F463678

General Info

Members Datasets Scaffolds Average Seq Length
560 295 1120 81

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_12078648|Ga0105241_120786481
Length 83
Sequence VTIRLDVVDRGHATAEAAMLDVVRQRSGAEPLGVVKMLLYRPELFGTPFSEALDEVMRGPSDWSPGERELFAAFTSLLNQCPF

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
168 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
189 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
197 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 11.43
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 32.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_12078648 3300009174 Unclassified 561
2 ARSoilOldRDRAFT_c005998 3300000044 Unclassified 1023
3 JGI24033J26618_1075109 3300002155 Unclassified 512
4 Ga0070658_10228362 3300005327 Bacteria 1576
5 Ga0070676_10352928 3300005328 Unclassified 1012
6 Ga0068869_101904490 3300005334 Unclassified 533
7 Ga0070682_100272219 3300005337 Unclassified 1231
8 Ga0068868_100223175 3300005338 Unclassified 1578
9 Ga0068868_101629849 3300005338 Bacteria 607
10 Ga0070660_100189495 3300005339 Unclassified 1666
11 Ga0070689_100009431 3300005340 Bacteria 6919
12 Ga0070691_10109039 3300005341 Unclassified 1383
13 Ga0070687_100602981 3300005343 Bacteria 755
14 Ga0070687_101093503 3300005343 Bacteria 583
15 Ga0070692_10008629 3300005345 Bacteria 4553
16 Ga0070692_10678659 3300005345 Bacteria 691
17 Ga0070668_100149345 3300005347 Unclassified 1888
18 Ga0070668_101768259 3300005347 Bacteria 568
19 Ga0070671_100087657 3300005355 Unclassified 2605
20 Ga0070671_100332087 3300005355 Bacteria 1296
21 Ga0070674_100012577 3300005356 Bacteria 5201
22 Ga0070673_100055806 3300005364 Unclassified 3114
23 Ga0070688_100015965 3300005365 Unclassified 4283
24 Ga0070659_100023724 3300005366 Unclassified 4697
25 Ga0070659_100025736 3300005366 Bacteria 4524
26 Ga0070659_100212488 3300005366 Bacteria 1594
27 Ga0070667_101083579 3300005367 Bacteria 749
28 Ga0070703_10103507 3300005406 Bacteria 1007
29 Ga0070703_10529264 3300005406 Bacteria 534
30 Ga0070703_10597616 3300005406 Bacteria 509
31 Ga0070709_10027567 3300005434 Bacteria 3378
32 Ga0070709_10108595 3300005434 Bacteria 1861
33 Ga0070714_100000784 3300005435 Bacteria 22555
34 Ga0070714_100013507 3300005435 Bacteria 6546
35 Ga0070714_101149994 3300005435 Bacteria 757
36 Ga0070714_101825724 3300005435 Unclassified 593
37 Ga0070713_100010112 3300005436 Bacteria 6805
38 Ga0070713_100226277 3300005436 Bacteria 1698
39 Ga0070713_101622521 3300005436 Archaea 628
40 Ga0070710_10056261 3300005437 Bacteria 2225
41 Ga0070710_11383983 3300005437 Unclassified 525
42 Ga0070701_10002963 3300005438 Bacteria 6631
43 Ga0070711_100019726 3300005439 Bacteria 4330
44 Ga0070711_100924429 3300005439 Bacteria 745
45 Ga0070705_100039265 3300005440 Unclassified 2685
46 Ga0070705_100570383 3300005440 Bacteria 871
47 Ga0070705_100580315 3300005440 Bacteria 864
48 Ga0070700_100075039 3300005441 Bacteria 2168
49 Ga0070694_100001205 3300005444 Bacteria 14923
50 Ga0070708_100032602 3300005445 Bacteria 4521
51 Ga0070708_100108711 3300005445 Bacteria 2547
52 Ga0070708_100414367 3300005445 Bacteria 1270
53 Ga0070663_100266445 3300005455 Bacteria 1360
54 Ga0070678_100349078 3300005456 Bacteria 1272
55 Ga0070662_100903418 3300005457 Bacteria 753
56 Ga0070662_101672644 3300005457 Unclassified 550
57 Ga0070681_10051033 3300005458 Bacteria 4126
58 Ga0070681_10162438 3300005458 Bacteria 2158
59 Ga0070681_10300922 3300005458 Unclassified 1514
60 Ga0070681_11425379 3300005458 Bacteria 616
61 Ga0068867_100419033 3300005459 Bacteria 1134
62 Ga0068867_100556098 3300005459 Bacteria 995
63 Ga0070685_10009190 3300005466 Bacteria 5101
64 Ga0070706_100181511 3300005467 Bacteria 1965
65 Ga0070706_100296852 3300005467 Bacteria 1508
66 Ga0070706_100424816 3300005467 Unclassified 1237
67 Ga0070706_100487060 3300005467 Bacteria 1147
68 Ga0070706_100571437 3300005467 Unclassified 1051
69 Ga0070707_100057565 3300005468 Bacteria 3729
70 Ga0070707_100139165 3300005468 Bacteria 2362
71 Ga0070707_100333130 3300005468 Bacteria 1475
72 Ga0070707_100449319 3300005468 Unclassified 1249
73 Ga0070707_101076659 3300005468 Bacteria 770
74 Ga0070698_100065395 3300005471 Bacteria 3662
75 Ga0070698_100366717 3300005471 Bacteria 1372
76 Ga0070698_101557005 3300005471 Unclassified 613
77 Ga0070698_101887305 3300005471 Unclassified 550
78 Ga0070699_100063395 3300005518 Bacteria 3205
79 Ga0070699_100292393 3300005518 Bacteria 1461
80 Ga0070699_100371710 3300005518 Bacteria 1290
81 Ga0070699_101186352 3300005518 Unclassified 700
82 Ga0070699_101441515 3300005518 Unclassified 631
83 Ga0070699_101830776 3300005518 Unclassified 555
84 Ga0070699_101900236 3300005518 Bacteria 544
85 Ga0070679_100010502 3300005530 Bacteria 8785
86 Ga0070679_100132371 3300005530 Bacteria 2475
