F463818

General Info

Members Datasets Scaffolds Average Seq Length
561 282 1122 154

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10357205|Ga0105248_103572052
Length 175
Sequence MPGDESSHKFGAVSKNFENMSEHKATIAWTRSSPDFLKGKYSREHTWTFDGGLTVPASSALSSVPVPYSNPANVDPEEAFVAAVSSCHMLTFLFLASRQGFQADSYHDEAIGLMTKNDKGTPWVSSIKLMPIIAYSGDKLPTQADEERLHHLAHEQCFIANSIKTEVTVAVRRPA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
143 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
179 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
265 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
266 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
267 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
270 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 2508501050 Microvirga lupini Lut6 Isolate Nodule
275 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
276 2773857925 Microvirga vignae BR3299 Isolate Unclassified
277 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
278 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
279 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
280 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
281 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
282 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.53
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.32
Nodule 0.71
Rhizoplane 0.71
Rhizosphere 93.76
Stem 0
Stem Tuber 0
Unclassified 16.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10357205 3300009177 Unclassified 1645
2 rootH2_10052448 3300003320 Bacteria 1654
3 Ga0058862_11397262 3300004803 Bacteria 761
4 Ga0065712_10105587 3300005290 Unclassified 1936
5 Ga0065707_10254103 3300005295 Bacteria 1116
6 Ga0070658_10018657 3300005327 Bacteria 5556
7 Ga0070658_10401600 3300005327 Bacteria 1177
8 Ga0070658_10407151 3300005327 Bacteria 1169
9 Ga0070676_10120693 3300005328 Bacteria 1645
10 Ga0070676_10292751 3300005328 Bacteria 1101
11 Ga0070676_10379972 3300005328 Bacteria 978
12 Ga0070690_100963422 3300005330 Unclassified 670
13 Ga0068869_100088872 3300005334 Bacteria 2319
14 Ga0068869_100640575 3300005334 Bacteria 901
15 Ga0070666_10258724 3300005335 Unclassified 1234
16 Ga0070680_100860346 3300005336 Bacteria 782
17 Ga0068868_100700289 3300005338 Bacteria 906
18 Ga0070660_100234035 3300005339 Bacteria 1495
19 Ga0070660_100344372 3300005339 Unclassified 1227
20 Ga0070689_100003905 3300005340 Bacteria 9991
21 Ga0070689_100167420 3300005340 Unclassified 1779
22 Ga0070689_100672406 3300005340 Bacteria 902
23 Ga0070689_100745220 3300005340 Bacteria 858
24 Ga0070687_100228353 3300005343 Bacteria 1144
25 Ga0070661_100000581 3300005344 Bacteria 27755
26 Ga0070661_100476715 3300005344 Bacteria 996
27 Ga0070668_100408357 3300005347 Bacteria 1161
28 Ga0070669_100319359 3300005353 Bacteria 1253
29 Ga0070671_100001192 3300005355 Bacteria 19490
30 Ga0070671_100741967 3300005355 Bacteria 853
31 Ga0070674_100742229 3300005356 Bacteria 843
32 Ga0070659_100096127 3300005366 Bacteria 2380
33 Ga0070659_100231922 3300005366 Bacteria 1526
34 Ga0070659_101082845 3300005366 Bacteria 706
35 Ga0070667_100012951 3300005367 Bacteria 6895
36 Ga0070667_100023396 3300005367 Bacteria 5125
37 Ga0070714_100229152 3300005435 Bacteria 1711
38 Ga0070713_100133758 3300005436 Bacteria 2189
39 Ga0070711_100008228 3300005439 Bacteria 6381
40 Ga0070711_100297555 3300005439 Bacteria 1282
41 Ga0070705_100271588 3300005440 Unclassified 1201
42 Ga0070700_100153140 3300005441 Bacteria 1579
43 Ga0070694_100137570 3300005444 Bacteria 1771
44 Ga0070708_100673043 3300005445 Bacteria 975
45 Ga0070663_100084686 3300005455 Bacteria 2337
46 Ga0070663_101487115 3300005455 Bacteria 602
47 Ga0070678_100353526 3300005456 Bacteria 1264
48 Ga0070678_100357692 3300005456 Bacteria 1257
49 Ga0070681_10122865 3300005458 Bacteria 2529
50 Ga0070685_10100568 3300005466 Bacteria 1765
51 Ga0070685_10303283 3300005466 Unclassified 1077
52 Ga0070706_100074971 3300005467 Bacteria 3131
53 Ga0070707_100719188 3300005468 Bacteria 961
54 Ga0070707_101422065 3300005468 Bacteria 660
55 Ga0070699_100063879 3300005518 Bacteria 3193
56 Ga0070699_100114849 3300005518 Bacteria 2365
57 Ga0070699_101251604 3300005518 Bacteria 681
58 Ga0070679_100127818 3300005530 Bacteria 2523
59 Ga0070679_101258639 3300005530 Bacteria 685
60 Ga0070684_100086405 3300005535 Bacteria 2784
61 Ga0070684_100939475 3300005535 Unclassified 811
62 Ga0068853_100245106 3300005539 Bacteria 1643
63 Ga0068853_100281250 3300005539 Bacteria 1534
64 Ga0068853_100532385 3300005539 Unclassified 1112
65 Ga0070672_101019252 3300005543 Bacteria 734
66 Ga0070686_100220944 3300005544 Unclassified 1369
67 Ga0070695_100053825 3300005545 Bacteria 2589
68 Ga0070696_100077515 3300005546 Bacteria 2349
69 Ga0070693_100018215 3300005547 Bacteria 3665
70 Ga0070665_100092328 3300005548 Bacteria 3032
71 Ga0070665_100103881 3300005548 Bacteria 2844
72 Ga0070665_100108895 3300005548 Bacteria 2773
73 Ga0070665_100567546 3300005548 Unclassified 1147
74 Ga0070665_100604712 3300005548 Bacteria 1109
75 Ga0070665_100790046 3300005548 Bacteria 962
76 Ga0070665_101974959 3300005548 Bacteria 589
77 Ga0070704_100170358 3300005549 Bacteria 1731
78 Ga0070704_100478279 3300005549 Bacteria 1077
79 Ga0068855_100011417 3300005563 Bacteria 10730
80 Ga0068855_100071525 3300005563 Bacteria 4034
