F463721

General Info

Members Datasets Scaffolds Average Seq Length
560 276 1120 156

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0041337|Ga0439453_0041337_100_630
Length 176
Sequence MPYTLTVNGKPMTVDVPADTPLLWALRDVLNLKGTKFGCGIGQCGACTVHLGGQAVRSCQTAVSAVKGPVTTIEGLSPEGTHPVQRAWMEIDVPQCGYCQAGQIMSAAALLAAKPRPTDADINTAMNGNICRCATYARIRQAIHRAAELASNRRTSPPAARPGGQEPTFAKAPAGK

Samples

Sample ID Description Type Environment
1 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
151 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
159 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
185 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
186 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
215 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
255 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
269 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
274 2857558681 Duganella sp. R-74565 Isolate Unclassified
275 2857564685 Duganella sp. R-74599 Isolate Unclassified
276 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.36
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.18
Rhizoplane 0.89
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 1.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439453_0041337 3300041408 Bacteria 905
2 MRS1b_contig_146016 2162886011 Bacteria 916
3 JGI25406J46586_10002319 3300003203 Bacteria 8986
4 rootL2_10103083 3300003322 Bacteria 1593
5 Ga0055529_1000152 3300003763 Bacteria 98133
6 Ga0055526_1000079 3300003771 Bacteria 89698
7 Ga0065712_10072618 3300005290 Bacteria 4680
8 Ga0065712_10090597 3300005290 Bacteria 2413
9 Ga0065712_10378768 3300005290 Bacteria 754
10 Ga0065707_10090154 3300005295 Bacteria 4196
11 Ga0065707_10122890 3300005295 Unclassified 2046
12 Ga0065707_10141278 3300005295 Bacteria 1769
13 Ga0070676_10033642 3300005328 Unclassified 2941
14 Ga0070690_100191480 3300005330 Bacteria 1418
15 Ga0070690_100342253 3300005330 Bacteria 1083
16 Ga0070690_100714157 3300005330 Bacteria 771
17 Ga0070670_100048327 3300005331 Bacteria 3662
18 Ga0070670_100291214 3300005331 Bacteria 1427
19 Ga0068869_100102706 3300005334 Bacteria 2165
20 Ga0068869_100109686 3300005334 Bacteria 2098
21 Ga0068869_101557924 3300005334 Bacteria 588
22 Ga0070666_11126708 3300005335 Bacteria 584
23 Ga0070680_100297725 3300005336 Bacteria 1368
24 Ga0070680_100520747 3300005336 Bacteria 1018
25 Ga0068868_100352194 3300005338 Bacteria 1261
26 Ga0070689_100021168 3300005340 Bacteria 4835
27 Ga0070689_100032378 3300005340 Bacteria 3975
28 Ga0070689_100097320 3300005340 Bacteria 2327
29 Ga0070689_100117511 3300005340 Bacteria 2121
30 Ga0070689_100930725 3300005340 Bacteria 770
31 Ga0070687_100047066 3300005343 Bacteria 2211
32 Ga0070687_100066392 3300005343 Bacteria 1922
33 Ga0070692_10054889 3300005345 Bacteria 2082
34 Ga0070668_100006264 3300005347 Bacteria 8812
35 Ga0070668_100036925 3300005347 Bacteria 3729
36 Ga0070668_100142423 3300005347 Unclassified 1933
37 Ga0070669_100003027 3300005353 Bacteria 12087
38 Ga0070669_100004917 3300005353 Bacteria 9652
39 Ga0070669_100024893 3300005353 Bacteria 4295
40 Ga0070675_100000762 3300005354 Bacteria 22497
41 Ga0070675_100002773 3300005354 Bacteria 13182
42 Ga0070675_100010054 3300005354 Bacteria 7377
43 Ga0070675_100048224 3300005354 Bacteria 3492
44 Ga0070675_100546957 3300005354 Bacteria 1047
45 Ga0070675_100669705 3300005354 Bacteria 944
46 Ga0070671_100017604 3300005355 Bacteria 5790
47 Ga0070673_100068038 3300005364 Bacteria 2850
48 Ga0070673_100093956 3300005364 Bacteria 2457
49 Ga0070673_100577931 3300005364 Bacteria 1023
50 Ga0070673_101050257 3300005364 Bacteria 760
51 Ga0070688_100005398 3300005365 Bacteria 6727
52 Ga0070688_100017614 3300005365 Bacteria 4103
53 Ga0070688_100081460 3300005365 Bacteria 2096
54 Ga0070659_100884475 3300005366 Bacteria 780
55 Ga0070703_10053661 3300005406 Bacteria 1297
56 Ga0070709_10003905 3300005434 Bacteria 8040
57 Ga0070709_10004293 3300005434 Bacteria 7687
58 Ga0070709_10010091 3300005434 Bacteria 5220
59 Ga0070714_100058936 3300005435 Bacteria 3291
60 Ga0070714_100205571 3300005435 Bacteria 1803
61 Ga0070714_100209643 3300005435 Bacteria 1786
62 Ga0070714_100327411 3300005435 Bacteria 1434
63 Ga0070714_100516560 3300005435 Bacteria 1140
64 Ga0070714_101820003 3300005435 Bacteria 594
65 Ga0070713_100000310 3300005436 Bacteria 32210
66 Ga0070713_100033903 3300005436 Bacteria 4095
67 Ga0070713_101476878 3300005436 Bacteria 659
68 Ga0070713_101519171 3300005436 Bacteria 650
69 Ga0070713_101947171 3300005436 Bacteria 570
70 Ga0070710_10011925 3300005437 Bacteria 4307
71 Ga0070710_10110110 3300005437 Bacteria 1653
72 Ga0070701_10006261 3300005438 Bacteria 4993
73 Ga0070701_10021705 3300005438 Bacteria 3069
74 Ga0070701_10138465 3300005438 Bacteria 1389
75 Ga0070701_10141050 3300005438 Bacteria 1378
76 Ga0070701_10670956 3300005438 Bacteria 694
77 Ga0070711_100022073 3300005439 Bacteria 4122
78 Ga0070711_100043873 3300005439 Bacteria 3031
79 Ga0070711_100273347 3300005439 Bacteria 1334
80 Ga0070711_100434288 3300005439 Bacteria 1072
81 Ga0070711_101269262 3300005439 Bacteria 638
82 Ga0070705_100019272 3300005440 Bacteria 3590
83 Ga0070705_100044176 3300005440 Bacteria 2558
84 Ga0070705_100069565 3300005440 Bacteria 2123
85 Ga0070700_100338866 3300005441 Bacteria 1111
86 Ga0070700_100486313 3300005441 Bacteria 947