87 Ga0070679_100140091 3300005530 Unclassified 2399
88 Ga0070679_100778642 3300005530 Bacteria 900
89 Ga0070679_100919388 3300005530 Bacteria 818
90 Ga0070684_100035105 3300005535 Bacteria 4290
91 Ga0070684_100303360 3300005535 Bacteria 1466
92 Ga0070697_100007663 3300005536 Bacteria 8406
93 Ga0070697_100049534 3300005536 Unclassified 3409
94 Ga0070697_100101121 3300005536 Bacteria 2395
95 Ga0068853_100053467 3300005539 Unclassified 3478
96 Ga0068853_100138444 3300005539 Bacteria 2184
97 Ga0068853_101127606 3300005539 Bacteria 757
98 Ga0070672_100015147 3300005543 Bacteria 5481
99 Ga0070695_100016967 3300005545 Bacteria 4415
100 Ga0070695_100046661 3300005545 Unclassified 2764
101 Ga0070695_100414563 3300005545 Bacteria 1024
102 Ga0070695_100841443 3300005545 Unclassified 738
103 Ga0070696_100002763 3300005546 Bacteria 11641
104 Ga0070696_100020370 3300005546 Bacteria 4496
105 Ga0070696_100924284 3300005546 Bacteria 725
106 Ga0070696_101652739 3300005546 Bacteria 551
107 Ga0070693_100409167 3300005547 Unclassified 943
108 Ga0070665_100034536 3300005548 Bacteria 5085
109 Ga0070704_100002444 3300005549 Bacteria 10425
110 Ga0070704_100061025 3300005549 Bacteria 2696
111 Ga0070704_100247587 3300005549 Bacteria 1462
112 Ga0068855_100384913 3300005563 Bacteria 1539
113 Ga0070664_100225544 3300005564 Bacteria 1678
114 Ga0068857_100079578 3300005577 Unclassified 2925
115 Ga0068854_100323515 3300005578 Bacteria 1254
116 Ga0068856_100263280 3300005614 Bacteria 1740
117 Ga0070702_100029563 3300005615 Bacteria 2981
118 Ga0068852_100096597 3300005616 Unclassified 2656
119 Ga0068859_100135040 3300005617 Unclassified 2539
120 Ga0068859_102334605 3300005617 Bacteria 590
121 Ga0068864_100027230 3300005618 Bacteria 4825
122 Ga0068864_100071967 3300005618 Bacteria 3012
123 Ga0068866_10030397 3300005718 Unclassified 2592
124 Ga0068870_10014463 3300005840 Unclassified 3728
125 Ga0068870_11147403 3300005840 Bacteria 561
126 Ga0068863_100054879 3300005841 Unclassified 3775
127 Ga0068860_100059217 3300005843 Unclassified 3642
128 Ga0068862_102350727 3300005844 Unclassified 545
129 Ga0070717_10001962 3300006028 Bacteria 14378
130 Ga0070717_10042448 3300006028 Bacteria 3709
131 Ga0070717_10054754 3300006028 Bacteria 3290
132 Ga0070717_10115856 3300006028 Unclassified 2290
133 Ga0075432_10000900 3300006058 Bacteria 9347
134 Ga0075432_10578160 3300006058 Bacteria 511
135 Ga0070715_10025977 3300006163 Bacteria 2325
136 Ga0070716_100007097 3300006173 Bacteria 5502
137 Ga0070716_100152336 3300006173 Unclassified 1489
138 Ga0070716_100414628 3300006173 Unclassified 972
139 Ga0070716_100818069 3300006173 Unclassified 723
140 Ga0070712_100196346 3300006175 Unclassified 1582
141 Ga0097621_100469004 3300006237 Bacteria 1136
142 Ga0075428_100002920 3300006844 Bacteria 18616
143 Ga0075433_10002717 3300006852 Bacteria 13511
144 Ga0075433_10151348 3300006852 Bacteria 2064
145 Ga0075433_10172083 3300006852 Unclassified 1927
146 Ga0075433_10442689 3300006852 Unclassified 1145
147 Ga0075434_100003822 3300006871 Bacteria 13467
148 Ga0075434_100005780 3300006871 Bacteria 11302
149 Ga0075434_100016166 3300006871 Bacteria 7172
150 Ga0075434_100302850 3300006871 Unclassified 1619
151 Ga0075434_100527675 3300006871 Unclassified 1201
152 Ga0075434_102248986 3300006871 Bacteria 549
153 Ga0075429_101079557 3300006880 Unclassified 701
154 Ga0068865_100082267 3300006881 Unclassified 2314
155 Ga0068865_101825953 3300006881 Bacteria 550
156 Ga0075436_100009985 3300006914 Bacteria 6495
157 Ga0075436_100034529 3300006914 Bacteria 3488
158 Ga0075436_100300125 3300006914 Unclassified 1151
159 Ga0075436_100378358 3300006914 Unclassified 1023
160 Ga0075436_101120542 3300006914 Bacteria 593
161 Ga0097620_100135039 3300006931 Unclassified 2539
162 Ga0097620_102334771 3300006931 Bacteria 590
163 Ga0075435_100004900 3300007076 Bacteria 9273
164 Ga0075435_100025158 3300007076 Bacteria 4631
165 Ga0075435_100032259 3300007076 Bacteria 4135
166 Ga0075435_100041519 3300007076 Bacteria 3678
167 Ga0099794_10069100 3300007265 Bacteria 1728
168 Ga0099794_10571414 3300007265 Bacteria 598
169 Ga0099795_10361159 3300007788 Bacteria 652
170 Ga0105240_10188342 3300009093 Bacteria 2428
171 Ga0105240_10298334 3300009093 Bacteria 1844
172 Ga0105240_11734228 3300009093 Bacteria 652
173 Ga0111539_10210915 3300009094 Bacteria 2263
174 Ga0111539_10751318 3300009094 Bacteria 1135
175 Ga0105245_10003784 3300009098 Bacteria 13459
176 Ga0105245_10058891 3300009098 Unclassified 3458
177 Ga0105245_10544494 3300009098 Unclassified 1182
178 Ga0105247_10009399 3300009101 Bacteria 5933
179 Ga0105247_10203956 3300009101 Unclassified 1330
180 Ga0114129_10032616 3300009147 Bacteria 7360
181 Ga0114129_10477538 3300009147 Bacteria 1632
182 Ga0114129_10910608 3300009147 Bacteria 1114