81 Ga0068855_100110735 3300005563 Bacteria 3151
82 Ga0068857_100191760 3300005577 Bacteria 1861
83 Ga0068857_100338693 3300005577 Bacteria 1391
84 Ga0068854_100190914 3300005578 Bacteria 1605
85 Ga0068856_100005449 3300005614 Bacteria 12536
86 Ga0068856_100323572 3300005614 Bacteria 1559
87 Ga0068856_101131885 3300005614 Unclassified 800
88 Ga0068856_101975643 3300005614 Unclassified 594
89 Ga0070702_100491111 3300005615 Bacteria 899
90 Ga0068859_100000397 3300005617 Bacteria 43279
91 Ga0068861_100066160 3300005719 Bacteria 2786
92 Ga0068870_10196939 3300005840 Bacteria 1219
93 Ga0068863_100003280 3300005841 Bacteria 15977
94 Ga0068863_100544949 3300005841 Bacteria 1145
95 Ga0068858_100004947 3300005842 Bacteria 13056
96 Ga0068858_100409162 3300005842 Bacteria 1304
97 Ga0068858_101306754 3300005842 Bacteria 714
98 Ga0068860_100001113 3300005843 Bacteria 29585
99 Ga0068860_100001302 3300005843 Bacteria 27105
100 Ga0068860_100050546 3300005843 Bacteria 3957
101 Ga0068860_100323102 3300005843 Bacteria 1515
102 Ga0081455_10000492 3300005937 Bacteria 51262
103 Ga0081455_10149597 3300005937 Unclassified 1801
104 Ga0081539_10458993 3300005985 Bacteria 528
105 Ga0070712_100456115 3300006175 Bacteria 1065
106 Ga0097621_100004514 3300006237 Bacteria 9704
107 Ga0097621_100127093 3300006237 Bacteria 2166
108 Ga0097621_100312154 3300006237 Unclassified 1391
109 Ga0068871_100069078 3300006358 Bacteria 2901
110 Ga0068871_100167875 3300006358 Bacteria 1879
111 Ga0075428_100191113 3300006844 Bacteria 2214
112 Ga0075431_100014429 3300006847 Bacteria 7992
113 Ga0075433_10585226 3300006852 Bacteria 980
114 Ga0075434_100799165 3300006871 Bacteria 960
115 Ga0075429_100047484 3300006880 Bacteria 3735
116 Ga0075429_100795248 3300006880 Bacteria 828
117 Ga0068865_100192759 3300006881 Bacteria 1577
118 Ga0075436_100347965 3300006914 Bacteria 1068
119 Ga0097620_100000397 3300006931 Bacteria 43279
120 Ga0075435_100481217 3300007076 Unclassified 1072
121 Ga0105250_10097562 3300009092 Bacteria 1198
122 Ga0105240_10002249 3300009093 Bacteria 31352
123 Ga0105240_10007319 3300009093 Bacteria 16060
124 Ga0105240_10023273 3300009093 Bacteria 8199
125 Ga0105240_10056550 3300009093 Unclassified 4909
126 Ga0105240_10071152 3300009093 Bacteria 4302
127 Ga0105240_10209592 3300009093 Bacteria 2278
128 Ga0105240_10332514 3300009093 Bacteria 1728
129 Ga0105240_10384958 3300009093 Bacteria 1583
130 Ga0105240_10394519 3300009093 Unclassified 1560
131 Ga0105240_10431705 3300009093 Bacteria 1478
132 Ga0105240_10486590 3300009093 Bacteria 1374
133 Ga0105240_10918431 3300009093 Unclassified 941
134 Ga0111539_10076222 3300009094 Bacteria 3949
135 Ga0111539_10433871 3300009094 Bacteria 1530
136 Ga0111539_10776483 3300009094 Bacteria 1115
137 Ga0111539_13118281 3300009094 Unclassified 535
138 Ga0105245_10052523 3300009098 Bacteria 3655
139 Ga0105245_10565262 3300009098 Bacteria 1160
140 Ga0105247_10000238 3300009101 Bacteria 51733
141 Ga0105247_10120059 3300009101 Unclassified 1702
142 Ga0105247_11173782 3300009101 Bacteria 610
143 Ga0114129_10061924 3300009147 Bacteria 5229
144 Ga0114129_10076990 3300009147 Bacteria 4642
145 Ga0114129_10401174 3300009147 Bacteria 1807
146 Ga0114129_10507042 3300009147 Unclassified 1575
147 Ga0114129_11000352 3300009147 Bacteria 1053
148 Ga0105243_10074910 3300009148 Bacteria 2746
149 Ga0105243_10250607 3300009148 Bacteria 1580
150 Ga0105241_10138879 3300009174 Bacteria 1976
151 Ga0105241_10150769 3300009174 Bacteria 1902
152 Ga0105241_10199388 3300009174 Bacteria 1671
153 Ga0105241_10313863 3300009174 Bacteria 1349
154 Ga0105241_10565970 3300009174 Bacteria 1022
155 Ga0105242_10074370 3300009176 Unclassified 2827
156 Ga0105242_10111776 3300009176 Bacteria 2330
157 Ga0105242_10263729 3300009176 Bacteria 1557
158 Ga0105248_10792179 3300009177 Bacteria 1070
159 Ga0105248_11352448 3300009177 Bacteria 806
160 Ga0105237_10295469 3300009545 Unclassified 1623
161 Ga0105237_10302465 3300009545 Unclassified 1603
162 Ga0105237_10438128 3300009545 Bacteria 1312
163 Ga0105237_10495191 3300009545 Unclassified 1229
164 Ga0105237_10589472 3300009545 Bacteria 1119
165 Ga0105237_10620510 3300009545 Unclassified 1088
166 Ga0105237_12063551 3300009545 Unclassified 579
167 Ga0105237_12459369 3300009545 Unclassified 531
168 Ga0105238_10008388 3300009551 Bacteria 10337
169 Ga0105238_10024668 3300009551 Bacteria 6130
170 Ga0105238_10053219 3300009551 Unclassified 4068
171 Ga0105238_10085036 3300009551 Bacteria 3152
172 Ga0105238_10167328 3300009551 Bacteria 2174
173 Ga0105238_10864210 3300009551 Bacteria 922
174 Ga0105249_10013091 3300009553 Bacteria 7322
175 Ga0105249_10048699 3300009553 Bacteria 3863
176 Ga0105249_10245695 3300009553 Bacteria 1772
177 Ga0105249_10763258 3300009553 Unclassified 1030
178 Ga0105249_11408827 3300009553 Bacteria 769
179 Ga0105249_11691609 3300009553 Bacteria 705
180 Ga0105239_10066128 3300010375 Bacteria 3972
181 Ga0105239_10142807 3300010375 Bacteria 2669
182 Ga0105239_10304548 3300010375 Bacteria 1795
183 Ga0105239_10361494 3300010375 Unclassified 1639
184 Ga0105239_11082822 3300010375 Unclassified 922
185 Ga0105246_10251630 3300011119 Bacteria 1402
186 Ga0157370_10463314 3300013104 Bacteria 1165
187 Ga0157369_10877987 3300013105 Unclassified 920
188 Ga0157374_10019746 3300013296 Bacteria 5970
189 Ga0157374_10703059 3300013296 Unclassified 1024