87 Ga0070694_100011168 3300005444 Bacteria 5562
88 Ga0070694_100033066 3300005444 Bacteria 3399
89 Ga0070694_100074043 3300005444 Bacteria 2353
90 Ga0070694_100135643 3300005444 Bacteria 1783
91 Ga0070708_100078765 3300005445 Bacteria 2979
92 Ga0070708_100466794 3300005445 Bacteria 1191
93 Ga0070678_100526898 3300005456 Unclassified 1046
94 Ga0070678_100966303 3300005456 Bacteria 781
95 Ga0070681_10179815 3300005458 Bacteria 2037
96 Ga0068867_100424918 3300005459 Bacteria 1126
97 Ga0070685_10209229 3300005466 Bacteria 1272
98 Ga0070706_100001799 3300005467 Bacteria 22198
99 Ga0070706_100084584 3300005467 Bacteria 2939
100 Ga0070706_100236765 3300005467 Bacteria 1705
101 Ga0070707_100560238 3300005468 Bacteria 1105
102 Ga0070707_100590779 3300005468 Bacteria 1073
103 Ga0070698_100007063 3300005471 Bacteria 12159
104 Ga0070698_100039428 3300005471 Bacteria 4862
105 Ga0070698_100063813 3300005471 Bacteria 3713
106 Ga0070698_100112262 3300005471 Bacteria 2691
107 Ga0070698_100169056 3300005471 Bacteria 2128
108 Ga0070699_100000931 3300005518 Bacteria 27307
109 Ga0070699_100004946 3300005518 Bacteria 11755
110 Ga0070699_100027156 3300005518 Bacteria 4938
111 Ga0070699_100062950 3300005518 Bacteria 3216
112 Ga0070699_100248613 3300005518 Bacteria 1588
113 Ga0070697_100009755 3300005536 Bacteria 7489
114 Ga0070697_100577790 3300005536 Bacteria 987
115 Ga0070672_100053407 3300005543 Bacteria 3159
116 Ga0070672_100060606 3300005543 Bacteria 2980
117 Ga0070672_100233418 3300005543 Bacteria 1546
118 Ga0070672_100321804 3300005543 Bacteria 1315
119 Ga0070695_100000165 3300005545 Bacteria 31530
120 Ga0070696_100000299 3300005546 Bacteria 29928
121 Ga0070696_100038115 3300005546 Bacteria 3316
122 Ga0070704_100002093 3300005549 Bacteria 11099
123 Ga0070704_100102923 3300005549 Bacteria 2156
124 Ga0070704_100335193 3300005549 Bacteria 1272
125 Ga0070704_100476151 3300005549 Bacteria 1080
126 Ga0070664_100046645 3300005564 Bacteria 3660
127 Ga0070664_100601230 3300005564 Bacteria 1020
128 Ga0068857_100026916 3300005577 Bacteria 5070
129 Ga0068857_100083476 3300005577 Bacteria 2854
130 Ga0068857_100091741 3300005577 Bacteria 2719
131 Ga0068857_100167209 3300005577 Bacteria 1998
132 Ga0068856_100002086 3300005614 Bacteria 20738
133 Ga0070702_100013434 3300005615 Bacteria 4134
134 Ga0068859_100000928 3300005617 Bacteria 30038
135 Ga0068859_100009409 3300005617 Bacteria 9870
136 Ga0068859_100016706 3300005617 Bacteria 7369
137 Ga0068859_100020897 3300005617 Bacteria 6570
138 Ga0068864_100118611 3300005618 Bacteria 2363
139 Ga0068864_100458653 3300005618 Bacteria 1220
140 Ga0068861_100006314 3300005719 Bacteria 8068
141 Ga0068861_100009853 3300005719 Bacteria 6609
142 Ga0068861_100052042 3300005719 Bacteria 3111
143 Ga0068870_10001215 3300005840 Bacteria 10361
144 Ga0068870_10033358 3300005840 Bacteria 2626
145 Ga0068870_10715788 3300005840 Bacteria 692
146 Ga0068863_100261012 3300005841 Bacteria 1675
147 Ga0068860_100084012 3300005843 Bacteria 3029
148 Ga0068862_100003850 3300005844 Bacteria 12780
149 Ga0068862_100013697 3300005844 Bacteria 6718
150 Ga0068862_100112864 3300005844 Bacteria 2387
151 Ga0081539_10000091 3300005985 Bacteria 211445
152 Ga0070717_10006220 3300006028 Bacteria 8769
153 Ga0070717_10028257 3300006028 Bacteria 4488
154 Ga0070717_10030111 3300006028 Bacteria 4360
155 Ga0070717_10302135 3300006028 Bacteria 1423
156 Ga0070717_10956181 3300006028 Bacteria 780
157 Ga0070715_10074238 3300006163 Bacteria 1527
158 Ga0070715_10099351 3300006163 Bacteria 1354
159 Ga0070716_100011364 3300006173 Bacteria 4482
160 Ga0070716_100024292 3300006173 Bacteria 3225
161 Ga0070716_100180511 3300006173 Bacteria 1385
162 Ga0070712_100018055 3300006175 Bacteria 4575
163 Ga0070712_100273123 3300006175 Bacteria 1359
164 Ga0070712_100430948 3300006175 Bacteria 1094
165 Ga0068871_100167707 3300006358 Bacteria 1880
166 Ga0075428_100388152 3300006844 Bacteria 1497
167 Ga0075428_100896305 3300006844 Bacteria 941
168 Ga0075431_100157268 3300006847 Bacteria 2338
169 Ga0075431_100824455 3300006847 Bacteria 900
170 Ga0075433_10055739 3300006852 Bacteria 3451
171 Ga0075433_10253094 3300006852 Bacteria 1562
172 Ga0075434_100130278 3300006871 Bacteria 2534
173 Ga0068865_100153791 3300006881 Bacteria 1748
174 Ga0068865_100550233 3300006881 Bacteria 969
175 Ga0075436_100025110 3300006914 Bacteria 4098
176 Ga0097620_100000928 3300006931 Bacteria 30038
177 Ga0097620_100009409 3300006931 Bacteria 9870
178 Ga0097620_100016705 3300006931 Bacteria 7369
179 Ga0097620_100020898 3300006931 Bacteria 6570
180 Ga0075435_100019483 3300007076 Bacteria 5185
181 Ga0075435_100089208 3300007076 Bacteria 2542
182 Ga0099794_10043739 3300007265 Bacteria 2139
183 Ga0099795_10031632 3300007788 Bacteria 1823
184 Ga0105244_10010117 3300009036 Bacteria 5742
185 Ga0105240_10132375 3300009093 Bacteria 2990
186 Ga0111539_10002741 3300009094 Bacteria 23388
187 Ga0111539_10036855 3300009094 Bacteria 5910
188 Ga0111539_10039605 3300009094 Bacteria 5678
189 Ga0111539_10733097 3300009094 Bacteria 1150
190 Ga0111539_11133010 3300009094 Bacteria 909
191 Ga0114129_10003883 3300009147 Bacteria 21085
192 Ga0114129_10021937 3300009147 Bacteria 9062
193 Ga0114129_10179595 3300009147 Bacteria 2881
194 Ga0114129_10212337 3300009147 Bacteria 2615
195 Ga0105243_10052699 3300009148 Bacteria 3223