183 Ga0105243_10013479 3300009148 Bacteria 6183
184 Ga0105243_10398030 3300009148 Bacteria 1278
185 Ga0105243_10517364 3300009148 Bacteria 1134
186 Ga0105242_10104209 3300009176 Bacteria 2408
187 Ga0105242_11926333 3300009176 Bacteria 632
188 Ga0105238_10619816 3300009551 Bacteria 1091
189 Ga0105249_10159033 3300009553 Unclassified 2182
190 Ga0105239_10017343 3300010375 Bacteria 7965
191 Ga0105239_10264676 3300010375 Unclassified 1933
192 Ga0105246_10198909 3300011119 Unclassified 1556
193 Ga0105246_11564397 3300011119 Bacteria 622
194 Ga0157338_1067200 3300012515 Unclassified 552
195 Ga0157369_10011224 3300013105 Bacteria 10184
196 Ga0157369_10122331 3300013105 Bacteria 2760
197 Ga0157369_10791267 3300013105 Bacteria 975
198 Ga0157374_10035362 3300013296 Bacteria 4570
199 Ga0157374_12757767 3300013296 Bacteria 519
200 Ga0157378_10943078 3300013297 Unclassified 895
201 Ga0163162_10106436 3300013306 Bacteria 2900
202 Ga0157375_10904312 3300013308 Bacteria 1026
203 Ga0163163_10671447 3300014325 Bacteria 1100
204 Ga0163163_11509640 3300014325 Bacteria 733
205 Ga0157380_10029334 3300014326 Bacteria 4204
206 Ga0182008_10754539 3300014497 Bacteria 561
207 Ga0157377_10208253 3300014745 Bacteria 1245
208 Ga0157376_10169047 3300014969 Unclassified 1989
209 Ga0182006_1133454 3300015261 Bacteria 853
210 Ga0163161_10693267 3300017792 Unclassified 847
211 Ga0206353_11653878 3300020082 Unclassified 745
212 Ga0213872_10366324 3300021361 Unclassified 589
213 Ga0207656_10146531 3300025321 Unclassified 1116
214 Ga0207653_10211529 3300025885 Bacteria 734
215 Ga0207692_10215259 3300025898 Bacteria 1136
216 Ga0207642_10027145 3300025899 Unclassified 2340
217 Ga0207710_10064273 3300025900 Unclassified 1671
218 Ga0207710_10175124 3300025900 Unclassified 1050
219 Ga0207688_10060305 3300025901 Unclassified 2137
220 Ga0207685_10045218 3300025905 Bacteria 1669
221 Ga0207685_10629398 3300025905 Unclassified 578
222 Ga0207699_10005627 3300025906 Bacteria 6014
223 Ga0207699_10090033 3300025906 Bacteria 1924
224 Ga0207645_10022018 3300025907 Bacteria 4150
225 Ga0207643_10018352 3300025908 Bacteria 3832
226 Ga0207705_10463038 3300025909 Bacteria 984
227 Ga0207684_10138629 3300025910 Bacteria 2090
228 Ga0207684_10374216 3300025910 Unclassified 1225
229 Ga0207684_10971395 3300025910 Bacteria 712
230 Ga0207684_11255608 3300025910 Bacteria 611
231 Ga0207654_10868058 3300025911 Unclassified 653
232 Ga0207707_10169375 3300025912 Bacteria 1909
233 Ga0207707_10582361 3300025912 Unclassified 948
234 Ga0207693_10000848 3300025915 Bacteria 27279
235 Ga0207693_10004251 3300025915 Bacteria 12141
236 Ga0207663_10045219 3300025916 Bacteria 2707
237 Ga0207663_10236590 3300025916 Bacteria 1337
238 Ga0207663_11201366 3300025916 Bacteria 610
239 Ga0207660_10086988 3300025917 Bacteria 2308
240 Ga0207660_10970551 3300025917 Bacteria 693
241 Ga0207662_10025657 3300025918 Bacteria 3394
242 Ga0207662_10300392 3300025918 Bacteria 1067
243 Ga0207657_10017657 3300025919 Bacteria 6836
244 Ga0207657_11182549 3300025919 Bacteria 582
245 Ga0207649_10349791 3300025920 Unclassified 1093
246 Ga0207649_10514838 3300025920 Bacteria 912
247 Ga0207649_11082948 3300025920 Bacteria 632
248 Ga0207652_10171438 3300025921 Bacteria 1947
249 Ga0207652_10810591 3300025921 Bacteria 831
250 Ga0207652_11030878 3300025921 Unclassified 722
251 Ga0207646_10135423 3300025922 Bacteria 2218
252 Ga0207646_10226281 3300025922 Bacteria 1690
253 Ga0207646_10390621 3300025922 Bacteria 1257
254 Ga0207681_10204812 3300025923 Unclassified 1517
255 Ga0207687_10020924 3300025927 Bacteria 4343
256 Ga0207687_10313381 3300025927 Bacteria 1268
257 Ga0207687_10568714 3300025927 Unclassified 953
258 Ga0207700_10072275 3300025928 Bacteria 2659
259 Ga0207700_10645971 3300025928 Unclassified 943
260 Ga0207700_11594500 3300025928 Unclassified 578
261 Ga0207664_10018432 3300025929 Bacteria 5139
262 Ga0207664_10158754 3300025929 Bacteria 1927
263 Ga0207664_10188510 3300025929 Unclassified 1774
264 Ga0207664_10534465 3300025929 Bacteria 1051
265 Ga0207644_10084158 3300025931 Unclassified 2357
266 Ga0207644_11321038 3300025931 Bacteria 606
267 Ga0207690_10022202 3300025932 Unclassified 3945
268 Ga0207706_10041906 3300025933 Bacteria 4057
269 Ga0207706_10089140 3300025933 Unclassified 2712
270 Ga0207686_11759240 3300025934 Bacteria 513
271 Ga0207709_10012791 3300025935 Unclassified 4628
272 Ga0207709_10039236 3300025935 Bacteria 2827
273 Ga0207670_10064516 3300025936 Unclassified 2510
274 Ga0207669_10094530 3300025937 Unclassified 1956
275 Ga0207704_10471163 3300025938 Unclassified 1006
276 Ga0207704_11273602 3300025938 Bacteria 628
277 Ga0207665_10000420 3300025939 Bacteria 29260
278 Ga0207665_10043243 3300025939 Bacteria 3012
279 Ga0207665_11374964 3300025939 Bacteria 562
280 Ga0207691_10005009 3300025940 Bacteria 12774