190 Ga0157378_10082944 3300013297 Bacteria 2900
191 Ga0157378_10108836 3300013297 Bacteria 2538
192 Ga0157378_11293745 3300013297 Unclassified 770
193 Ga0163162_10147651 3300013306 Unclassified 2468
194 Ga0163162_10167513 3300013306 Bacteria 2321
195 Ga0163162_10541270 3300013306 Bacteria 1293
196 Ga0163162_10735959 3300013306 Unclassified 1106
197 Ga0163162_11229428 3300013306 Bacteria 850
198 Ga0163162_11478768 3300013306 Unclassified 774
199 Ga0157372_11334412 3300013307 Bacteria 827
200 Ga0157375_10417216 3300013308 Bacteria 1508
201 Ga0163163_10060864 3300014325 Bacteria 3740
202 Ga0163163_10362402 3300014325 Bacteria 1506
203 Ga0157380_10285042 3300014326 Bacteria 1513
204 Ga0157379_10039025 3300014968 Bacteria 4236
205 Ga0157379_10048849 3300014968 Unclassified 3777
206 Ga0157379_10143905 3300014968 Bacteria 2150
207 Ga0157379_10244269 3300014968 Bacteria 1628
208 Ga0157379_10347047 3300014968 Bacteria 1358
209 Ga0157379_10377930 3300014968 Bacteria 1300
210 Ga0157376_10226838 3300014969 Bacteria 1733
211 Ga0163161_10714148 3300017792 Bacteria 836
212 Ga0163161_10916154 3300017792 Bacteria 743
213 Ga0207710_10000693 3300025900 Bacteria 18877
214 Ga0207688_10071525 3300025901 Bacteria 1969
215 Ga0207680_10143650 3300025903 Unclassified 1584
216 Ga0207647_10168316 3300025904 Unclassified 1276
217 Ga0207647_10416792 3300025904 Bacteria 755
218 Ga0207699_11223624 3300025906 Bacteria 556
219 Ga0207645_10158187 3300025907 Bacteria 1481
220 Ga0207705_10052003 3300025909 Bacteria 2948
221 Ga0207705_10298292 3300025909 Bacteria 1236
222 Ga0207705_10622450 3300025909 Bacteria 839
223 Ga0207705_10754648 3300025909 Bacteria 756
224 Ga0207705_10756136 3300025909 Bacteria 755
225 Ga0207684_10001578 3300025910 Bacteria 24315
226 Ga0207654_10127426 3300025911 Bacteria 1607
227 Ga0207654_10561613 3300025911 Unclassified 811
228 Ga0207654_11401260 3300025911 Bacteria 510
229 Ga0207695_10008082 3300025913 Bacteria 13237
230 Ga0207695_10020095 3300025913 Bacteria 7662
231 Ga0207695_10047044 3300025913 Bacteria 4569
232 Ga0207695_10077816 3300025913 Bacteria 3367
233 Ga0207695_10084740 3300025913 Unclassified 3199
234 Ga0207695_10268337 3300025913 Bacteria 1603
235 Ga0207695_10370131 3300025913 Bacteria 1319
236 Ga0207695_10382910 3300025913 Bacteria 1292
237 Ga0207695_10417932 3300025913 Bacteria 1225
238 Ga0207695_10661195 3300025913 Bacteria 926
239 Ga0207695_10704290 3300025913 Unclassified 890
240 Ga0207695_11084310 3300025913 Bacteria 681
241 Ga0207671_10189488 3300025914 Unclassified 1603
242 Ga0207671_10285945 3300025914 Bacteria 1301
243 Ga0207671_10345471 3300025914 Bacteria 1179
244 Ga0207663_10000627 3300025916 Bacteria 15650
245 Ga0207660_10944943 3300025917 Bacteria 703
246 Ga0207662_10151826 3300025918 Bacteria 1474
247 Ga0207662_10462437 3300025918 Unclassified 869
248 Ga0207657_10687630 3300025919 Bacteria 795
249 Ga0207657_10701556 3300025919 Unclassified 786
250 Ga0207652_10036153 3300025921 Bacteria 4176
251 Ga0207652_11000093 3300025921 Bacteria 735
252 Ga0207646_10008655 3300025922 Bacteria 10162
253 Ga0207646_10184125 3300025922 Bacteria 1886
254 Ga0207646_10385508 3300025922 Bacteria 1266
255 Ga0207646_10442048 3300025922 Bacteria 1173
256 Ga0207681_10674752 3300025923 Bacteria 858
257 Ga0207694_10025257 3300025924 Bacteria 4514
258 Ga0207694_10054082 3300025924 Bacteria 3114
259 Ga0207694_10127297 3300025924 Bacteria 2039
260 Ga0207694_10210557 3300025924 Bacteria 1583
261 Ga0207694_10241250 3300025924 Bacteria 1477
262 Ga0207687_10534555 3300025927 Unclassified 982
263 Ga0207687_10811532 3300025927 Unclassified 798
264 Ga0207644_10024033 3300025931 Bacteria 4179
265 Ga0207644_10174477 3300025931 Bacteria 1681
266 Ga0207690_11176164 3300025932 Bacteria 640
267 Ga0207686_10111139 3300025934 Unclassified 1849
268 Ga0207686_10428701 3300025934 Unclassified 1013
269 Ga0207709_10288741 3300025935 Bacteria 1215
270 Ga0207709_10555156 3300025935 Bacteria 904
271 Ga0207670_10405942 3300025936 Bacteria 1090
272 Ga0207670_11159574 3300025936 Bacteria 653
273 Ga0207670_11514002 3300025936 Unclassified 570
274 Ga0207704_10064869 3300025938 Bacteria 2284
275 Ga0207689_10022516 3300025942 Bacteria 5297
276 Ga0207689_10467951 3300025942 Bacteria 1055
277 Ga0207667_10009417 3300025949 Bacteria 11505
278 Ga0207667_10064378 3300025949 Bacteria 3828
279 Ga0207667_10194929 3300025949 Bacteria 2078
280 Ga0207667_11161632 3300025949 Bacteria 753
281 Ga0207651_11582261 3300025960 Bacteria 590
282 Ga0207712_10052486 3300025961 Bacteria 2856
283 Ga0207712_10188609 3300025961 Bacteria 1626
284 Ga0207658_10046628 3300025986 Bacteria 3166
285 Ga0207703_10017019 3300026035 Bacteria 5668
286 Ga0207703_10712463 3300026035 Unclassified 955
287 Ga0207639_10037164 3300026041 Bacteria 3615
288 Ga0207678_10008418 3300026067 Bacteria 9098
289 Ga0207678_11476555 3300026067 Bacteria 600
290 Ga0207708_10464104 3300026075 Bacteria 1056
291 Ga0207702_10150806 3300026078 Bacteria 2114
292 Ga0207702_11032175 3300026078 Unclassified 816
293 Ga0207702_11635811 3300026078 Bacteria 637
294 Ga0207641_10001753 3300026088 Bacteria 20925
295 Ga0207641_10005551 3300026088 Bacteria 10750
296 Ga0207641_10725369 3300026088 Unclassified 980
297 Ga0207641_10919625 3300026088 Bacteria 869
298 Ga0207648_10180224 3300026089 Bacteria 1870
