207689_100060725 274
364 3300025945 Ga0207679_10008919 Ga0207679_100089195 274
365 3300025960 Ga0207651_10037440 Ga0207651_100374403 274
366 3300025961 Ga0207712_10023423 Ga0207712_100234231 274
367 3300026023 Ga0207677_10058880 Ga0207677_100588802 274
368 3300026035 Ga0207703_10035381 Ga0207703_100353812 274
369 3300026075 Ga0207708_10188031 Ga0207708_101880314 274
370 3300026088 Ga0207641_10529040 Ga0207641_105290401 274
371 3300026089 Ga0207648_10112781 Ga0207648_101127815 274
372 3300026116 Ga0207674_10074131 Ga0207674_100741312 274
373 3300026118 Ga0207675_100025300 Ga0207675_1000253005 274
374 3300026121 Ga0207683_10057284 Ga0207683_100572842 274
375 3300026142 Ga0207698_10308417 Ga0207698_103084171 274
376 3300027907 Ga0207428_10005530 Ga0207428_100055306 274
377 3300028379 Ga0268266_10021229 Ga0268266_100212294 274
378 3300028380 Ga0268265_10120252 Ga0268265_101202525 274
379 3300031901 Ga0307406_10154338 Ga0307406_101543384 274
380 3300032002 Ga0307416_100051196 Ga0307416_1000511963 274
381 3300044658 Ga0466972_0000035 Ga0466972_0000035_79369_80214 274
382 3300044765 Ga0466970_0013485 Ga0466970_0013485_1622_2467 274
383 3300045051 Ga0451576_0022238 Ga0451576_0022238_4304_5269 274
384 3300047472 Ga0495686_0104935 Ga0495686_0104935_160_984 274
385 3300048907 Ga0496104_0611564 Ga0496104_0611564_85_909 274
386 3300048915 Ga0496112_0095517 Ga0496112_0095517_860_1825 274
387 3300048917 Ga0496114_0162502 Ga0496114_0162502_644_1609 274
388 3300050507 nmdc:mga05p37_164682_c1 nmdc:mga05p37_164682_c1_817_1647 274
389 3300050507 nmdc:mga05p37_22020_c1 nmdc:mga05p37_22020_c1_4851_5687 274
390 3300050508 nmdc:mga09592_2341_c1 nmdc:mga09592_2341_c1_2334_3164 274
391 3300050508 nmdc:mga09592_4281_c1 nmdc:mga09592_4281_c1_9669_10538 274
392 3300050508 nmdc:mga09592_52389_c1 nmdc:mga09592_52389_c1_2073_2897 274
393 3300050509 nmdc:mga0qj67_257601_c1 nmdc:mga0qj67_257601_c1_271_1095 274
394 3300050509 nmdc:mga0qj67_602_c1 nmdc:mga0qj67_602_c1_10667_11536 274
395 3300050509 nmdc:mga0qj67_8928_c1 nmdc:mga0qj67_8928_c1_2526_3443 274
396 3300050510 nmdc:mga06r32_1130_c1 nmdc:mga06r32_1130_c1_17147_18016 274
397 3300050510 nmdc:mga06r32_116_c1 nmdc:mga06r32_116_c1_1955_2785 274
398 3300050510 nmdc:mga06r32_12490_c1 nmdc:mga06r32_12490_c1_4621_5583 274
399 3300050511 nmdc:mga08y16_418_c1 nmdc:mga08y16_418_c1_15169_15999 274
400 3300050512 nmdc:mga0n895_271732_c1 nmdc:mga0n895_271732_c1_846_1670 274
401 iso_pu_bacteria 2513237305 2514417119 274
402 iso_pu_bacteria 2687453743 2689995755 274
403 iso_pu_bacteria 2721755686 2723573684 274
404 iso_pu_bacteria 2857591370 2857597703 274
405 iso_pu_bacteria 2882632389 2882638379 274
406 iso_pu_bacteria 2929177148 2929182203 274
407 iso_pu_bacteria 2945977869 2945978120 274
408 iso_pu_bacteria 2946013367 2946016018 274
409 3300003762 Ga0055542_1000473 Ga0055542_10004738 275
410 3300003763 Ga0055529_1001655 Ga0055529_10016554 275
411 3300005339 Ga0070660_100125724 Ga0070660_1001257242 275
412 3300006038 Ga0075365_10018565 Ga0075365_100185652 275
413 3300009177 Ga0105248_10105441 Ga0105248_101054413 275
414 3300013296 Ga0157374_10043889 Ga0157374_100438894 275
415 3300014497 Ga0182008_10041905 Ga0182008_100419053 275
416 3300015261 Ga0182006_1018233 Ga0182006_10182334 275
417 3300025254 Ga0209148_1000317 Ga0209148_100031731 275
418 3300025272 Ga0209455_1000152 Ga0209455_100015238 275
419 3300025906 Ga0207699_10004374 Ga0207699_100043742 275
420 3300025961 Ga0207712_10080527 Ga0207712_100805273 275
421 3300025981 Ga0207640_10416393 Ga0207640_104163931 275
422 3300028379 Ga0268266_10182874 Ga0268266_101828742 275
423 3300031548 Ga0307408_100053577 Ga0307408_1000535774 275
424 3300031903 Ga0307407_10235378 Ga0307407_102353782 275
425 3300032002 Ga0307416_100118792 Ga0307416_1001187925 275
426 3300032002 Ga0307416_100288870 Ga0307416_1002888702 275
427 3300032005 Ga0307411_10339369 Ga0307411_103393692 275
428 3300032126 Ga0307415_100093379 Ga0307415_1000933793 275
429 3300035114 Ga0373939_0103532 Ga0373939_0103532_21_884 275