281 Ga0207711_10395530 3300025941 Bacteria 1283
282 Ga0207689_10226365 3300025942 Unclassified 1546
283 Ga0207661_10257300 3300025944 Bacteria 1554
284 Ga0207667_10391988 3300025949 Unclassified 1414
285 Ga0207651_10025062 3300025960 Bacteria 3702
286 Ga0207712_10078043 3300025961 Unclassified 2402
287 Ga0207668_11110030 3300025972 Unclassified 709
288 Ga0207668_11333783 3300025972 Bacteria 646
289 Ga0207640_10970067 3300025981 Bacteria 746
290 Ga0207640_12148569 3300025981 Unclassified 506
291 Ga0207658_10179344 3300025986 Unclassified 1752
292 Ga0207677_10090998 3300026023 Unclassified 2218
293 Ga0207639_10316956 3300026041 Unclassified 1383
294 Ga0207678_10045769 3300026067 Bacteria 3783
295 Ga0207708_10016753 3300026075 Bacteria 5515
296 Ga0207708_10309409 3300026075 Unclassified 1287
297 Ga0207708_10843866 3300026075 Bacteria 791
298 Ga0207702_10469351 3300026078 Unclassified 1223
299 Ga0207641_10079670 3300026088 Unclassified 2840
300 Ga0207648_10012674 3300026089 Bacteria 7882
301 Ga0207648_10439494 3300026089 Bacteria 1186
302 Ga0207676_10015168 3300026095 Bacteria 5558
303 Ga0207676_10030267 3300026095 Bacteria 4062
304 Ga0207674_10243354 3300026116 Bacteria 1746
305 Ga0207683_10316319 3300026121 Unclassified 1429
306 Ga0207698_10218278 3300026142 Unclassified 1721
307 Ga0207428_10005121 3300027907 Bacteria 12292
308 Ga0268265_10182989 3300028380 Unclassified 1802
309 Ga0268264_10054607 3300028381 Unclassified 3336
310 Ga0373930_0051783 3300034816 Unclassified 898
311 Ga0373948_0050747 3300034817 Bacteria 891
312 Ga0373951_0077746 3300035091 Unclassified 854
313 Ga0373951_0191784 3300035091 Bacteria 592
314 Ga0373939_0285175 3300035114 Unclassified 653
315 Ga0373941_0070036 3300035115 Unclassified 1162
316 Ga0373941_0257576 3300035115 Bacteria 683
317 Ga0373960_0096019 3300035121 Bacteria 954
318 Ga0373943_0362748 3300035170 Bacteria 832
319 Ga0373962_0004918 3300035242 Bacteria 3230
320 Ga0373962_0219678 3300035242 Bacteria 650
321 Ga0373931_0075240 3300035691 Unclassified 1851
322 Ga0373931_0233523 3300035691 Bacteria 1112
323 Ga0373935_0149594 3300035692 Bacteria 1583
324 Ga0373937_1119997 3300036401 Bacteria 736
325 Ga0373925_1014535 3300037068 Unclassified 683
326 Ga0395899_0022189 3300037312 Bacteria 4813
327 Ga0395899_0235581 3300037312 Bacteria 1262
328 Ga0395900_0044993 3300037418 Bacteria 4546
329 Ga0395900_0048369 3300037418 Bacteria 4381
330 Ga0395900_0127547 3300037418 Bacteria 2608
331 Ga0395900_1843415 3300037418 Unclassified 515
332 Ga0395898_0151703 3300037466 Bacteria 2217
333 Ga0395898_0178785 3300037466 Bacteria 2027
334 Ga0395898_0455033 3300037466 Bacteria 1219
335 Ga0395898_1813555 3300037466 Unclassified 531
336 Ga0395905_0014380 3300037471 Bacteria 7560
337 Ga0395905_0171311 3300037471 Bacteria 2039
338 Ga0395905_0666622 3300037471 Unclassified 942
339 Ga0395901_0097462 3300038443 Bacteria 3082
340 Ga0395901_0127899 3300038443 Unclassified 2670
341 Ga0395901_0258335 3300038443 Bacteria 1813
342 Ga0395901_0523901 3300038443 Bacteria 1204
343 Ga0395901_1011132 3300038443 Unclassified 807
344 Ga0436361_1084359 3300039447 Bacteria 1483
345 Ga0436362_0287685 3300039453 Bacteria 775
346 Ga0439453_0106681 3300041408 Bacteria 630
347 Ga0439453_0162008 3300041408 Bacteria 536
348 Ga0451807_1820820 3300041486 Unclassified 548
349 Ga0439451_002851 3300042009 Bacteria 3520
350 Ga0439454_046460 3300042011 Unclassified 723
351 Ga0439435_0148427 3300042436 Unclassified 751
352 Ga0450916_010625 3300042530 Bacteria 1153
353 Ga0466969_0427715 3300044656 Unclassified 602
354 Ga0466966_0091994 3300044684 Bacteria 1882
355 Ga0466961_0105571 3300044693 Bacteria 1773
356 Ga0466963_0029452 3300044694 Bacteria 3535
357 Ga0466964_0012180 3300044706 Bacteria 3253
358 Ga0466971_0007396 3300044719 Bacteria 4781
359 Ga0466971_0026695 3300044719 Bacteria 2582
360 Ga0466968_0010483 3300044735 Bacteria 3595
361 Ga0466957_0060716 3300044842 Unclassified 2318
362 Ga0466957_0810810 3300044842 Unclassified 665
363 Ga0466959_0010606 3300045049 Bacteria 6596
364 Ga0451576_0428179 3300045051 Bacteria 1389
365 Ga0466958_0048816 3300045836 Bacteria 2559
366 Ga0466967_0001728 3300045976 Bacteria 13024
367 Ga0466967_0008805 3300045976 Bacteria 7438
368 Ga0466967_0065315 3300045976 Bacteria 3238
369 Ga0466967_0538379 3300045976 Unclassified 1148
370 Ga0466967_1402151 3300045976 Unclassified 696
371 Ga0466967_2203534 3300045976 Unclassified 547
372 Ga0495592_0007830 3300046454 Bacteria 8007
373 Ga0495603_0006978 3300046455 Bacteria 6776
374 Ga0495603_0698722 3300046455 Bacteria 580
375 Ga0495641_0088228 3300046461 Bacteria 1387
376 Ga0495641_0280643 3300046461 Bacteria 750
377 Ga0495651_0982415 3300046462 Unclassified 513
378 Ga0495582_0012979 3300046473 Bacteria 4590
379 Ga0495582_0475684 3300046473 Bacteria 722