299 Ga0207648_11488004 3300026089 Unclassified 636
300 Ga0207674_10052011 3300026116 Bacteria 4178
301 Ga0207674_10174127 3300026116 Bacteria 2104
302 Ga0207675_100049612 3300026118 Bacteria 3917
303 Ga0207675_100247562 3300026118 Bacteria 1724
304 Ga0207683_10199411 3300026121 Bacteria 1819
305 Ga0207683_10356009 3300026121 Bacteria 1344
306 Ga0268266_10003449 3300028379 Bacteria 15764
307 Ga0268266_10140205 3300028379 Bacteria 2169
308 Ga0268265_10008489 3300028380 Bacteria 6943
309 Ga0268265_10450015 3300028380 Unclassified 1203
310 Ga0268264_10000188 3300028381 Bacteria 129042
311 Ga0268264_10000659 3300028381 Bacteria 40567
312 Ga0268264_11106699 3300028381 Unclassified 801
313 Ga0265337_1000067 3300028556 Bacteria 48544
314 Ga0265337_1001306 3300028556 Bacteria 12432
315 Ga0265337_1077447 3300028556 Unclassified 911
316 Ga0265326_10128402 3300028558 Unclassified 722
317 Ga0265318_10254729 3300028577 Bacteria 640
318 Ga0265336_10017571 3300028666 Bacteria 2328
319 Ga0265338_10007464 3300028800 Bacteria 13558
320 Ga0265338_10026672 3300028800 Bacteria 5818
321 Ga0265338_10104141 3300028800 Bacteria 2303
322 Ga0265338_10372010 3300028800 Unclassified 1023
323 Ga0265338_10419913 3300028800 Unclassified 951
324 Ga0265338_10545268 3300028800 Bacteria 812
325 Ga0265320_10140359 3300031240 Unclassified 1094
326 Ga0265325_10063971 3300031241 Bacteria 1860
327 Ga0265329_10028123 3300031242 Bacteria 1844
328 Ga0265340_10195636 3300031247 Bacteria 910
329 Ga0265339_10298710 3300031249 Bacteria 768
330 Ga0265331_10000011 3300031250 Bacteria 308171
331 Ga0265331_10019027 3300031250 Bacteria 3550
332 Ga0265331_10031029 3300031250 Bacteria 2658
333 Ga0265331_10056167 3300031250 Bacteria 1870
334 Ga0265327_10001286 3300031251 Bacteria 32988
335 Ga0265327_10010980 3300031251 Bacteria 6300
336 Ga0265327_10053186 3300031251 Bacteria 2103
337 Ga0265316_10087342 3300031344 Bacteria 2383
338 Ga0307509_10000130 3300031507 Bacteria 111098
339 Ga0307408_100027235 3300031548 Bacteria 3937
340 Ga0307408_100163167 3300031548 Bacteria 1772
341 Ga0265313_10134635 3300031595 Bacteria 1067
342 Ga0265314_10167803 3300031711 Bacteria 1328
343 Ga0265342_10111280 3300031712 Bacteria 1550
344 Ga0307405_10226707 3300031731 Bacteria 1375
345 Ga0307410_10104651 3300031852 Bacteria 2035
346 Ga0307406_11300138 3300031901 Bacteria 635
347 Ga0307407_10916615 3300031903 Bacteria 673
348 Ga0307412_10085015 3300031911 Bacteria 2198
349 Ga0307412_10590112 3300031911 Bacteria 939
350 Ga0307409_100064226 3300031995 Bacteria 2883
351 Ga0307409_100158265 3300031995 Bacteria 1977
352 Ga0307415_100309899 3300032126 Bacteria 1311
353 Ga0373956_0043869 3300035119 Bacteria 1991
354 Ga0373960_0221887 3300035121 Unclassified 676
355 Ga0373943_0327237 3300035170 Bacteria 875
356 Ga0373933_0558983 3300035724 Bacteria 751
357 Ga0373937_0014534 3300036401 Bacteria 6952
358 Ga0373937_0081487 3300036401 Bacteria 2994
359 Ga0373937_0109620 3300036401 Bacteria 2567
360 Ga0373937_0316582 3300036401 Bacteria 1476
361 Ga0373925_0752472 3300037068 Bacteria 803
362 Ga0395899_0716273 3300037312 Unclassified 626
363 Ga0395900_0518641 3300037418 Unclassified 1140
364 Ga0395905_0205997 3300037471 Bacteria 1843
365 Ga0436365_0292851 3300039437 Bacteria 11194
366 Ga0451798_0043761 3300041458 Bacteria 1465
367 Ga0451849_0657777 3300041505 Bacteria 862
368 Ga0450909_030706 3300042185 Bacteria 815
369 Ga0451577_0009223 3300042876 Bacteria 9516
370 Ga0451577_0010919 3300042876 Bacteria 8630
371 Ga0466972_0053768 3300044658 Bacteria 1939
372 Ga0466972_0151653 3300044658 Bacteria 1090
373 Ga0466972_0195371 3300044658 Bacteria 948
374 Ga0453683_0034092 3300044673 Bacteria 3209
375 Ga0453683_0035884 3300044673 Bacteria 3122
376 Ga0453683_0826947 3300044673 Unclassified 610
377 Ga0453683_0996312 3300044673 Bacteria 556
378 Ga0453684_0258558 3300044712 Bacteria 1996
379 Ga0453684_0263646 3300044712 Bacteria 1972
380 Ga0453684_0455015 3300044712 Bacteria 1424
381 Ga0453684_1904935 3300044712 Bacteria 601
382 Ga0466970_0191954 3300044765 Bacteria 1135
383 Ga0466957_1156266 3300044842 Bacteria 559
384 Ga0466960_0087661 3300044901 Bacteria 1581
385 Ga0466960_0149117 3300044901 Bacteria 1248
386 Ga0466960_0190624 3300044901 Bacteria 1116
387 Ga0466959_0547146 3300045049 Bacteria 781
388 Ga0451576_0083065 3300045051 Bacteria 3332
389 Ga0451576_0384399 3300045051 Bacteria 1471
390 Ga0451576_0697604 3300045051 Bacteria 1067
391 Ga0451576_0891819 3300045051 Bacteria 933
392 Ga0451576_0937900 3300045051 Bacteria 908
393 Ga0451576_1692872 3300045051 Unclassified 655
394 Ga0495629_0040137 3300046459 Bacteria 3293
395 Ga0495641_0035073 3300046461 Bacteria 2368
396 Ga0495582_0189074 3300046473 Unclassified 1174
397 Ga0495605_0182832 3300046474 Bacteria 921
398 Ga0495594_0795244 3300046499 Bacteria 533
399 Ga0495607_0030680 3300046501 Bacteria 3298
400 Ga0495618_0006198 3300046514 Bacteria 7254
401 Ga0495630_0000126 3300046517 Bacteria 60933
402 Ga0495632_0494644 3300046519 Bacteria 528
403 Ga0495586_0000214 3300046535 Bacteria 38764
404 Ga0495586_0007676 3300046535 Bacteria 5750
405 Ga0495586_0048615 3300046535 Bacteria 2292
406 Ga0495586_0485696 3300046535 Unclassified 712
407 Ga0495586_0495904 3300046535 Bacteria 705
408 Ga0495622_0291735 3300046557 Unclassified 712
409 Ga0495667_0060554 3300046559 Bacteria 2483