430 3300042157 Ga0439458_0064922 Ga0439458_0064922_60_887 275
431 3300046522 Ga0495643_0093533 Ga0495643_0093533_598_1425 275
432 3300046660 Ga0495625_0034942 Ga0495625_0034942_455_1282 275
433 3300048904 Ga0496101_0498368 Ga0496101_0498368_11_871 275
434 3300048915 Ga0496112_0097580 Ga0496112_0097580_702_1529 275
435 3300048918 Ga0496115_0185690 Ga0496115_0185690_600_1427 275
436 3300048922 Ga0496119_0020754 Ga0496119_0020754_2364_3191 275
437 3300048923 Ga0496120_0020735 Ga0496120_0020735_1517_2344 275
438 3300048928 Ga0496125_0253392 Ga0496125_0253392_68_895 275
439 3300050491 nmdc:mga00v17_80675_c1 nmdc:mga00v17_80675_c1_506_1333 275
440 3300050492 nmdc:mga0yw44_22118_c1 nmdc:mga0yw44_22118_c1_784_1611 275
441 3300053079 Ga0500610_0018828 Ga0500610_0018828_2356_3183 275
442 3300053139 Ga0500568_0087844 Ga0500568_0087844_314_1141 275
443 3300003320 rootH2_10104731 rootH2_101047315 276
444 3300003323 rootH1_10012489 rootH1_1001248912 276
445 3300003323 rootH1_10021689 rootH1_1002168914 276
446 3300005328 Ga0070676_10010283 Ga0070676_100102833 276
447 3300005329 Ga0070683_100067103 Ga0070683_1000671031 276
448 3300005336 Ga0070680_100189436 Ga0070680_1001894363 276
449 3300005347 Ga0070668_100005944 Ga0070668_1000059449 276
450 3300005353 Ga0070669_100011049 Ga0070669_1000110498 276
451 3300005356 Ga0070674_100165844 Ga0070674_1001658442 276
452 3300005457 Ga0070662_100039549 Ga0070662_1000395493 276
453 3300005458 Ga0070681_10160932 Ga0070681_101609324 276
454 3300005543 Ga0070672_100173110 Ga0070672_1001731103 276
455 3300005719 Ga0068861_100007839 Ga0068861_1000078399 276
456 3300005840 Ga0068870_10018877 Ga0068870_100188772 276
457 3300005844 Ga0068862_100089013 Ga0068862_1000890132 276
458 3300005981 Ga0081538_10008061 Ga0081538_1000806112 276
459 3300005981 Ga0081538_10014515 Ga0081538_100145151 276
460 3300005981 Ga0081538_10068170 Ga0081538_100681702 276
461 3300006058 Ga0075432_10022816 Ga0075432_100228162 276
462 3300006847 Ga0075431_100611911 Ga0075431_1006119111 276
463 3300006881 Ga0068865_100152647 Ga0068865_1001526471 276
464 3300006881 Ga0068865_100163314 Ga0068865_1001633142 276
465 3300009094 Ga0111539_10067716 Ga0111539_100677162 276
466 3300009148 Ga0105243_10177504 Ga0105243_101775043 276
467 3300013308 Ga0157375_10069680 Ga0157375_100696802 276
468 3300014325 Ga0163163_10046228 Ga0163163_100462282 276
469 3300014326 Ga0157380_10190935 Ga0157380_101909352 276
470 3300017792 Ga0163161_10163225 Ga0163161_101632252 276
471 3300025907 Ga0207645_10023677 Ga0207645_100236773 276
472 3300025916 Ga0207663_10341085 Ga0207663_103410851 276
473 3300025933 Ga0207706_10066553 Ga0207706_100665533 276
474 3300025938 Ga0207704_10180509 Ga0207704_101805092 276
475 3300025941 Ga0207711_10690431 Ga0207711_106904311 276
476 3300025961 Ga0207712_10007575 Ga0207712_100075752 276
477 3300026118 Ga0207675_100001666 Ga0207675_10000166615 276
478 3300027907 Ga0207428_10084225 Ga0207428_100842252 276
479 3300027907 Ga0207428_10470848 Ga0207428_104708481 276
480 3300028380 Ga0268265_10173433 Ga0268265_101734334 276
481 3300031730 Ga0307516_10036170 Ga0307516_100361706 276
482 3300031731 Ga0307405_10196285 Ga0307405_101962852 276
483 3300031733 Ga0316577_10021228 Ga0316577_100212285 276
484 3300032002 Ga0307416_100183621 Ga0307416_1001836212 276
485 3300032126 Ga0307415_100300147 Ga0307415_1003001472 276
486 3300032126 Ga0307415_100305534 Ga0307415_1003055342 276
487 3300049705 Ga0501225_0002424 Ga0501225_0002424_1033_1869 276
488 3300053098 Ga0500650_0057953 Ga0500650_0057953_549_1385 276
489 3300053153 Ga0500616_0045846 Ga0500616_0045846_610_1458 276
490 iso_pu_bacteria 2997600082 2997601828 276
491 3300002705 JGI25156J39149_1002552 JGI25156J39149_100255211 277
492 3300003214 JGI25165J46597_1000026 JGI25165J46597_1000026171 277
493 3300005356 Ga0070674_100088685 Ga0070674_1000886852 277
494 3300005471 Ga0070698_100072879 Ga0070698_1000728793 277
495 3300005518 Ga0070699_100147370 Ga0070699_1001473702 277