196 Ga0105243_10082562 3300009148 Bacteria 2627
197 Ga0105243_11057409 3300009148 Bacteria 818
198 Ga0105241_10512557 3300009174 Bacteria 1071
199 Ga0105242_10303461 3300009176 Bacteria 1458
200 Ga0105248_10205451 3300009177 Bacteria 2220
201 Ga0105237_10176606 3300009545 Bacteria 2136
202 Ga0105249_10028419 3300009553 Bacteria 5047
203 Ga0105249_10197304 3300009553 Bacteria 1968
204 Ga0105249_10364523 3300009553 Bacteria 1467
205 Ga0099796_10000897 3300010159 Bacteria 5523
206 Ga0099796_10098845 3300010159 Bacteria 1095
207 Ga0105246_10489876 3300011119 Bacteria 1042
208 Ga0157374_10570372 3300013296 Bacteria 1140
209 Ga0157374_10655642 3300013296 Bacteria 1062
210 Ga0157378_10644288 3300013297 Unclassified 1075
211 Ga0157378_10876982 3300013297 Bacteria 927
212 Ga0157378_11281556 3300013297 Bacteria 774
213 Ga0163162_10203242 3300013306 Bacteria 2110
214 Ga0163162_10345736 3300013306 Bacteria 1620
215 Ga0157372_10092104 3300013307 Bacteria 3448
216 Ga0157372_10456582 3300013307 Bacteria 1489
217 Ga0157375_10011529 3300013308 Bacteria 7805
218 Ga0157375_10289380 3300013308 Bacteria 1801
219 Ga0157375_10331557 3300013308 Bacteria 1687
220 Ga0157375_10462911 3300013308 Bacteria 1433
221 Ga0157375_11243586 3300013308 Bacteria 874
222 Ga0157380_10000293 3300014326 Bacteria 30049
223 Ga0157380_10014300 3300014326 Bacteria 5805
224 Ga0157377_10000935 3300014745 Bacteria 12232
225 Ga0157377_10002046 3300014745 Bacteria 8847
226 Ga0157377_10067467 3300014745 Bacteria 2060
227 Ga0157377_10177384 3300014745 Bacteria 1337
228 Ga0157376_10095958 3300014969 Bacteria 2580
229 Ga0182007_10043103 3300015262 Bacteria 1500
230 Ga0163161_10730482 3300017792 Bacteria 827
231 Ga0213872_10000430 3300021361 Bacteria 34377
232 Ga0213872_10002336 3300021361 Bacteria 11273
233 Ga0213872_10014114 3300021361 Bacteria 3731
234 Ga0213872_10033039 3300021361 Bacteria 2371
235 Ga0209455_1000070 3300025272 Bacteria 307867
236 Ga0209564_1000047 3300025295 Bacteria 368031
237 Ga0207697_10024410 3300025315 Bacteria 2475
238 Ga0207655_1001651 3300025728 Bacteria 19767
239 Ga0207653_10091710 3300025885 Bacteria 1065
240 Ga0207653_10121806 3300025885 Bacteria 940
241 Ga0207692_10024528 3300025898 Bacteria 2805
242 Ga0207685_10012145 3300025905 Bacteria 2618
243 Ga0207699_10005635 3300025906 Bacteria 6010
244 Ga0207699_10025630 3300025906 Bacteria 3239
245 Ga0207699_10044376 3300025906 Bacteria 2587
246 Ga0207645_10042973 3300025907 Unclassified 2892
247 Ga0207645_10605818 3300025907 Bacteria 744
248 Ga0207643_10005958 3300025908 Bacteria 6513
249 Ga0207643_10014555 3300025908 Bacteria 4276
250 Ga0207684_10007935 3300025910 Bacteria 9484
251 Ga0207684_10070738 3300025910 Bacteria 2965
252 Ga0207684_10070968 3300025910 Bacteria 2960
253 Ga0207684_10109508 3300025910 Bacteria 2364
254 Ga0207684_10233633 3300025910 Bacteria 1586
255 Ga0207684_11637222 3300025910 Bacteria 520
256 Ga0207707_10218596 3300025912 Bacteria 1659
257 Ga0207707_10280105 3300025912 Bacteria 1444
258 Ga0207693_10000164 3300025915 Bacteria 59739
259 Ga0207693_10019885 3300025915 Bacteria 5340
260 Ga0207693_10114759 3300025915 Bacteria 2114
261 Ga0207693_10286389 3300025915 Bacteria 1291
262 Ga0207663_10147686 3300025916 Bacteria 1645
263 Ga0207662_10020642 3300025918 Bacteria 3760
264 Ga0207662_10093918 3300025918 Bacteria 1849
265 Ga0207646_10022452 3300025922 Bacteria 5812
266 Ga0207646_10149273 3300025922 Bacteria 2108
267 Ga0207681_10005212 3300025923 Bacteria 7981
268 Ga0207681_10014865 3300025923 Bacteria 4847
269 Ga0207681_10028439 3300025923 Bacteria 3621
270 Ga0207681_10872083 3300025923 Bacteria 753
271 Ga0207650_10021340 3300025925 Bacteria 4576
272 Ga0207650_10182595 3300025925 Bacteria 1672
273 Ga0207659_10000862 3300025926 Bacteria 18012
274 Ga0207659_10011304 3300025926 Bacteria 5638
275 Ga0207659_10028386 3300025926 Bacteria 3802
276 Ga0207659_10028744 3300025926 Bacteria 3781
277 Ga0207659_10265413 3300025926 Bacteria 1398
278 Ga0207659_10568389 3300025926 Bacteria 965
279 Ga0207700_10021209 3300025928 Bacteria 4430
280 Ga0207700_10025016 3300025928 Bacteria 4140
281 Ga0207700_10039973 3300025928 Bacteria 3419
282 Ga0207700_10239115 3300025928 Bacteria 1547
283 Ga0207700_10970907 3300025928 Bacteria 760
284 Ga0207700_11054112 3300025928 Bacteria 727
285 Ga0207664_10037391 3300025929 Bacteria 3756
286 Ga0207664_10101888 3300025929 Bacteria 2373
287 Ga0207664_10653374 3300025929 Bacteria 945
288 Ga0207644_10330971 3300025931 Bacteria 1233
289 Ga0207690_10375895 3300025932 Bacteria 1128
290 Ga0207709_10034528 3300025935 Bacteria 2981
291 Ga0207670_10068514 3300025936 Bacteria 2445
292 Ga0207670_10142441 3300025936 Bacteria 1769
293 Ga0207670_10150141 3300025936 Bacteria 1728
294 Ga0207670_10303275 3300025936 Bacteria 1251
295 Ga0207670_10639836 3300025936 Bacteria 876
296 Ga0207670_11163775 3300025936 Bacteria 652
297 Ga0207704_10196016 3300025938 Bacteria 1473
298 Ga0207665_10004406 3300025939 Bacteria 9357
299 Ga0207665_10012756 3300025939 Bacteria 5526
300 Ga0207665_10014027 3300025939 Bacteria 5271
301 Ga0207691_10039335 3300025940 Bacteria 4375
302 Ga0207691_10171118 3300025940 Bacteria 1902
303 Ga0207691_10197794 3300025940 Bacteria 1750
304 Ga0207689_10093896 3300025942 Bacteria 2464
305 Ga0207689_10143959 3300025942 Bacteria 1964