410 Ga0495667_0168537 3300046559 Bacteria 1407
411 Ga0495668_0277999 3300046616 Bacteria 917
412 Ga0495634_0014669 3300046642 Bacteria 5642
413 Ga0495647_0250518 3300046681 Unclassified 788
414 Ga0495613_0036176 3300046689 Bacteria 3661
415 Ga0495613_0059003 3300046689 Bacteria 2814
416 Ga0495613_0217592 3300046689 Unclassified 1342
417 Ga0495613_0281626 3300046689 Unclassified 1154
418 Ga0495624_0952382 3300046690 Unclassified 504
419 Ga0495600_0809217 3300046809 Unclassified 558
420 Ga0495581_0151531 3300047315 Unclassified 1354
421 Ga0495636_0055013 3300047318 Bacteria 1673
422 Ga0495674_0018627 3300047319 Bacteria 6461
423 Ga0495674_0129921 3300047319 Bacteria 2123
424 Ga0495676_0241097 3300047321 Bacteria 1238
425 Ga0495675_0720357 3300047444 Unclassified 557
426 Ga0495684_0859826 3300047471 Unclassified 588
427 Ga0496104_0396718 3300048907 Bacteria 1292
428 Ga0496108_0180661 3300048911 Bacteria 1827
429 Ga0496114_0023684 3300048917 Bacteria 5011
430 Ga0496118_0237190 3300048921 Bacteria 1047
431 Ga0496119_0129014 3300048922 Bacteria 1380
432 Ga0496121_0002021 3300048924 Bacteria 32182
433 Ga0496121_0711501 3300048924 Unclassified 603
434 Ga0496125_0000280 3300048928 Bacteria 101989
435 Ga0496125_0023847 3300048928 Bacteria 5639
436 Ga0501305_015461 3300049161 Bacteria 1078
437 Ga0501321_014835 3300049537 Bacteria 911
438 Ga0501031_0305924 3300049568 Bacteria 1030
439 Ga0501032_0006860 3300049569 Bacteria 8348
440 Ga0501032_0185455 3300049569 Bacteria 1361
441 Ga0501033_0015428 3300049570 Bacteria 5796
442 Ga0501033_0018180 3300049570 Bacteria 5312
443 Ga0501033_0054002 3300049570 Bacteria 2974
444 Ga0501033_0064859 3300049570 Bacteria 2687
445 Ga0501033_0076703 3300049570 Bacteria 2453
446 Ga0501033_0213452 3300049570 Bacteria 1375
447 Ga0501033_0234510 3300049570 Bacteria 1303
448 Ga0501034_0001907 3300049571 Bacteria 26379
449 Ga0501034_0110221 3300049571 Bacteria 2744
450 Ga0501034_0187627 3300049571 Bacteria 2030
451 Ga0501034_0964788 3300049571 Unclassified 738
452 Ga0501036_0006200 3300049572 Bacteria 9703
453 Ga0501037_0002268 3300049573 Bacteria 13893
454 Ga0501037_0059160 3300049573 Bacteria 2796
455 Ga0501037_0229521 3300049573 Bacteria 1304
456 Ga0501037_0508780 3300049573 Unclassified 816
457 Ga0501038_0096443 3300049574 Bacteria 2468
458 Ga0501038_0131716 3300049574 Bacteria 2052
459 Ga0501038_0217663 3300049574 Bacteria 1525
460 Ga0501038_0226237 3300049574 Bacteria 1491
461 Ga0501038_0267912 3300049574 Bacteria 1348
462 Ga0501038_0441983 3300049574 Bacteria 1001
463 Ga0501039_0014104 3300049575 Bacteria 6118
464 Ga0501039_0156097 3300049575 Bacteria 1793
465 Ga0501039_0159107 3300049575 Bacteria 1775
466 Ga0501040_0028778 3300049576 Bacteria 3747
467 Ga0501040_0081462 3300049576 Bacteria 2243
468 Ga0501041_0032350 3300049577 Bacteria 3161
469 Ga0501042_0009587 3300049578 Bacteria 6461
470 Ga0501042_0468221 3300049578 Bacteria 914
471 Ga0501043_0006384 3300049579 Bacteria 9469
472 Ga0501043_0024318 3300049579 Bacteria 4754
473 Ga0501043_0077101 3300049579 Bacteria 2618
474 Ga0501043_0339310 3300049579 Bacteria 1143
475 Ga0501043_0721934 3300049579 Unclassified 726
476 Ga0501046_0001650 3300049580 Bacteria 21369
477 Ga0501046_0291992 3300049580 Bacteria 1192
478 Ga0501046_0359081 3300049580 Bacteria 1057
479 Ga0501047_0033383 3300049581 Bacteria 4967
480 Ga0501047_0111613 3300049581 Bacteria 2616
481 Ga0501047_0157216 3300049581 Bacteria 2146
482 Ga0501047_0277054 3300049581 Bacteria 1523
483 Ga0501047_0308173 3300049581 Bacteria 1424
484 Ga0501048_0004835 3300049582 Bacteria 10269
485 Ga0501067_0007097 3300049583 Bacteria 6221
486 Ga0501068_0034750 3300049584 Bacteria 3008
487 Ga0501068_0039165 3300049584 Bacteria 2842
488 Ga0501069_0003859 3300049585 Bacteria 7720
489 Ga0501070_0007811 3300049586 Bacteria 9067
490 Ga0501070_0050146 3300049586 Bacteria 3465
491 Ga0501070_0081504 3300049586 Bacteria 2677
492 Ga0501070_0498237 3300049586 Bacteria 979
493 Ga0501073_0014013 3300049589 Bacteria 5825
494 Ga0501073_0117478 3300049589 Bacteria 1843
495 Ga0501073_0662184 3300049589 Bacteria 720
496 Ga0501074_0017098 3300049590 Bacteria 5261
497 Ga0501075_0035432 3300049591 Bacteria 3722
498 Ga0501076_0037447 3300049592 Bacteria 3804
499 Ga0501076_0144636 3300049592 Bacteria 1933
500 Ga0501077_0014345 3300049593 Bacteria 4978
501 Ga0501079_0009813 3300049741 Bacteria 7260
502 Ga0501080_0023580 3300049742 Bacteria 5702
503 Ga0501080_0054141 3300049742 Bacteria 3737
504 Ga0501080_0107049 3300049742 Bacteria 2591
505 Ga0501080_0621781 3300049742 Bacteria 957
506 Ga0501080_0678332 3300049742 Bacteria 910
507 Ga0501081_0004049 3300049743 Bacteria 9393
508 Ga0501083_0001727 3300049744 Bacteria 14885
509 Ga0501083_0164942 3300049744 Bacteria 1448
510 Ga0501083_0530488 3300049744 Bacteria 766
511 Ga0501035_0053514 3300049822 Bacteria 3609
512 Ga0501035_0088713 3300049822 Bacteria 2724
513 Ga0501035_0125917 3300049822 Bacteria 2236
514 Ga0501035_0224034 3300049822 Bacteria 1605
515 Ga0501035_0378231 3300049822 Bacteria 1181
516 Ga0501035_1093891 3300049822 Bacteria 623
517 Ga0501044_0011647 3300049823 Bacteria 9532
518 Ga0501044_0140055 3300049823 Bacteria 2408
519 Ga0501044_0227812 3300049823 Bacteria 1812
520 Ga0501045_0441392 3300049824 Bacteria 968
521 nmdc:mga03683_290472_c1 3300050489 Bacteria 765