496 3300005548 Ga0070665_100012693 Ga0070665_1000126935 277
497 3300005719 Ga0068861_100298170 Ga0068861_1002981702 277
498 3300005981 Ga0081538_10040191 Ga0081538_100401913 277
499 3300006042 Ga0075368_10003550 Ga0075368_100035503 277
500 3300006175 Ga0070712_100089402 Ga0070712_1000894021 277
501 3300006844 Ga0075428_100014375 Ga0075428_1000143754 277
502 3300006844 Ga0075428_100082771 Ga0075428_1000827713 277
503 3300006847 Ga0075431_100077840 Ga0075431_1000778402 277
504 3300009147 Ga0114129_10050595 Ga0114129_100505951 277
505 3300025250 Ga0209026_1000032 Ga0209026_1000032327 277
506 3300025256 Ga0209759_1000168 Ga0209759_100016850 277
507 3300025261 Ga0209233_1000030 Ga0209233_1000030225 277
508 3300025900 Ga0207710_10028164 Ga0207710_100281642 277
509 3300025907 Ga0207645_10132361 Ga0207645_101323612 277
510 3300025914 Ga0207671_10008464 Ga0207671_100084642 277
511 3300025937 Ga0207669_10047566 Ga0207669_100475662 277
512 3300025981 Ga0207640_10195915 Ga0207640_101959151 277
513 3300028379 Ga0268266_10020894 Ga0268266_100208948 277
514 3300028379 Ga0268266_10047421 Ga0268266_100474213 277
515 3300031456 Ga0307513_10001099 Ga0307513_100010995 277
516 3300031665 Ga0316575_10000466 Ga0316575_100004661 277
517 3300031691 Ga0316579_10000459 Ga0316579_100004592 277
518 3300031727 Ga0316576_10002226 Ga0316576_100022262 277
519 3300031727 Ga0316576_10004642 Ga0316576_100046421 277
520 3300031728 Ga0316578_10002236 Ga0316578_100022365 277
521 3300031728 Ga0316578_10012723 Ga0316578_100127232 277
522 3300031733 Ga0316577_10000053 Ga0316577_1000005322 277
523 3300031733 Ga0316577_10171070 Ga0316577_101710702 277
524 3300031995 Ga0307409_100060888 Ga0307409_1000608883 277
525 3300032002 Ga0307416_100140286 Ga0307416_1001402861 277
526 3300032005 Ga0307411_10020972 Ga0307411_100209723 277
527 3300032133 Ga0316583_10038113 Ga0316583_100381132 277
528 3300032137 Ga0316585_10002691 Ga0316585_100026911 277
529 3300032139 Ga0316580_10000334 Ga0316580_100003348 277
530 3300032139 Ga0316580_10081140 Ga0316580_100811401 277
531 3300035398 Ga0316574_0000030 Ga0316574_0000030_25412_26275 277
532 3300038443 Ga0395901_0418758 Ga0395901_0418758_285_1142 277
533 3300039062 Ga0400483_221339 Ga0400483_221339_1265_2113 277
534 3300039093 Ga0400489_76699 Ga0400489_76699_1353_2210 277
535 3300041451 Ga0451791_0857751 Ga0451791_0857751_275_1144 277
536 3300041512 Ga0451853_2264629 Ga0451853_2264629_35_904 277
537 3300044683 Ga0466965_0155388 Ga0466965_0155388_285_1148 277
538 3300045049 Ga0466959_0192297 Ga0466959_0192297_287_1135 277
539 3300046477 Ga0495664_0124816 Ga0495664_0124816_622_1524 277
540 3300046524 Ga0495648_0080002 Ga0495648_0080002_117_971 277
541 3300046616 Ga0495668_0098943 Ga0495668_0098943_632_1465 277
542 3300046691 Ga0495670_0074961 Ga0495670_0074961_511_1377 277
543 3300048903 Ga0496100_0002990 Ga0496100_0002990_5968_6828 277
544 3300048907 Ga0496104_0008888 Ga0496104_0008888_7664_8524 277
545 3300048915 Ga0496112_0169958 Ga0496112_0169958_99_968 277
546 3300048918 Ga0496115_0003011 Ga0496115_0003011_1129_1989 277
547 3300048921 Ga0496118_0190301 Ga0496118_0190301_97_981 277
548 3300048925 Ga0496122_0000817 Ga0496122_0000817_2624_3508 277
549 3300048926 Ga0496123_0005275 Ga0496123_0005275_6891_7775 277
550 3300050490 nmdc:mga03n38_27801_c1 nmdc:mga03n38_27801_c1_277_1131 277
551 3300050492 nmdc:mga0yw44_165147_c1 nmdc:mga0yw44_165147_c1_506_1363 277
552 3300050496 nmdc:mga07m45_14362_c1 nmdc:mga07m45_14362_c1_3046_3879 277
553 3300050510 nmdc:mga06r32_6037_c1 nmdc:mga06r32_6037_c1_7690_8544 277
554 3300053155 Ga0500620_000145 Ga0500620_000145_6599_7432 277
555 3300053155 Ga0500620_008011 Ga0500620_008011_1354_2187 277
556 3300053158 Ga0500627_0066617 Ga0500627_0066617_26_904 277
557 3300053727 Ga0500611_005589 Ga0500611_005589_691_1524 277
558 iso_pu_bacteria 2515154129 2515721251 277
559 iso_pu_bacteria 3002141150 3002144097 277
560 iso_pu_bacteria 8048127548 8048131123 277
561 iso_pu_bacteria 8056207758 8056210833 277