380 Ga0495664_0036655 3300046477 Unclassified 2891
381 Ga0495664_0180078 3300046477 Unclassified 1282
382 Ga0495584_0321548 3300046491 Bacteria 786
383 Ga0495594_0723799 3300046499 Unclassified 562
384 Ga0495607_0093380 3300046501 Bacteria 1625
385 Ga0495608_0236304 3300046511 Bacteria 1143
386 Ga0495608_0701431 3300046511 Bacteria 602
387 Ga0495628_0257083 3300046516 Unclassified 1302
388 Ga0495628_0688326 3300046516 Unclassified 723
389 Ga0495630_0385762 3300046517 Bacteria 1073
390 Ga0495644_0031026 3300046523 Bacteria 2018
391 Ga0495652_0011700 3300046529 Bacteria 7930
392 Ga0495652_0417638 3300046529 Bacteria 946
393 Ga0495587_0664844 3300046536 Bacteria 572
394 Ga0495587_0689955 3300046536 Unclassified 560
395 Ga0495609_0214502 3300046538 Bacteria 801
396 Ga0495645_0023591 3300046543 Unclassified 4456
397 Ga0495667_0838938 3300046559 Unclassified 565
398 Ga0495656_0103096 3300046615 Bacteria 1322
399 Ga0495634_0313600 3300046642 Bacteria 946
400 Ga0495611_0215588 3300046648 Unclassified 893
401 Ga0495588_0641609 3300046674 Bacteria 556
402 Ga0495599_0018221 3300046678 Unclassified 4374
403 Ga0495624_0008855 3300046690 Bacteria 6996
404 Ga0495670_0140006 3300046691 Bacteria 1265
405 Ga0495604_0038491 3300047317 Bacteria 3762
406 Ga0495674_0601591 3300047319 Unclassified 871
407 Ga0495676_0064952 3300047321 Bacteria 2835
408 Ga0495680_0711180 3300047322 Unclassified 663
409 Ga0495677_0229591 3300047445 Unclassified 724
410 Ga0495593_0476600 3300047673 Bacteria 625
411 Ga0495602_0541140 3300048088 Unclassified 808
412 Ga0496100_0016947 3300048903 Bacteria 4288
413 Ga0496100_0020554 3300048903 Bacteria 3960
414 Ga0496100_0163268 3300048903 Unclassified 1598
415 Ga0496100_0180503 3300048903 Bacteria 1526
416 Ga0496100_0429423 3300048903 Bacteria 1010
417 Ga0496100_0576934 3300048903 Unclassified 872
418 Ga0496101_0003841 3300048904 Bacteria 9392
419 Ga0496101_0020586 3300048904 Bacteria 4518
420 Ga0496101_0022168 3300048904 Bacteria 4370
421 Ga0496101_0037581 3300048904 Bacteria 3435
422 Ga0496101_0202361 3300048904 Bacteria 1535
423 Ga0496101_0395681 3300048904 Bacteria 1088
424 Ga0496102_0032477 3300048905 Bacteria 4688
425 Ga0496102_0091922 3300048905 Bacteria 2809
426 Ga0496102_0093666 3300048905 Bacteria 2783
427 Ga0496102_0385011 3300048905 Bacteria 1320
428 Ga0496102_1316363 3300048905 Bacteria 642
429 Ga0496103_0040651 3300048906 Bacteria 2857
430 Ga0496103_0116841 3300048906 Bacteria 1697
431 Ga0496103_0509065 3300048906 Bacteria 770
432 Ga0496104_0076136 3300048907 Bacteria 3195
433 Ga0496104_0375562 3300048907 Bacteria 1334
434 Ga0496104_0696801 3300048907 Bacteria 923
435 Ga0496104_0760731 3300048907 Unclassified 875
436 Ga0496104_1106958 3300048907 Unclassified 696
437 Ga0496105_0058349 3300048908 Bacteria 3186
438 Ga0496105_0061129 3300048908 Unclassified 3108
439 Ga0496105_0217761 3300048908 Bacteria 1555
440 Ga0496105_0325753 3300048908 Unclassified 1230
441 Ga0496106_0004525 3300048909 Bacteria 10298
442 Ga0496106_0015690 3300048909 Bacteria 5604
443 Ga0496106_0151376 3300048909 Bacteria 1830
444 Ga0496107_0007921 3300048910 Bacteria 7330
445 Ga0496107_0012388 3300048910 Bacteria 5952
446 Ga0496107_0012602 3300048910 Bacteria 5904
447 Ga0496107_0212927 3300048910 Bacteria 1437
448 Ga0496107_0243706 3300048910 Bacteria 1337
449 Ga0496107_0270937 3300048910 Bacteria 1263
450 Ga0496108_0105631 3300048911 Unclassified 2404
451 Ga0496108_0365516 3300048911 Unclassified 1259
452 Ga0496108_0985359 3300048911 Bacteria 720
453 Ga0496109_0018488 3300048912 Bacteria 6122
454 Ga0496109_0059858 3300048912 Bacteria 3479
455 Ga0496110_0075993 3300048913 Unclassified 2985
456 Ga0496110_0107610 3300048913 Bacteria 2503
457 Ga0496110_0119999 3300048913 Bacteria 2368
458 Ga0496111_0004880 3300048914 Bacteria 8517
459 Ga0496111_0007157 3300048914 Bacteria 7290
460 Ga0496111_0040959 3300048914 Bacteria 3323
461 Ga0496112_0191417 3300048915 Unclassified 2007
462 Ga0496112_1270485 3300048915 Bacteria 652
463 Ga0496113_0067591 3300048916 Unclassified 2710
464 Ga0496113_0111441 3300048916 Bacteria 2130
465 Ga0496114_0006524 3300048917 Bacteria 9194
466 Ga0496114_0010427 3300048917 Bacteria 7393
467 Ga0496114_0062735 3300048917 Bacteria 3110
468 Ga0496114_0198774 3300048917 Bacteria 1755
469 Ga0496114_1386123 3300048917 Bacteria 590
470 Ga0496115_0000502 3300048918 Bacteria 30706
471 Ga0496115_0009011 3300048918 Bacteria 7402
472 Ga0496115_0168602 3300048918 Bacteria 1811
473 Ga0496115_0437714 3300048918 Unclassified 1057
474 Ga0496115_1070904 3300048918 Unclassified 613
475 Ga0501031_0160795 3300049568 Unclassified 1468
476 Ga0501033_0379656 3300049570 Bacteria 987
477 Ga0501034_1067023 3300049571 Bacteria 690
478 Ga0501036_0130472 3300049572 Unclassified 2122
479 Ga0501036_1088473 3300049572 Unclassified 653