522 nmdc:mga00v17_324100_c1 3300050491 Bacteria 1001
523 nmdc:mga06z11_128726_c1 3300050494 Bacteria 1419
524 nmdc:mga06z11_256184_c1 3300050494 Bacteria 1031
525 nmdc:mga07m45_206594_c1 3300050496 Bacteria 1142
526 nmdc:mga05p37_145032_c1 3300050507 Bacteria 2908
527 nmdc:mga05p37_23473_c1 3300050507 Bacteria 7485
528 nmdc:mga05p37_385881_c1 3300050507 Bacteria 1640
529 nmdc:mga09592_2267_c1 3300050508 Bacteria 15491
530 nmdc:mga06r32_866377_c1 3300050510 Bacteria 861
531 nmdc:mga08y16_1962031_c1 3300050511 Unclassified 535
532 nmdc:mga0rr50_1726882_c1 3300050513 Bacteria 527
533 nmdc:mga0rr50_466089_c1 3300050513 Unclassified 1072
534 nmdc:mga08x19_366235_c1 3300050514 Bacteria 1008
535 nmdc:mga0a205_1010343_c1 3300050515 Bacteria 679
536 nmdc:mga0a205_378302_c1 3300050515 Bacteria 1281
537 nmdc:mga0a205_670930_c1 3300050515 Bacteria 887
538 Ga0500641_0151930 3300053096 Bacteria 999
539 Ga0500650_0056352 3300053098 Bacteria 1831
540 Ga0500650_0101662 3300053098 Bacteria 1344
541 Ga0500654_069955 3300053099 Bacteria 1719
542 Ga0500556_0001436 3300053104 Bacteria 10139
543 Ga0500568_0137475 3300053139 Bacteria 907
544 Ga0500589_073421 3300053147 Bacteria 1543
545 Ga0500604_0108127 3300053151 Bacteria 922
546 Ga0501084_0019197 3300054114 Bacteria 5693
547 Ga0501084_0666856 3300054114 Bacteria 878
548 Ga0501084_1635951 3300054114 Unclassified 538
549 Ga0590075_003681 3300059424 Unclassified 3637
550 Ga0501082_0003200 3300060353 Bacteria 14271
551 Ga0501082_0073160 3300060353 Bacteria 2952
552 Ga0501082_1351979 3300060353 Unclassified 622
553 2508731677 2508501050 Bacteria 9633614
554 2509080128 2508501114 Bacteria 7082538
555 2774872806 2773857925 Bacteria 6472445
556 2776261683 2775506901 Bacteria 9631051
557 2835313268 2835312727 Bacteria 7413381
558 2882456945 2882456835 Bacteria 6863978
559 2884299326 2884298095 Bacteria 3823049
560 2894237999 2894232714 Bacteria 8834183
561 2909399770 2909399089 Bacteria 3922598
562 Ga0105248_10357205
563 rootH2_10052448
564 Ga0058862_11397262
565 Ga0065712_10105587
566 Ga0065707_10254103
567 Ga0070658_10018657
568 Ga0070658_10401600
569 Ga0070658_10407151
570 Ga0070676_10120693
571 Ga0070676_10292751
572 Ga0070676_10379972
573 Ga0070690_100963422
574 Ga0068869_100088872
575 Ga0068869_100640575
576 Ga0070666_10258724
577 Ga0070680_100860346
578 Ga0068868_100700289
579 Ga0070660_100234035
580 Ga0070660_100344372
581 Ga0070689_100003905
582 Ga0070689_100167420
583 Ga0070689_100672406
584 Ga0070689_100745220
585 Ga0070687_100228353
586 Ga0070661_100000581
587 Ga0070661_100476715
588 Ga0070668_100408357
589 Ga0070669_100319359
590 Ga0070671_100001192
591 Ga0070671_100741967
592 Ga0070674_100742229
593 Ga0070659_100096127
594 Ga0070659_100231922
595 Ga0070659_101082845
596 Ga0070667_100012951
597 Ga0070667_100023396
598 Ga0070714_100229152
599 Ga0070713_100133758
600 Ga0070711_100008228
601 Ga0070711_100297555
602 Ga0070705_100271588
603 Ga0070700_100153140
604 Ga0070694_100137570
605 Ga0070708_100673043
606 Ga0070663_100084686
607 Ga0070663_101487115
608 Ga0070678_100353526
609 Ga0070678_100357692
610 Ga0070681_10122865
611 Ga0070685_10100568
612 Ga0070685_10303283
613 Ga0070706_100074971
614 Ga0070707_100719188
615 Ga0070707_101422065
616 Ga0070699_100063879
617 Ga0070699_100114849
618 Ga0070699_101251604
619 Ga0070679_100127818
620 Ga0070679_101258639
621 Ga0070684_100086405
622 Ga0070684_100939475
623 Ga0068853_100245106
624 Ga0068853_100281250
625 Ga0068853_100532385
626 Ga0070672_101019252
627 Ga0070686_100220944
628 Ga0070695_100053825
629 Ga0070696_100077515
630 Ga0070693_100018215
631 Ga0070665_100092328
632 Ga0070665_100103881
633 Ga0070665_100108895
634 Ga0070665_100567546
635 Ga0070665_100604712
636 Ga0070665_100790046
637 Ga0070665_101974959
638 Ga0070704_100170358
639 Ga0070704_100478279
640 Ga0068855_100011417
641 Ga0068855_100071525
642 Ga0068855_100110735
643 Ga0068857_100191760
644 Ga0068857_100338693
645 Ga0068854_100190914
646 Ga0068856_100005449
647 Ga0068856_100323572
648 Ga0068856_101131885
649 Ga0068856_101975643
650 Ga0070702_100491111
651 Ga0068859_100000397
652 Ga0068861_100066160
653 Ga0068870_10196939
654 Ga0068863_100003280
655 Ga0068863_100544949
656 Ga0068858_100004947
657 Ga0068858_100409162
658 Ga0068858_101306754
659 Ga0068860_100001113
660 Ga0068860_100001302
661 Ga0068860_100050546
662 Ga0068860_100323102
663 Ga0081455_10000492
664 Ga0081455_10149597
665 Ga0081539_10458993
666 Ga0070712_100456115
667 Ga0097621_100004514
668 Ga0097621_100127093
669 Ga0097621_100312154
670 Ga0068871_100069078
671 Ga0068871_100167875
672 Ga0075428_100191113
673 Ga0075431_100014429
674 Ga0075433_10585226
675 Ga0075434_100799165
676 Ga0075429_100047484
677 Ga0075429_100795248
678 Ga0068865_100192759
679 Ga0075436_100347965
680 Ga0097620_100000397
681 Ga0075435_100481217
682 Ga0105250_10097562
683 Ga0105240_10002249
684 Ga0105240_10007319
685 Ga0105240_10023273
686 Ga0105240_10056550
687 Ga0105240_10071152
688 Ga0105240_10209592
689 Ga0105240_10332514
690 Ga0105240_10384958
691 Ga0105240_10394519
692 Ga0105240_10431705
693 Ga0105240_10486590
694 Ga0105240_10918431
695 Ga0111539_10076222
696 Ga0111539_10433871
697 Ga0111539_10776483
698 Ga0111539_13118281
699 Ga0105245_10052523
700 Ga0105245_10565262
701 Ga0105247_10000238
702 Ga0105247_10120059
703 Ga0105247_11173782
704 Ga0114129_10061924