306 Ga0207689_10153347 3300025942 Bacteria 1899
307 Ga0207689_11172071 3300025942 Bacteria 647
308 Ga0207679_10103940 3300025945 Bacteria 2227
309 Ga0207651_10097049 3300025960 Bacteria 2175
310 Ga0207651_10311342 3300025960 Bacteria 1313
311 Ga0207651_11503685 3300025960 Bacteria 606
312 Ga0207712_10123015 3300025961 Bacteria 1966
313 Ga0207712_10330719 3300025961 Bacteria 1260
314 Ga0207712_10748877 3300025961 Bacteria 856
315 Ga0207668_10093808 3300025972 Bacteria 2212
316 Ga0207668_10128215 3300025972 Unclassified 1933
317 Ga0207668_10485894 3300025972 Bacteria 1060
318 Ga0207703_10075086 3300026035 Bacteria 2800
319 Ga0207639_10201922 3300026041 Bacteria 1706
320 Ga0207708_10021331 3300026075 Bacteria 4884
321 Ga0207708_10219819 3300026075 Bacteria 1522
322 Ga0207702_10000396 3300026078 Bacteria 49721
323 Ga0207702_10414518 3300026078 Bacteria 1301
324 Ga0207641_10203205 3300026088 Bacteria 1828
325 Ga0207641_10828216 3300026088 Bacteria 916
326 Ga0207648_10004040 3300026089 Bacteria 15229
327 Ga0207676_10103695 3300026095 Bacteria 2364
328 Ga0207674_10029664 3300026116 Bacteria 5756
329 Ga0207674_10033168 3300026116 Bacteria 5406
330 Ga0207674_10087445 3300026116 Bacteria 3110
331 Ga0207674_10168482 3300026116 Bacteria 2144
332 Ga0207674_10742525 3300026116 Bacteria 947
333 Ga0207674_11318686 3300026116 Bacteria 691
334 Ga0207675_100003057 3300026118 Bacteria 16412
335 Ga0207675_100016035 3300026118 Bacteria 6995
336 Ga0207675_100063535 3300026118 Bacteria 3449
337 Ga0207683_10951378 3300026121 Bacteria 798
338 Ga0209588_1037790 3300027671 Bacteria 1555
339 Ga0207428_10018943 3300027907 Bacteria 5870
340 Ga0207428_10449238 3300027907 Bacteria 940
341 Ga0268265_10004707 3300028380 Bacteria 9419
342 Ga0268265_10038365 3300028380 Bacteria 3523
343 Ga0268265_10424323 3300028380 Bacteria 1235
344 Ga0268264_10002485 3300028381 Bacteria 16199
345 Ga0265319_1006681 3300028563 Bacteria 5306
346 Ga0265319_1013795 3300028563 Bacteria 3195
347 Ga0265318_10086090 3300028577 Bacteria 1158
348 Ga0265338_10204136 3300028800 Bacteria 1488
349 Ga0265338_10409005 3300028800 Bacteria 966
350 Ga0316181_1114137 3300030744 Bacteria 3751
351 Ga0265762_1000069 3300030760 Bacteria 13612
352 Ga0265320_10002549 3300031240 Bacteria 12657
353 Ga0265325_10104650 3300031241 Bacteria 1382
354 Ga0307408_100323450 3300031548 Bacteria 1300
355 Ga0265314_10003231 3300031711 Bacteria 15933
356 Ga0307413_10323128 3300031824 Bacteria 1180
357 Ga0307409_100516546 3300031995 Bacteria 1166
358 Ga0316214_1038220 3300033545 Bacteria 687
359 Ga0373928_0051422 3300035084 Bacteria 974
360 Ga0373940_0039179 3300035088 Bacteria 1296
361 Ga0373932_0050470 3300035112 Bacteria 1233
362 Ga0373936_0006620 3300035113 Bacteria 4363
363 Ga0373939_0011925 3300035114 Bacteria 2206
364 Ga0373941_0073671 3300035115 Bacteria 1139
365 Ga0373945_0018360 3300035116 Bacteria 2379
366 Ga0373945_0130006 3300035116 Bacteria 1008
367 Ga0373943_0037224 3300035170 Bacteria 2335
368 Ga0373955_0158868 3300035172 Bacteria 1333
369 Ga0373955_0737684 3300035172 Bacteria 605
370 Ga0373942_0142472 3300035207 Bacteria 764
371 Ga0373962_0076685 3300035242 Bacteria 1008
372 Ga0373931_0448877 3300035691 Bacteria 824
373 Ga0373935_0013278 3300035692 Bacteria 4969
374 Ga0373935_0198814 3300035692 Bacteria 1384
375 Ga0373935_0229259 3300035692 Bacteria 1293
376 Ga0373935_1114598 3300035692 Bacteria 587
377 Ga0373927_0005941 3300035695 Bacteria 8359
378 Ga0373927_0545773 3300035695 Bacteria 766
379 Ga0373933_0442727 3300035724 Bacteria 849
380 Ga0373947_0005735 3300035725 Bacteria 7237
381 Ga0373947_0079091 3300035725 Bacteria 2031
382 Ga0373937_0101520 3300036401 Bacteria 2670
383 Ga0373937_1062375 3300036401 Bacteria 758
384 Ga0373925_0007810 3300037068 Bacteria 7790
385 Ga0373925_0313208 3300037068 Bacteria 1269
386 Ga0373925_0485046 3300037068 Bacteria 1014
387 Ga0373925_1075258 3300037068 Bacteria 662
388 Ga0395899_0154558 3300037312 Bacteria 1624
389 Ga0395900_0009261 3300037418 Bacteria 10095
390 Ga0395898_0755028 3300037466 Bacteria 914
391 Ga0395905_0008819 3300037471 Bacteria 9909
392 Ga0395905_0628423 3300037471 Bacteria 976
393 Ga0436365_1150739 3300039437 Bacteria 748
394 Ga0436361_0896173 3300039447 Bacteria 6982
395 Ga0436361_1091442 3300039447 Bacteria 27914
396 Ga0451841_0341929 3300041498 Bacteria 671
397 Ga0450896_020665 3300042133 Bacteria 964
398 Ga0450898_099176 3300042134 Bacteria 607
399 Ga0450906_072153 3300042145 Bacteria 619
400 Ga0451577_0000523 3300042876 Bacteria 63915
401 Ga0451577_0248007 3300042876 Bacteria 1612
402 Ga0453683_0053721 3300044673 Bacteria 2521
403 Ga0466965_0137596 3300044683 Bacteria 1270
404 Ga0453684_0112853 3300044712 Bacteria 3298
405 Ga0466970_0057414 3300044765 Bacteria 2081
406 Ga0466959_0027614 3300045049 Bacteria 4208
407 Ga0451576_0046432 3300045051 Bacteria 4572
408 Ga0451576_0307644 3300045051 Bacteria 1658
409 Ga0451576_1236416 3300045051 Bacteria 779
410 Ga0495617_152165 3300046452 Bacteria 735
411 Ga0495603_0220565 3300046455 Bacteria 1094
412 Ga0495629_0101683 3300046459 Bacteria 2005
413 Ga0495629_0108466 3300046459 Bacteria 1936
414 Ga0495638_0000898 3300046460 Bacteria 30438
415 Ga0495638_0077160 3300046460 Bacteria 2029
416 Ga0495650_0000254 3300046471 Bacteria 103512
417 Ga0495580_0000550 3300046472 Bacteria 31699
418 Ga0495580_0007540 3300046472 Bacteria 8735