480 Ga0501037_0144409 3300049573 Bacteria 1702
481 Ga0501038_0024898 3300049574 Bacteria 5335
482 Ga0501039_0022138 3300049575 Bacteria 4878
483 Ga0501039_0842971 3300049575 Unclassified 714
484 Ga0501040_0030595 3300049576 Bacteria 3637
485 Ga0501040_0223878 3300049576 Bacteria 1339
486 Ga0501041_0145370 3300049577 Bacteria 1479
487 Ga0501041_0489253 3300049577 Bacteria 782
488 Ga0501041_0798368 3300049577 Unclassified 605
489 Ga0501042_0378985 3300049578 Unclassified 1024
490 Ga0501042_1207378 3300049578 Bacteria 551
491 Ga0501042_1251864 3300049578 Bacteria 541
492 Ga0501043_0247602 3300049579 Unclassified 1373
493 Ga0501046_0185599 3300049580 Bacteria 1553
494 Ga0501046_0733420 3300049580 Unclassified 695
495 Ga0501048_0056870 3300049582 Unclassified 2775
496 Ga0501068_0056249 3300049584 Unclassified 2385
497 Ga0501068_0404151 3300049584 Bacteria 881
498 Ga0501069_0044560 3300049585 Unclassified 2456
499 Ga0501070_0109449 3300049586 Unclassified 2283
500 Ga0501071_0039433 3300049587 Bacteria 3379
501 Ga0501071_0047160 3300049587 Bacteria 3095
502 Ga0501072_0009522 3300049588 Bacteria 7389
503 Ga0501072_0128097 3300049588 Bacteria 2022
504 Ga0501072_0250256 3300049588 Unclassified 1411
505 Ga0501073_0031110 3300049589 Bacteria 3809
506 Ga0501074_0171982 3300049590 Bacteria 1546
507 Ga0501074_1330544 3300049590 Unclassified 503
508 Ga0501075_0059189 3300049591 Bacteria 2885
509 Ga0501075_0061081 3300049591 Bacteria 2839
510 Ga0501076_0024216 3300049592 Bacteria 4689
511 Ga0501076_0042033 3300049592 Bacteria 3599
512 Ga0501077_0016783 3300049593 Unclassified 4617
513 Ga0501077_0035214 3300049593 Bacteria 3187
514 Ga0501079_0013764 3300049741 Bacteria 6168
515 Ga0501080_0049734 3300049742 Bacteria 3902
516 Ga0501080_0121355 3300049742 Bacteria 2422
517 Ga0501081_0046065 3300049743 Unclassified 2996
518 Ga0501081_0135690 3300049743 Bacteria 1761
519 Ga0501081_0173983 3300049743 Bacteria 1555
520 Ga0501083_0021585 3300049744 Unclassified 4472
521 Ga0501035_0383982 3300049822 Bacteria 1171
522 Ga0501045_0008493 3300049824 Bacteria 7158
523 nmdc:mga0yw44_1019127_c1 3300050492 Bacteria 560
524 nmdc:mga05p37_18869_c1 3300050507 Bacteria 8337
525 nmdc:mga05p37_751280_c1 3300050507 Bacteria 1075
526 nmdc:mga09592_1145883_c1 3300050508 Unclassified 645
527 nmdc:mga09592_27192_c1 3300050508 Bacteria 4747
528 nmdc:mga08y16_1695892_c1 3300050511 Bacteria 587
529 nmdc:mga08y16_175027_c1 3300050511 Bacteria 2228
530 nmdc:mga08y16_65124_c1 3300050511 Bacteria 3805
531 nmdc:mga0n895_15418_c1 3300050512 Bacteria 6968
532 nmdc:mga0n895_2033020_c1 3300050512 Unclassified 532
533 nmdc:mga0n895_23968_c1 3300050512 Bacteria 5744
534 nmdc:mga0n895_463_c1 3300050512 Bacteria 27175
535 nmdc:mga0n895_55435_c1 3300050512 Bacteria 3901
536 nmdc:mga0rr50_111649_c1 3300050513 Bacteria 2164
537 nmdc:mga0rr50_12300_c1 3300050513 Bacteria 5524
538 nmdc:mga0rr50_48010_c1 3300050513 Bacteria 3154
539 nmdc:mga08x19_162418_c1 3300050514 Unclassified 1518
540 nmdc:mga08x19_53638_c1 3300050514 Bacteria 2594
541 nmdc:mga08x19_9453_c1 3300050514 Bacteria 5838
542 nmdc:mga0a205_1316773_c1 3300050515 Bacteria 570
543 nmdc:mga0a205_304184_c1 3300050515 Unclassified 1467
544 nmdc:mga0a205_3324_c1 3300050515 Bacteria 14321
545 nmdc:mga0a205_363843_c1 3300050515 Unclassified 1313
546 nmdc:mga0a205_41996_c1 3300050515 Bacteria 4406
547 nmdc:mga0a205_625648_c1 3300050515 Bacteria 929
548 Ga0495601_0005579 3300053077 Bacteria 7340
549 Ga0495612_0074575 3300053078 Unclassified 1419
550 Ga0495612_0299735 3300053078 Bacteria 721
551 Ga0495619_0481683 3300053085 Unclassified 854
552 Ga0495619_1000525 3300053085 Unclassified 559
553 Ga0501084_0003825 3300054114 Bacteria 12244
554 Ga0501084_0111834 3300054114 Unclassified 2295
555 Ga0501082_0016555 3300060353 Bacteria 6348
556 Ga0466962_0004488 3300061719 Bacteria 6690
557 Ga0466962_0014467 3300061719 Bacteria 3804
558 Ga0466962_0322345 3300061719 Unclassified 766
559 Ga0530510_0037663 3300061734 Bacteria 3490
560 Ga0530510_0817044 3300061734 Unclassified 711
561 Ga0105241_12078648
562 ARSoilOldRDRAFT_c005998
563 JGI24033J26618_1075109
564 Ga0070658_10228362
565 Ga0070676_10352928
566 Ga0068869_101904490
567 Ga0070682_100272219
568 Ga0068868_100223175
569 Ga0068868_101629849
570 Ga0070660_100189495
571 Ga0070689_100009431
572 Ga0070691_10109039
573 Ga0070687_100602981
574 Ga0070687_101093503
575 Ga0070692_10008629
576 Ga0070692_10678659
577 Ga0070668_100149345
578 Ga0070668_101768259
579 Ga0070671_100087657
580 Ga0070671_100332087
581 Ga0070674_100012577
582 Ga0070673_100055806
583 Ga0070688_100015965
584 Ga0070659_100023724
585 Ga0070659_100025736
586 Ga0070659_100212488
587 Ga0070667_101083579
588 Ga0070703_10103507
589 Ga0070703_10529264
590 Ga0070703_10597616
591 Ga0070709_10027567
592 Ga0070709_10108595