705 Ga0114129_10076990
706 Ga0114129_10401174
707 Ga0114129_10507042
708 Ga0114129_11000352
709 Ga0105243_10074910
710 Ga0105243_10250607
711 Ga0105241_10138879
712 Ga0105241_10150769
713 Ga0105241_10199388
714 Ga0105241_10313863
715 Ga0105241_10565970
716 Ga0105242_10074370
717 Ga0105242_10111776
718 Ga0105242_10263729
719 Ga0105248_10792179
720 Ga0105248_11352448
721 Ga0105237_10295469
722 Ga0105237_10302465
723 Ga0105237_10438128
724 Ga0105237_10495191
725 Ga0105237_10589472
726 Ga0105237_10620510
727 Ga0105237_12063551
728 Ga0105237_12459369
729 Ga0105238_10008388
730 Ga0105238_10024668
731 Ga0105238_10053219
732 Ga0105238_10085036
733 Ga0105238_10167328
734 Ga0105238_10864210
735 Ga0105249_10013091
736 Ga0105249_10048699
737 Ga0105249_10245695
738 Ga0105249_10763258
739 Ga0105249_11408827
740 Ga0105249_11691609
741 Ga0105239_10066128
742 Ga0105239_10142807
743 Ga0105239_10304548
744 Ga0105239_10361494
745 Ga0105239_11082822
746 Ga0105246_10251630
747 Ga0157370_10463314
748 Ga0157369_10877987
749 Ga0157374_10019746
750 Ga0157374_10703059
751 Ga0157378_10082944
752 Ga0157378_10108836
753 Ga0157378_11293745
754 Ga0163162_10147651
755 Ga0163162_10167513
756 Ga0163162_10541270
757 Ga0163162_10735959
758 Ga0163162_11229428
759 Ga0163162_11478768
760 Ga0157372_11334412
761 Ga0157375_10417216
762 Ga0163163_10060864
763 Ga0163163_10362402
764 Ga0157380_10285042
765 Ga0157379_10039025
766 Ga0157379_10048849
767 Ga0157379_10143905
768 Ga0157379_10244269
769 Ga0157379_10347047
770 Ga0157379_10377930
771 Ga0157376_10226838
772 Ga0163161_10714148
773 Ga0163161_10916154
774 Ga0207710_10000693
775 Ga0207688_10071525
776 Ga0207680_10143650
777 Ga0207647_10168316
778 Ga0207647_10416792
779 Ga0207699_11223624
780 Ga0207645_10158187
781 Ga0207705_10052003
782 Ga0207705_10298292
783 Ga0207705_10622450
784 Ga0207705_10754648
785 Ga0207705_10756136
786 Ga0207684_10001578
787 Ga0207654_10127426
788 Ga0207654_10561613
789 Ga0207654_11401260
790 Ga0207695_10008082
791 Ga0207695_10020095
792 Ga0207695_10047044
793 Ga0207695_10077816
794 Ga0207695_10084740
795 Ga0207695_10268337
796 Ga0207695_10370131
797 Ga0207695_10382910
798 Ga0207695_10417932
799 Ga0207695_10661195
800 Ga0207695_10704290
801 Ga0207695_11084310
802 Ga0207671_10189488
803 Ga0207671_10285945
804 Ga0207671_10345471
805 Ga0207663_10000627
806 Ga0207660_10944943
807 Ga0207662_10151826
808 Ga0207662_10462437
809 Ga0207657_10687630
810 Ga0207657_10701556
811 Ga0207652_10036153
812 Ga0207652_11000093
813 Ga0207646_10008655
814 Ga0207646_10184125
815 Ga0207646_10385508
816 Ga0207646_10442048
817 Ga0207681_10674752
818 Ga0207694_10025257
819 Ga0207694_10054082
820 Ga0207694_10127297
821 Ga0207694_10210557
822 Ga0207694_10241250
823 Ga0207687_10534555
824 Ga0207687_10811532
825 Ga0207644_10024033
826 Ga0207644_10174477
827 Ga0207690_11176164
828 Ga0207686_10111139
829 Ga0207686_10428701
830 Ga0207709_10288741
831 Ga0207709_10555156
832 Ga0207670_10405942
833 Ga0207670_11159574
834 Ga0207670_11514002
835 Ga0207704_10064869
836 Ga0207689_10022516
837 Ga0207689_10467951
838 Ga0207667_10009417
839 Ga0207667_10064378
840 Ga0207667_10194929
841 Ga0207667_11161632
842 Ga0207651_11582261
843 Ga0207712_10052486
844 Ga0207712_10188609
845 Ga0207658_10046628
846 Ga0207703_10017019
847 Ga0207703_10712463
848 Ga0207639_10037164
849 Ga0207678_10008418
850 Ga0207678_11476555
851 Ga0207708_10464104
852 Ga0207702_10150806
853 Ga0207702_11032175
854 Ga0207702_11635811
855 Ga0207641_10001753
856 Ga0207641_10005551
857 Ga0207641_10725369
858 Ga0207641_10919625
859 Ga0207648_10180224
860 Ga0207648_11488004
861 Ga0207674_10052011
862 Ga0207674_10174127
863 Ga0207675_100049612
864 Ga0207675_100247562
865 Ga0207683_10199411
866 Ga0207683_10356009
867 Ga0268266_10003449
868 Ga0268266_10140205
869 Ga0268265_10008489
870 Ga0268265_10450015
871 Ga0268264_10000188
872 Ga0268264_10000659
873 Ga0268264_11106699
874 Ga0265337_1000067
875 Ga0265337_1001306
876 Ga0265337_1077447
877 Ga0265326_10128402
878 Ga0265318_10254729
879 Ga0265336_10017571
880 Ga0265338_10007464
881 Ga0265338_10026672
882 Ga0265338_10104141
883 Ga0265338_10372010
884 Ga0265338_10419913
885 Ga0265338_10545268
886 Ga0265320_10140359
887 Ga0265325_10063971
888 Ga0265329_10028123
889 Ga0265340_10195636
890 Ga0265339_10298710
891 Ga0265331_10000011
892 Ga0265331_10019027
893 Ga0265331_10031029
894 Ga0265331_10056167
895 Ga0265327_10001286
896 Ga0265327_10010980
897 Ga0265327_10053186
898 Ga0265316_10087342
899 Ga0307509_10000130
900 Ga0307408_100027235
901 Ga0307408_100163167
902 Ga0265313_10134635
903 Ga0265314_10167803
904 Ga0265342_10111280
905 Ga0307405_10226707
906 Ga0307410_10104651
907 Ga0307406_11300138
908 Ga0307407_10916615
909 Ga0307412_10085015
910 Ga0307412_10590112
911 Ga0307409_100064226
912 Ga0307409_100158265
913 Ga0307415_100309899
914 Ga0373956_0043869
915 Ga0373960_0221887
916 Ga0373943_0327237
917 Ga0373933_0558983
918 Ga0373937_0014534
919 Ga0373937_0081487
920 Ga0373937_0109620
921 Ga0373937_0316582
922 Ga0373925_0752472
923 Ga0395899_0716273
924 Ga0395900_0518641
925 Ga0395905_0205997
926 Ga0436365_0292851
927 Ga0451798_0043761
928 Ga0451849_0657777
929 Ga0450909_030706
930 Ga0451577_0009223
931 Ga0451577_0010919
932 Ga0466972_0053768
933 Ga0466972_0151653
934 Ga0466972_0195371
935 Ga0453683_0034092
936 Ga0453683_0035884