419 Ga0495580_0011725 3300046472 Bacteria 6770
420 Ga0495580_0013129 3300046472 Bacteria 6341
421 Ga0495580_0276033 3300046472 Bacteria 1147
422 Ga0495580_0815624 3300046472 Bacteria 604
423 Ga0495582_0002059 3300046473 Bacteria 11248
424 Ga0495582_0002896 3300046473 Bacteria 9591
425 Ga0495582_0272901 3300046473 Bacteria 971
426 Ga0495605_0002046 3300046474 Bacteria 12721
427 Ga0495584_0000232 3300046491 Bacteria 40218
428 Ga0495584_0056463 3300046491 Bacteria 1975
429 Ga0495584_0097595 3300046491 Bacteria 1484
430 Ga0495594_0026880 3300046499 Bacteria 3099
431 Ga0495607_0067210 3300046501 Bacteria 2014
432 Ga0495607_0107652 3300046501 Bacteria 1482
433 Ga0495607_0304740 3300046501 Bacteria 748
434 Ga0495583_0000150 3300046506 Bacteria 117772
435 Ga0495606_0002891 3300046507 Bacteria 18970
436 Ga0495610_0012678 3300046512 Bacteria 5052
437 Ga0495610_0028490 3300046512 Bacteria 2953
438 Ga0495616_0006939 3300046513 Bacteria 6818
439 Ga0495616_0062358 3300046513 Bacteria 1826
440 Ga0495630_0092727 3300046517 Bacteria 2283
441 Ga0495630_0263039 3300046517 Bacteria 1318
442 Ga0495643_0000250 3300046522 Bacteria 78905
443 Ga0495644_0001124 3300046523 Bacteria 10982
444 Ga0495644_0009837 3300046523 Bacteria 3680
445 Ga0495648_0001108 3300046524 Bacteria 27307
446 Ga0495648_0313521 3300046524 Bacteria 730
447 Ga0495663_0007320 3300046525 Bacteria 3048
448 Ga0495642_0009119 3300046528 Bacteria 3798
449 Ga0495642_0182293 3300046528 Bacteria 914
450 Ga0495642_0355467 3300046528 Bacteria 644
451 Ga0495665_0002968 3300046531 Bacteria 9165
452 Ga0495665_0247848 3300046531 Bacteria 917
453 Ga0495598_0417356 3300046537 Bacteria 527
454 Ga0495609_0001318 3300046538 Bacteria 16863
455 Ga0495609_0123365 3300046538 Bacteria 1113
456 Ga0495621_0009240 3300046539 Bacteria 2988
457 Ga0495622_0120635 3300046557 Bacteria 1197
458 Ga0495633_0025435 3300046558 Bacteria 2915
459 Ga0495633_0060963 3300046558 Bacteria 1767
460 Ga0495656_0033992 3300046615 Bacteria 2084
461 Ga0495611_0162816 3300046648 Bacteria 1042
462 Ga0495625_0006366 3300046660 Bacteria 10539
463 Ga0495625_0040195 3300046660 Bacteria 3413
464 Ga0495625_0052454 3300046660 Bacteria 2920
465 Ga0495659_0001728 3300046664 Bacteria 7268
466 Ga0495659_0004011 3300046664 Bacteria 4661
467 Ga0495659_0005726 3300046664 Bacteria 3918
468 Ga0495659_0046534 3300046664 Bacteria 1566
469 Ga0495659_0071974 3300046664 Bacteria 1297
470 Ga0495661_0120300 3300046665 Bacteria 1451
471 Ga0495588_0083619 3300046674 Bacteria 1667
472 Ga0495658_0001926 3300046683 Bacteria 10607
473 Ga0495658_0016075 3300046683 Bacteria 3850
474 Ga0495658_0052197 3300046683 Bacteria 2318
475 Ga0495658_0576917 3300046683 Bacteria 720
476 Ga0495669_0036522 3300046684 Bacteria 2172
477 Ga0495670_0000577 3300046691 Bacteria 17523
478 Ga0495670_0088329 3300046691 Bacteria 1584
479 Ga0495670_0348787 3300046691 Bacteria 796
480 Ga0495671_0035322 3300046692 Bacteria 2538
481 Ga0495671_0039973 3300046692 Bacteria 2366
482 Ga0495671_0088298 3300046692 Bacteria 1518
483 Ga0495671_0115638 3300046692 Bacteria 1309
484 Ga0495649_0002493 3300046694 Bacteria 12924
485 Ga0495581_0015902 3300047315 Bacteria 4371
486 Ga0495581_0268482 3300047315 Bacteria 998
487 Ga0495636_0000457 3300047318 Bacteria 15157
488 Ga0495636_0014977 3300047318 Bacteria 3088
489 Ga0495636_0015207 3300047318 Bacteria 3066
490 Ga0495636_0226628 3300047318 Bacteria 859
491 Ga0495672_0004405 3300047320 Bacteria 11546
492 Ga0495672_0038857 3300047320 Bacteria 2899
493 Ga0495672_0172669 3300047320 Bacteria 1101
494 Ga0495676_0027421 3300047321 Bacteria 4884
495 Ga0495683_0000690 3300047323 Bacteria 24691
496 Ga0495687_000057 3300047443 Bacteria 186224
497 Ga0495677_0015576 3300047445 Bacteria 2762
498 Ga0495677_0176005 3300047445 Bacteria 828
499 Ga0495677_0254963 3300047445 Bacteria 686
500 Ga0495685_043637 3300047447 Bacteria 1530
501 Ga0495673_0003158 3300047469 Bacteria 11024
502 Ga0495673_0269966 3300047469 Bacteria 616
503 Ga0495684_0349670 3300047471 Bacteria 1050
504 Ga0495686_0130907 3300047472 Bacteria 1487
505 Ga0495593_0144560 3300047673 Bacteria 1204
506 Ga0495614_0182781 3300048089 Bacteria 944
507 Ga0496102_1943728 3300048905 Bacteria 505
508 Ga0496106_0143843 3300048909 Bacteria 1877
509 Ga0496106_0745328 3300048909 Bacteria 779
510 Ga0496107_0213842 3300048910 Bacteria 1434
511 Ga0496114_0297724 3300048917 Bacteria 1424
512 Ga0496121_0079305 3300048924 Bacteria 2607
513 Ga0496126_0062541 3300048929 Bacteria 3340
514 Ga0495678_000095 3300049459 Bacteria 109532
515 Ga0495678_016555 3300049459 Bacteria 3366
516 Ga0495682_0000089 3300049460 Bacteria 80020
517 Ga0495682_0000432 3300049460 Bacteria 29176
518 Ga0501034_0178692 3300049571 Bacteria 2088
519 Ga0501068_0565030 3300049584 Bacteria 740
520 Ga0501069_0669247 3300049585 Bacteria 625
521 Ga0501073_0072865 3300049589 Bacteria 2392
522 Ga0501077_0560510 3300049593 Bacteria 733
523 Ga0501249_044967 3300049679 Bacteria 1007
524 Ga0501269_000043 3300049766 Bacteria 38904
525 nmdc:mga05p37_10603_c1 3300050507 Bacteria 10930
526 nmdc:mga05p37_392034_c1 3300050507 Bacteria 1624
527 nmdc:mga05p37_39798_c1 3300050507 Bacteria 5772
528 nmdc:mga05p37_64136_c1 3300050507 Bacteria 4520
529 nmdc:mga09592_105343_c1 3300050508 Bacteria 2418
530 nmdc:mga09592_1404286_c1 3300050508 Bacteria 571