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

83

253

0.84

PF13460

NAD_binding_10

NAD(P)H-binding

57

217

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l4l-assembly1.cif.gz_A polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 0.8366 9 272
2zcv-assembly1.cif.gz_A crystal structure of nadph-dependent quinone oxidoreductase qor2 complexed with nadph from escherichia coli 0.823 9 268
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.8217 7 272
2vrc-assembly1.cif.gz_C crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.8122 8 270
2vrb-assembly1.cif.gz_A-2 crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.8072 9 270
ID Description Score Start End Superfamily
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9019 10 269 3.40.50.720
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.878 9 62 3.40.50.720
af_Q55F90_2_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8716 9 183 3.40.50.720
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8466 10 269 3.40.50.720
af_Q2G0Y0_1_192_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8459 8 177 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Y3KUE2-F1-model_v4 NmrA family transcriptional regulator 0.9919 8 277
AF-A0A7W0W8K6-F1-model_v4 NAD(P)H-binding protein 0.9907 6 277
AF-A0A059E1U6-F1-model_v4 NAD(P)-binding domain-containing protein 0.9895 31 277
AF-A0A6H9YKD9-F1-model_v4 NAD(P)H-binding protein 0.9876 6 275
AF-A0A7Z7N6G5-F1-model_v4 Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains 0.9874 7 276

Feature Viewer

pLDDT pTM Quality
93.41 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map