937 Ga0453683_0826947
938 Ga0453683_0996312
939 Ga0453684_0258558
940 Ga0453684_0263646
941 Ga0453684_0455015
942 Ga0453684_1904935
943 Ga0466970_0191954
944 Ga0466957_1156266
945 Ga0466960_0087661
946 Ga0466960_0149117
947 Ga0466960_0190624
948 Ga0466959_0547146
949 Ga0451576_0083065
950 Ga0451576_0384399
951 Ga0451576_0697604
952 Ga0451576_0891819
953 Ga0451576_0937900
954 Ga0451576_1692872
955 Ga0495629_0040137
956 Ga0495641_0035073
957 Ga0495582_0189074
958 Ga0495605_0182832
959 Ga0495594_0795244
960 Ga0495607_0030680
961 Ga0495618_0006198
962 Ga0495630_0000126
963 Ga0495632_0494644
964 Ga0495586_0000214
965 Ga0495586_0007676
966 Ga0495586_0048615
967 Ga0495586_0485696
968 Ga0495586_0495904
969 Ga0495622_0291735
970 Ga0495667_0060554
971 Ga0495667_0168537
972 Ga0495668_0277999
973 Ga0495634_0014669
974 Ga0495647_0250518
975 Ga0495613_0036176
976 Ga0495613_0059003
977 Ga0495613_0217592
978 Ga0495613_0281626
979 Ga0495624_0952382
980 Ga0495600_0809217
981 Ga0495581_0151531
982 Ga0495636_0055013
983 Ga0495674_0018627
984 Ga0495674_0129921
985 Ga0495676_0241097
986 Ga0495675_0720357
987 Ga0495684_0859826
988 Ga0496104_0396718
989 Ga0496108_0180661
990 Ga0496114_0023684
991 Ga0496118_0237190
992 Ga0496119_0129014
993 Ga0496121_0002021
994 Ga0496121_0711501
995 Ga0496125_0000280
996 Ga0496125_0023847
997 Ga0501305_015461
998 Ga0501321_014835
999 Ga0501031_0305924
1000 Ga0501032_0006860
1001 Ga0501032_0185455
1002 Ga0501033_0015428
1003 Ga0501033_0018180
1004 Ga0501033_0054002
1005 Ga0501033_0064859
1006 Ga0501033_0076703
1007 Ga0501033_0213452
1008 Ga0501033_0234510
1009 Ga0501034_0001907
1010 Ga0501034_0110221
1011 Ga0501034_0187627
1012 Ga0501034_0964788
1013 Ga0501036_0006200
1014 Ga0501037_0002268
1015 Ga0501037_0059160
1016 Ga0501037_0229521
1017 Ga0501037_0508780
1018 Ga0501038_0096443
1019 Ga0501038_0131716
1020 Ga0501038_0217663
1021 Ga0501038_0226237
1022 Ga0501038_0267912
1023 Ga0501038_0441983
1024 Ga0501039_0014104
1025 Ga0501039_0156097
1026 Ga0501039_0159107
1027 Ga0501040_0028778
1028 Ga0501040_0081462
1029 Ga0501041_0032350
1030 Ga0501042_0009587
1031 Ga0501042_0468221
1032 Ga0501043_0006384
1033 Ga0501043_0024318
1034 Ga0501043_0077101
1035 Ga0501043_0339310
1036 Ga0501043_0721934
1037 Ga0501046_0001650
1038 Ga0501046_0291992
1039 Ga0501046_0359081
1040 Ga0501047_0033383
1041 Ga0501047_0111613
1042 Ga0501047_0157216
1043 Ga0501047_0277054
1044 Ga0501047_0308173
1045 Ga0501048_0004835
1046 Ga0501067_0007097
1047 Ga0501068_0034750
1048 Ga0501068_0039165
1049 Ga0501069_0003859
1050 Ga0501070_0007811
1051 Ga0501070_0050146
1052 Ga0501070_0081504
1053 Ga0501070_0498237
1054 Ga0501073_0014013
1055 Ga0501073_0117478
1056 Ga0501073_0662184
1057 Ga0501074_0017098
1058 Ga0501075_0035432
1059 Ga0501076_0037447
1060 Ga0501076_0144636
1061 Ga0501077_0014345
1062 Ga0501079_0009813
1063 Ga0501080_0023580
1064 Ga0501080_0054141
1065 Ga0501080_0107049
1066 Ga0501080_0621781
1067 Ga0501080_0678332
1068 Ga0501081_0004049
1069 Ga0501083_0001727
1070 Ga0501083_0164942
1071 Ga0501083_0530488
1072 Ga0501035_0053514
1073 Ga0501035_0088713
1074 Ga0501035_0125917
1075 Ga0501035_0224034
1076 Ga0501035_0378231
1077 Ga0501035_1093891
1078 Ga0501044_0011647
1079 Ga0501044_0140055
1080 Ga0501044_0227812
1081 Ga0501045_0441392
1082 nmdc:mga03683_290472_c1
1083 nmdc:mga00v17_324100_c1
1084 nmdc:mga06z11_128726_c1
1085 nmdc:mga06z11_256184_c1
1086 nmdc:mga07m45_206594_c1
1087 nmdc:mga05p37_145032_c1
1088 nmdc:mga05p37_23473_c1
1089 nmdc:mga05p37_385881_c1
1090 nmdc:mga09592_2267_c1
1091 nmdc:mga06r32_866377_c1
1092 nmdc:mga08y16_1962031_c1
1093 nmdc:mga0rr50_1726882_c1
1094 nmdc:mga0rr50_466089_c1
1095 nmdc:mga08x19_366235_c1
1096 nmdc:mga0a205_1010343_c1
1097 nmdc:mga0a205_378302_c1
1098 nmdc:mga0a205_670930_c1
1099 Ga0500641_0151930
1100 Ga0500650_0056352
1101 Ga0500650_0101662
1102 Ga0500654_069955
1103 Ga0500556_0001436
1104 Ga0500568_0137475
1105 Ga0500589_073421
1106 Ga0500604_0108127
1107 Ga0501084_0019197
1108 Ga0501084_0666856
1109 Ga0501084_1635951
1110 Ga0590075_003681
1111 Ga0501082_0003200
1112 Ga0501082_0073160
1113 Ga0501082_1351979
1114 2508731677
1115 2509080128
1116 2774872806
1117 2776261683
1118 2835313268
1119 2882456945
1120 2884299326
1121 2894237999
1122 2909399770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

69

172

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9305 1 145
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9244 1 145
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8539 1 144
1nye-assembly3.cif.gz_F crystal structure of osmc from e. coli 0.8457 1 144
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.8344 1 144
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9161 2 145 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.904 2 145 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8388 56 144 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8198 1 144 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8087 53 144 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A368B9L0-F1-model_v4 OsmC family peroxiredoxin 0.981 1 144
AF-A0A7V2S636-F1-model_v4 OsmC family peroxiredoxin 0.9734 1 144
AF-M6X437-F1-model_v4 deleted 0.9726 1 144
AF-A0A6N8AIA5-F1-model_v4 deleted 0.9723 1 144
AF-A0A521XYH1-F1-model_v4 OsmC family peroxiredoxin 0.9709 2 144

Map