531 nmdc:mga09592_199108_c1 3300050508 Bacteria 1734
532 nmdc:mga06r32_126638_c1 3300050510 Bacteria 2523
533 nmdc:mga06r32_51861_c1 3300050510 Bacteria 3927
534 nmdc:mga08y16_1017966_c1 3300050511 Bacteria 807
535 nmdc:mga08y16_120787_c1 3300050511 Bacteria 2727
536 nmdc:mga08y16_417488_c1 3300050511 Bacteria 1372
537 nmdc:mga0n895_137810_c1 3300050512 Bacteria 2468
538 nmdc:mga0n895_161464_c1 3300050512 Bacteria 2273
539 nmdc:mga0n895_18571_c1 3300050512 Bacteria 6438
540 nmdc:mga0n895_245235_c1 3300050512 Bacteria 1818
541 nmdc:mga0n895_417545_c1 3300050512 Bacteria 1356
542 nmdc:mga0n895_645839_c1 3300050512 Bacteria 1057
543 nmdc:mga0n895_66380_c1 3300050512 Bacteria 3573
544 nmdc:mga0rr50_162993_c1 3300050513 Bacteria 1811
545 nmdc:mga0rr50_224593_c1 3300050513 Bacteria 1552
546 nmdc:mga0rr50_36501_c1 3300050513 Bacteria 3540
547 nmdc:mga0rr50_752736_c1 3300050513 Bacteria 831
548 nmdc:mga08x19_3319_c1 3300050514 Bacteria 9623
549 nmdc:mga08x19_44857_c1 3300050514 Bacteria 2824
550 nmdc:mga0a205_12872_c1 3300050515 Bacteria 7762
551 nmdc:mga0a205_31119_c1 3300050515 Bacteria 5110
552 Ga0500562_003291 3300053108 Bacteria 4036
553 Ga0500593_256178 3300053117 Bacteria 589
554 Ga0500568_0006532 3300053139 Bacteria 5841
555 Ga0500616_0061006 3300053153 Bacteria 1954
556 Ga0587111_0016270 3300060346 Bacteria 1371
557 2644030783 2643221603 Bacteria 6147767
558 2857562332 2857558681 Bacteria 6617694
559 2857568285 2857564685 Bacteria 6290584
560 2894027810 2894023352 Bacteria 5167372
561 Ga0439453_0041337
562 MRS1b_contig_146016
563 JGI25406J46586_10002319
564 rootL2_10103083
565 Ga0055529_1000152
566 Ga0055526_1000079
567 Ga0065712_10072618
568 Ga0065712_10090597
569 Ga0065712_10378768
570 Ga0065707_10090154
571 Ga0065707_10122890
572 Ga0065707_10141278
573 Ga0070676_10033642
574 Ga0070690_100191480
575 Ga0070690_100342253
576 Ga0070690_100714157
577 Ga0070670_100048327
578 Ga0070670_100291214
579 Ga0068869_100102706
580 Ga0068869_100109686
581 Ga0068869_101557924
582 Ga0070666_11126708
583 Ga0070680_100297725
584 Ga0070680_100520747
585 Ga0068868_100352194
586 Ga0070689_100021168
587 Ga0070689_100032378
588 Ga0070689_100097320
589 Ga0070689_100117511
590 Ga0070689_100930725
591 Ga0070687_100047066
592 Ga0070687_100066392
593 Ga0070692_10054889
594 Ga0070668_100006264
595 Ga0070668_100036925
596 Ga0070668_100142423
597 Ga0070669_100003027
598 Ga0070669_100004917
599 Ga0070669_100024893
600 Ga0070675_100000762
601 Ga0070675_100002773
602 Ga0070675_100010054
603 Ga0070675_100048224
604 Ga0070675_100546957
605 Ga0070675_100669705
606 Ga0070671_100017604
607 Ga0070673_100068038
608 Ga0070673_100093956
609 Ga0070673_100577931
610 Ga0070673_101050257
611 Ga0070688_100005398
612 Ga0070688_100017614
613 Ga0070688_100081460
614 Ga0070659_100884475
615 Ga0070703_10053661
616 Ga0070709_10003905
617 Ga0070709_10004293
618 Ga0070709_10010091
619 Ga0070714_100058936
620 Ga0070714_100205571
621 Ga0070714_100209643
622 Ga0070714_100327411
623 Ga0070714_100516560
624 Ga0070714_101820003
625 Ga0070713_100000310
626 Ga0070713_100033903
627 Ga0070713_101476878
628 Ga0070713_101519171
629 Ga0070713_101947171
630 Ga0070710_10011925
631 Ga0070710_10110110
632 Ga0070701_10006261
633 Ga0070701_10021705
634 Ga0070701_10138465
635 Ga0070701_10141050
636 Ga0070701_10670956
637 Ga0070711_100022073
638 Ga0070711_100043873
639 Ga0070711_100273347
640 Ga0070711_100434288
641 Ga0070711_101269262
642 Ga0070705_100019272
643 Ga0070705_100044176
644 Ga0070705_100069565
645 Ga0070700_100338866
646 Ga0070700_100486313
647 Ga0070694_100011168
648 Ga0070694_100033066
649 Ga0070694_100074043
650 Ga0070694_100135643
651 Ga0070708_100078765
652 Ga0070708_100466794
653 Ga0070678_100526898
654 Ga0070678_100966303
655 Ga0070681_10179815
656 Ga0068867_100424918
657 Ga0070685_10209229
658 Ga0070706_100001799
659 Ga0070706_100084584
660 Ga0070706_100236765
661 Ga0070707_100560238
662 Ga0070707_100590779
663 Ga0070698_100007063
664 Ga0070698_100039428
665 Ga0070698_100063813
666 Ga0070698_100112262
667 Ga0070698_100169056
668 Ga0070699_100000931
669 Ga0070699_100004946
670 Ga0070699_100027156
671 Ga0070699_100062950
672 Ga0070699_100248613
673 Ga0070697_100009755
674 Ga0070697_100577790
675 Ga0070672_100053407
676 Ga0070672_100060606
677 Ga0070672_100233418
678 Ga0070672_100321804
679 Ga0070695_100000165
680 Ga0070696_100000299
681 Ga0070696_100038115
682 Ga0070704_100002093
683 Ga0070704_100102923
684 Ga0070704_100335193
685 Ga0070704_100476151
686 Ga0070664_100046645
687 Ga0070664_100601230
688 Ga0068857_100026916
689 Ga0068857_100083476
690 Ga0068857_100091741
691 Ga0068857_100167209
692 Ga0068856_100002086
693 Ga0070702_100013434
694 Ga0068859_100000928
695 Ga0068859_100009409
696 Ga0068859_100016706
697 Ga0068859_100020897
698 Ga0068864_100118611
699 Ga0068864_100458653
700 Ga0068861_100006314
701 Ga0068861_100009853
702 Ga0068861_100052042
703 Ga0068870_10001215
704 Ga0068870_10033358
705 Ga0068870_10715788
706 Ga0068863_100261012
707 Ga0068860_100084012
708 Ga0068862_100003850
709 Ga0068862_100013697
710 Ga0068862_100112864
711 Ga0081539_10000091
712 Ga0070717_10006220
713 Ga0070717_10028257
714 Ga0070717_10030111
715 Ga0070717_10302135
716 Ga0070717_10956181
717 Ga0070715_10074238
718 Ga0070715_10099351
719 Ga0070716_100011364
720 Ga0070716_100024292