593 Ga0070714_100000784
594 Ga0070714_100013507
595 Ga0070714_101149994
596 Ga0070714_101825724
597 Ga0070713_100010112
598 Ga0070713_100226277
599 Ga0070713_101622521
600 Ga0070710_10056261
601 Ga0070710_11383983
602 Ga0070701_10002963
603 Ga0070711_100019726
604 Ga0070711_100924429
605 Ga0070705_100039265
606 Ga0070705_100570383
607 Ga0070705_100580315
608 Ga0070700_100075039
609 Ga0070694_100001205
610 Ga0070708_100032602
611 Ga0070708_100108711
612 Ga0070708_100414367
613 Ga0070663_100266445
614 Ga0070678_100349078
615 Ga0070662_100903418
616 Ga0070662_101672644
617 Ga0070681_10051033
618 Ga0070681_10162438
619 Ga0070681_10300922
620 Ga0070681_11425379
621 Ga0068867_100419033
622 Ga0068867_100556098
623 Ga0070685_10009190
624 Ga0070706_100181511
625 Ga0070706_100296852
626 Ga0070706_100424816
627 Ga0070706_100487060
628 Ga0070706_100571437
629 Ga0070707_100057565
630 Ga0070707_100139165
631 Ga0070707_100333130
632 Ga0070707_100449319
633 Ga0070707_101076659
634 Ga0070698_100065395
635 Ga0070698_100366717
636 Ga0070698_101557005
637 Ga0070698_101887305
638 Ga0070699_100063395
639 Ga0070699_100292393
640 Ga0070699_100371710
641 Ga0070699_101186352
642 Ga0070699_101441515
643 Ga0070699_101830776
644 Ga0070699_101900236
645 Ga0070679_100010502
646 Ga0070679_100132371
647 Ga0070679_100140091
648 Ga0070679_100778642
649 Ga0070679_100919388
650 Ga0070684_100035105
651 Ga0070684_100303360
652 Ga0070697_100007663
653 Ga0070697_100049534
654 Ga0070697_100101121
655 Ga0068853_100053467
656 Ga0068853_100138444
657 Ga0068853_101127606
658 Ga0070672_100015147
659 Ga0070695_100016967
660 Ga0070695_100046661
661 Ga0070695_100414563
662 Ga0070695_100841443
663 Ga0070696_100002763
664 Ga0070696_100020370
665 Ga0070696_100924284
666 Ga0070696_101652739
667 Ga0070693_100409167
668 Ga0070665_100034536
669 Ga0070704_100002444
670 Ga0070704_100061025
671 Ga0070704_100247587
672 Ga0068855_100384913
673 Ga0070664_100225544
674 Ga0068857_100079578
675 Ga0068854_100323515
676 Ga0068856_100263280
677 Ga0070702_100029563
678 Ga0068852_100096597
679 Ga0068859_100135040
680 Ga0068859_102334605
681 Ga0068864_100027230
682 Ga0068864_100071967
683 Ga0068866_10030397
684 Ga0068870_10014463
685 Ga0068870_11147403
686 Ga0068863_100054879
687 Ga0068860_100059217
688 Ga0068862_102350727
689 Ga0070717_10001962
690 Ga0070717_10042448
691 Ga0070717_10054754
692 Ga0070717_10115856
693 Ga0075432_10000900
694 Ga0075432_10578160
695 Ga0070715_10025977
696 Ga0070716_100007097
697 Ga0070716_100152336
698 Ga0070716_100414628
699 Ga0070716_100818069
700 Ga0070712_100196346
701 Ga0097621_100469004
702 Ga0075428_100002920
703 Ga0075433_10002717
704 Ga0075433_10151348
705 Ga0075433_10172083
706 Ga0075433_10442689
707 Ga0075434_100003822
708 Ga0075434_100005780
709 Ga0075434_100016166
710 Ga0075434_100302850
711 Ga0075434_100527675
712 Ga0075434_102248986
713 Ga0075429_101079557
714 Ga0068865_100082267
715 Ga0068865_101825953
716 Ga0075436_100009985
717 Ga0075436_100034529
718 Ga0075436_100300125
719 Ga0075436_100378358
720 Ga0075436_101120542
721 Ga0097620_100135039
722 Ga0097620_102334771
723 Ga0075435_100004900
724 Ga0075435_100025158
725 Ga0075435_100032259
726 Ga0075435_100041519
727 Ga0099794_10069100
728 Ga0099794_10571414
729 Ga0099795_10361159
730 Ga0105240_10188342
731 Ga0105240_10298334
732 Ga0105240_11734228
733 Ga0111539_10210915
734 Ga0111539_10751318
735 Ga0105245_10003784
736 Ga0105245_10058891
737 Ga0105245_10544494
738 Ga0105247_10009399
739 Ga0105247_10203956
740 Ga0114129_10032616
741 Ga0114129_10477538
742 Ga0114129_10910608
743 Ga0105243_10013479
744 Ga0105243_10398030
745 Ga0105243_10517364
746 Ga0105242_10104209
747 Ga0105242_11926333
748 Ga0105238_10619816
749 Ga0105249_10159033
750 Ga0105239_10017343
751 Ga0105239_10264676
752 Ga0105246_10198909
753 Ga0105246_11564397
754 Ga0157338_1067200
755 Ga0157369_10011224
756 Ga0157369_10122331
757 Ga0157369_10791267
758 Ga0157374_10035362
759 Ga0157374_12757767
760 Ga0157378_10943078
761 Ga0163162_10106436
762 Ga0157375_10904312
763 Ga0163163_10671447
764 Ga0163163_11509640
765 Ga0157380_10029334
766 Ga0182008_10754539
767 Ga0157377_10208253
768 Ga0157376_10169047
769 Ga0182006_1133454
770 Ga0163161_10693267
771 Ga0206353_11653878
772 Ga0213872_10366324
773 Ga0207656_10146531
774 Ga0207653_10211529
775 Ga0207692_10215259
776 Ga0207642_10027145
777 Ga0207710_10064273
778 Ga0207710_10175124
779 Ga0207688_10060305
780 Ga0207685_10045218
781 Ga0207685_10629398
782 Ga0207699_10005627
783 Ga0207699_10090033
784 Ga0207645_10022018
785 Ga0207643_10018352
786 Ga0207705_10463038
787 Ga0207684_10138629
788 Ga0207684_10374216
789 Ga0207684_10971395
790 Ga0207684_11255608
791 Ga0207654_10868058
792 Ga0207707_10169375
793 Ga0207707_10582361
794 Ga0207693_10000848
795 Ga0207693_10004251