721 Ga0070716_100180511
722 Ga0070712_100018055
723 Ga0070712_100273123
724 Ga0070712_100430948
725 Ga0068871_100167707
726 Ga0075428_100388152
727 Ga0075428_100896305
728 Ga0075431_100157268
729 Ga0075431_100824455
730 Ga0075433_10055739
731 Ga0075433_10253094
732 Ga0075434_100130278
733 Ga0068865_100153791
734 Ga0068865_100550233
735 Ga0075436_100025110
736 Ga0097620_100000928
737 Ga0097620_100009409
738 Ga0097620_100016705
739 Ga0097620_100020898
740 Ga0075435_100019483
741 Ga0075435_100089208
742 Ga0099794_10043739
743 Ga0099795_10031632
744 Ga0105244_10010117
745 Ga0105240_10132375
746 Ga0111539_10002741
747 Ga0111539_10036855
748 Ga0111539_10039605
749 Ga0111539_10733097
750 Ga0111539_11133010
751 Ga0114129_10003883
752 Ga0114129_10021937
753 Ga0114129_10179595
754 Ga0114129_10212337
755 Ga0105243_10052699
756 Ga0105243_10082562
757 Ga0105243_11057409
758 Ga0105241_10512557
759 Ga0105242_10303461
760 Ga0105248_10205451
761 Ga0105237_10176606
762 Ga0105249_10028419
763 Ga0105249_10197304
764 Ga0105249_10364523
765 Ga0099796_10000897
766 Ga0099796_10098845
767 Ga0105246_10489876
768 Ga0157374_10570372
769 Ga0157374_10655642
770 Ga0157378_10644288
771 Ga0157378_10876982
772 Ga0157378_11281556
773 Ga0163162_10203242
774 Ga0163162_10345736
775 Ga0157372_10092104
776 Ga0157372_10456582
777 Ga0157375_10011529
778 Ga0157375_10289380
779 Ga0157375_10331557
780 Ga0157375_10462911
781 Ga0157375_11243586
782 Ga0157380_10000293
783 Ga0157380_10014300
784 Ga0157377_10000935
785 Ga0157377_10002046
786 Ga0157377_10067467
787 Ga0157377_10177384
788 Ga0157376_10095958
789 Ga0182007_10043103
790 Ga0163161_10730482
791 Ga0213872_10000430
792 Ga0213872_10002336
793 Ga0213872_10014114
794 Ga0213872_10033039
795 Ga0209455_1000070
796 Ga0209564_1000047
797 Ga0207697_10024410
798 Ga0207655_1001651
799 Ga0207653_10091710
800 Ga0207653_10121806
801 Ga0207692_10024528
802 Ga0207685_10012145
803 Ga0207699_10005635
804 Ga0207699_10025630
805 Ga0207699_10044376
806 Ga0207645_10042973
807 Ga0207645_10605818
808 Ga0207643_10005958
809 Ga0207643_10014555
810 Ga0207684_10007935
811 Ga0207684_10070738
812 Ga0207684_10070968
813 Ga0207684_10109508
814 Ga0207684_10233633
815 Ga0207684_11637222
816 Ga0207707_10218596
817 Ga0207707_10280105
818 Ga0207693_10000164
819 Ga0207693_10019885
820 Ga0207693_10114759
821 Ga0207693_10286389
822 Ga0207663_10147686
823 Ga0207662_10020642
824 Ga0207662_10093918
825 Ga0207646_10022452
826 Ga0207646_10149273
827 Ga0207681_10005212
828 Ga0207681_10014865
829 Ga0207681_10028439
830 Ga0207681_10872083
831 Ga0207650_10021340
832 Ga0207650_10182595
833 Ga0207659_10000862
834 Ga0207659_10011304
835 Ga0207659_10028386
836 Ga0207659_10028744
837 Ga0207659_10265413
838 Ga0207659_10568389
839 Ga0207700_10021209
840 Ga0207700_10025016
841 Ga0207700_10039973
842 Ga0207700_10239115
843 Ga0207700_10970907
844 Ga0207700_11054112
845 Ga0207664_10037391
846 Ga0207664_10101888
847 Ga0207664_10653374
848 Ga0207644_10330971
849 Ga0207690_10375895
850 Ga0207709_10034528
851 Ga0207670_10068514
852 Ga0207670_10142441
853 Ga0207670_10150141
854 Ga0207670_10303275
855 Ga0207670_10639836
856 Ga0207670_11163775
857 Ga0207704_10196016
858 Ga0207665_10004406
859 Ga0207665_10012756
860 Ga0207665_10014027
861 Ga0207691_10039335
862 Ga0207691_10171118
863 Ga0207691_10197794
864 Ga0207689_10093896
865 Ga0207689_10143959
866 Ga0207689_10153347
867 Ga0207689_11172071
868 Ga0207679_10103940
869 Ga0207651_10097049
870 Ga0207651_10311342
871 Ga0207651_11503685
872 Ga0207712_10123015
873 Ga0207712_10330719
874 Ga0207712_10748877
875 Ga0207668_10093808
876 Ga0207668_10128215
877 Ga0207668_10485894
878 Ga0207703_10075086
879 Ga0207639_10201922
880 Ga0207708_10021331
881 Ga0207708_10219819
882 Ga0207702_10000396
883 Ga0207702_10414518
884 Ga0207641_10203205
885 Ga0207641_10828216
886 Ga0207648_10004040
887 Ga0207676_10103695
888 Ga0207674_10029664
889 Ga0207674_10033168
890 Ga0207674_10087445
891 Ga0207674_10168482
892 Ga0207674_10742525
893 Ga0207674_11318686
894 Ga0207675_100003057
895 Ga0207675_100016035
896 Ga0207675_100063535
897 Ga0207683_10951378
898 Ga0209588_1037790
899 Ga0207428_10018943
900 Ga0207428_10449238
901 Ga0268265_10004707
902 Ga0268265_10038365
903 Ga0268265_10424323
904 Ga0268264_10002485
905 Ga0265319_1006681
906 Ga0265319_1013795
907 Ga0265318_10086090
908 Ga0265338_10204136
909 Ga0265338_10409005
910 Ga0316181_1114137
911 Ga0265762_1000069
912 Ga0265320_10002549
913 Ga0265325_10104650
914 Ga0307408_100323450
915 Ga0265314_10003231
916 Ga0307413_10323128
917 Ga0307409_100516546
918 Ga0316214_1038220
919 Ga0373928_0051422
920 Ga0373940_0039179
921 Ga0373932_0050470
922 Ga0373936_0006620
923 Ga0373939_0011925
924 Ga0373941_0073671
925 Ga0373945_0018360
926 Ga0373945_0130006
927 Ga0373943_0037224
928 Ga0373955_0158868
929 Ga0373955_0737684
930 Ga0373942_0142472
931 Ga0373962_0076685
932 Ga0373931_0448877
933 Ga0373935_0013278
934 Ga0373935_0198814
935 Ga0373935_0229259
936 Ga0373935_1114598
937 Ga0373927_0005941
938 Ga0373927_0545773
939 Ga0373933_0442727
940 Ga0373947_0005735
941 Ga0373947_0079091
942 Ga0373937_0101520
943 Ga0373937_1062375
944 Ga0373925_0007810
945 Ga0373925_0313208
946 Ga0373925_0485046
947 Ga0373925_1075258
948 Ga0395899_0154558
949 Ga0395900_0009261
950 Ga0395898_0755028
951 Ga0395905_0008819
952 Ga0395905_0628423
953 Ga0436365_1150739
954 Ga0436361_0896173
955 Ga0436361_1091442
956 Ga0451841_0341929
957 Ga0450896_020665
958 Ga0450898_099176
959 Ga0450906_072153
960 Ga0451577_0000523
961 Ga0451577_0248007
962 Ga0453683_0053721
963 Ga0466965_0137596
964 Ga0453684_0112853
965 Ga0466970_0057414
966 Ga0466959_0027614
967 Ga0451576_0046432
968 Ga0451576_0307644
969 Ga0451576_1236416
970 Ga0495617_152165
971 Ga0495603_0220565
972 Ga0495629_0101683
973 Ga0495629_0108466
974 Ga0495638_0000898
975 Ga0495638_0077160
976 Ga0495650_0000254
977 Ga0495580_0000550
978 Ga0495580_0007540
979 Ga0495580_0011725
980 Ga0495580_0013129
981 Ga0495580_0276033
982 Ga0495580_0815624
983 Ga0495582_0002059
984 Ga0495582_0002896
985 Ga0495582_0272901
986 Ga0495605_0002046
987 Ga0495584_0000232
988 Ga0495584_0056463
989 Ga0495584_0097595
990 Ga0495594_0026880
991 Ga0495607_0067210
992 Ga0495607_0107652
993 Ga0495607_0304740
994 Ga0495583_0000150
995 Ga0495606_0002891
996 Ga0495610_0012678
997 Ga0495610_0028490
998 Ga0495616_0006939
999 Ga0495616_0062358
1000 Ga0495630_0092727
1001 Ga0495630_0263039
1002 Ga0495643_0000250
1003 Ga0495644_0001124
1004 Ga0495644_0009837
1005 Ga0495648_0001108
1006 Ga0495648_0313521
1007 Ga0495663_0007320
1008 Ga0495642_0009119
1009 Ga0495642_0182293
1010 Ga0495642_0355467
1011 Ga0495665_0002968
1012 Ga0495665_0247848
1013 Ga0495598_0417356
1014 Ga0495609_0001318
1015 Ga0495609_0123365
1016 Ga0495621_0009240
1017 Ga0495622_0120635
1018 Ga0495633_0025435
1019 Ga0495633_0060963
1020 Ga0495656_0033992
1021 Ga0495611_0162816
1022 Ga0495625_0006366
1023 Ga0495625_0040195
1024 Ga0495625_0052454
1025 Ga0495659_0001728
1026 Ga0495659_0004011
1027 Ga0495659_0005726
1028 Ga0495659_0046534
1029 Ga0495659_0071974
1030 Ga0495661_0120300
1031 Ga0495588_0083619
1032 Ga0495658_0001926
1033 Ga0495658_0016075
1034 Ga0495658_0052197
1035 Ga0495658_0576917
1036 Ga0495669_0036522
1037 Ga0495670_0000577
1038 Ga0495670_0088329
1039 Ga0495670_0348787
1040 Ga0495671_0035322
1041 Ga0495671_0039973
1042 Ga0495671_0088298
1043 Ga0495671_0115638
1044 Ga0495649_0002493
1045 Ga0495581_0015902
1046 Ga0495581_0268482
1047 Ga0495636_0000457
1048 Ga0495636_0014977
1049 Ga0495636_0015207
1050 Ga0495636_0226628
1051 Ga0495672_0004405
1052 Ga0495672_0038857
1053 Ga0495672_0172669
1054 Ga0495676_0027421
1055 Ga0495683_0000690
1056 Ga0495687_000057
1057 Ga0495677_0015576
1058 Ga0495677_0176005
1059 Ga0495677_0254963
1060 Ga0495685_043637
1061 Ga0495673_0003158
1062 Ga0495673_0269966
1063 Ga0495684_0349670
1064 Ga0495686_0130907
1065 Ga0495593_0144560
1066 Ga0495614_0182781
1067 Ga0496102_1943728
1068 Ga0496106_0143843
1069 Ga0496106_0745328
1070 Ga0496107_0213842
1071 Ga0496114_0297724
1072 Ga0496121_0079305
1073 Ga0496126_0062541
1074 Ga0495678_000095
1075 Ga0495678_016555
1076 Ga0495682_0000089
1077 Ga0495682_0000432
1078 Ga0501034_0178692
1079 Ga0501068_0565030
1080 Ga0501069_0669247
1081 Ga0501073_0072865
1082 Ga0501077_0560510
1083 Ga0501249_044967
1084 Ga0501269_000043
1085 nmdc:mga05p37_10603_c1
1086 nmdc:mga05p37_392034_c1
1087 nmdc:mga05p37_39798_c1
1088 nmdc:mga05p37_64136_c1
1089 nmdc:mga09592_105343_c1
1090 nmdc:mga09592_1404286_c1
1091 nmdc:mga09592_199108_c1
1092 nmdc:mga06r32_126638_c1
1093 nmdc:mga06r32_51861_c1
1094 nmdc:mga08y16_1017966_c1
1095 nmdc:mga08y16_120787_c1
1096 nmdc:mga08y16_417488_c1
1097 nmdc:mga0n895_137810_c1
1098 nmdc:mga0n895_161464_c1
1099 nmdc:mga0n895_18571_c1
1100 nmdc:mga0n895_245235_c1
1101 nmdc:mga0n895_417545_c1
1102 nmdc:mga0n895_645839_c1
1103 nmdc:mga0n895_66380_c1
1104 nmdc:mga0rr50_162993_c1
1105 nmdc:mga0rr50_224593_c1
1106 nmdc:mga0rr50_36501_c1
1107 nmdc:mga0rr50_752736_c1
1108 nmdc:mga08x19_3319_c1
1109 nmdc:mga08x19_44857_c1
1110 nmdc:mga0a205_12872_c1
1111 nmdc:mga0a205_31119_c1
1112 Ga0500562_003291
1113 Ga0500593_256178
1114 Ga0500568_0006532
1115 Ga0500616_0061006
1116 Ga0587111_0016270
1117 2644030783
1118 2857562332
1119 2857568285
1120 2894027810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

72

144

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

68

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9819 2 151
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9629 2 151
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9493 1 151
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9485 3 151
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9484 2 151
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9586 2 76 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9565 84 151 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.955 2 74 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9532 84 151 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9531 84 151 1.10.150.120
ID Description Score Start End GO Terms
AF-G0IXS8-F1-model_v4 (2Fe-2S)-binding domain-containing protein 0.9936 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A239I481-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9929 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A4Q3SWA3-F1-model_v4 (2Fe-2S)-binding protein 0.9928 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A3HWC2-F1-model_v4 Isoquinoline 1-oxidoreductase, alpha subunit 0.9918 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A3D8YFZ6-F1-model_v4 (2Fe-2S)-binding protein 0.9916 1 150 GO:0016491
GO:0046872
GO:0051537

Map