796 Ga0207663_10045219
797 Ga0207663_10236590
798 Ga0207663_11201366
799 Ga0207660_10086988
800 Ga0207660_10970551
801 Ga0207662_10025657
802 Ga0207662_10300392
803 Ga0207657_10017657
804 Ga0207657_11182549
805 Ga0207649_10349791
806 Ga0207649_10514838
807 Ga0207649_11082948
808 Ga0207652_10171438
809 Ga0207652_10810591
810 Ga0207652_11030878
811 Ga0207646_10135423
812 Ga0207646_10226281
813 Ga0207646_10390621
814 Ga0207681_10204812
815 Ga0207687_10020924
816 Ga0207687_10313381
817 Ga0207687_10568714
818 Ga0207700_10072275
819 Ga0207700_10645971
820 Ga0207700_11594500
821 Ga0207664_10018432
822 Ga0207664_10158754
823 Ga0207664_10188510
824 Ga0207664_10534465
825 Ga0207644_10084158
826 Ga0207644_11321038
827 Ga0207690_10022202
828 Ga0207706_10041906
829 Ga0207706_10089140
830 Ga0207686_11759240
831 Ga0207709_10012791
832 Ga0207709_10039236
833 Ga0207670_10064516
834 Ga0207669_10094530
835 Ga0207704_10471163
836 Ga0207704_11273602
837 Ga0207665_10000420
838 Ga0207665_10043243
839 Ga0207665_11374964
840 Ga0207691_10005009
841 Ga0207711_10395530
842 Ga0207689_10226365
843 Ga0207661_10257300
844 Ga0207667_10391988
845 Ga0207651_10025062
846 Ga0207712_10078043
847 Ga0207668_11110030
848 Ga0207668_11333783
849 Ga0207640_10970067
850 Ga0207640_12148569
851 Ga0207658_10179344
852 Ga0207677_10090998
853 Ga0207639_10316956
854 Ga0207678_10045769
855 Ga0207708_10016753
856 Ga0207708_10309409
857 Ga0207708_10843866
858 Ga0207702_10469351
859 Ga0207641_10079670
860 Ga0207648_10012674
861 Ga0207648_10439494
862 Ga0207676_10015168
863 Ga0207676_10030267
864 Ga0207674_10243354
865 Ga0207683_10316319
866 Ga0207698_10218278
867 Ga0207428_10005121
868 Ga0268265_10182989
869 Ga0268264_10054607
870 Ga0373930_0051783
871 Ga0373948_0050747
872 Ga0373951_0077746
873 Ga0373951_0191784
874 Ga0373939_0285175
875 Ga0373941_0070036
876 Ga0373941_0257576
877 Ga0373960_0096019
878 Ga0373943_0362748
879 Ga0373962_0004918
880 Ga0373962_0219678
881 Ga0373931_0075240
882 Ga0373931_0233523
883 Ga0373935_0149594
884 Ga0373937_1119997
885 Ga0373925_1014535
886 Ga0395899_0022189
887 Ga0395899_0235581
888 Ga0395900_0044993
889 Ga0395900_0048369
890 Ga0395900_0127547
891 Ga0395900_1843415
892 Ga0395898_0151703
893 Ga0395898_0178785
894 Ga0395898_0455033
895 Ga0395898_1813555
896 Ga0395905_0014380
897 Ga0395905_0171311
898 Ga0395905_0666622
899 Ga0395901_0097462
900 Ga0395901_0127899
901 Ga0395901_0258335
902 Ga0395901_0523901
903 Ga0395901_1011132
904 Ga0436361_1084359
905 Ga0436362_0287685
906 Ga0439453_0106681
907 Ga0439453_0162008
908 Ga0451807_1820820
909 Ga0439451_002851
910 Ga0439454_046460
911 Ga0439435_0148427
912 Ga0450916_010625
913 Ga0466969_0427715
914 Ga0466966_0091994
915 Ga0466961_0105571
916 Ga0466963_0029452
917 Ga0466964_0012180
918 Ga0466971_0007396
919 Ga0466971_0026695
920 Ga0466968_0010483
921 Ga0466957_0060716
922 Ga0466957_0810810
923 Ga0466959_0010606
924 Ga0451576_0428179
925 Ga0466958_0048816
926 Ga0466967_0001728
927 Ga0466967_0008805
928 Ga0466967_0065315
929 Ga0466967_0538379
930 Ga0466967_1402151
931 Ga0466967_2203534
932 Ga0495592_0007830
933 Ga0495603_0006978
934 Ga0495603_0698722
935 Ga0495641_0088228
936 Ga0495641_0280643
937 Ga0495651_0982415
938 Ga0495582_0012979
939 Ga0495582_0475684
940 Ga0495664_0036655
941 Ga0495664_0180078
942 Ga0495584_0321548
943 Ga0495594_0723799
944 Ga0495607_0093380
945 Ga0495608_0236304
946 Ga0495608_0701431
947 Ga0495628_0257083
948 Ga0495628_0688326
949 Ga0495630_0385762
950 Ga0495644_0031026
951 Ga0495652_0011700
952 Ga0495652_0417638
953 Ga0495587_0664844
954 Ga0495587_0689955
955 Ga0495609_0214502
956 Ga0495645_0023591
957 Ga0495667_0838938
958 Ga0495656_0103096
959 Ga0495634_0313600
960 Ga0495611_0215588
961 Ga0495588_0641609
962 Ga0495599_0018221
963 Ga0495624_0008855
964 Ga0495670_0140006
965 Ga0495604_0038491
966 Ga0495674_0601591
967 Ga0495676_0064952
968 Ga0495680_0711180
969 Ga0495677_0229591
970 Ga0495593_0476600
971 Ga0495602_0541140
972 Ga0496100_0016947
973 Ga0496100_0020554
974 Ga0496100_0163268
975 Ga0496100_0180503
976 Ga0496100_0429423
977 Ga0496100_0576934
978 Ga0496101_0003841
979 Ga0496101_0020586
980 Ga0496101_0022168
981 Ga0496101_0037581
982 Ga0496101_0202361
983 Ga0496101_0395681
984 Ga0496102_0032477
985 Ga0496102_0091922
986 Ga0496102_0093666
987 Ga0496102_0385011
988 Ga0496102_1316363
989 Ga0496103_0040651
990 Ga0496103_0116841
991 Ga0496103_0509065
992 Ga0496104_0076136
993 Ga0496104_0375562
994 Ga0496104_0696801
995 Ga0496104_0760731
996 Ga0496104_1106958
997 Ga0496105_0058349
998 Ga0496105_0061129
999 Ga0496105_0217761
1000 Ga0496105_0325753
1001 Ga0496106_0004525
1002 Ga0496106_0015690
1003 Ga0496106_0151376
1004 Ga0496107_0007921
1005 Ga0496107_0012388
1006 Ga0496107_0012602
1007 Ga0496107_0212927
1008 Ga0496107_0243706
1009 Ga0496107_0270937
1010 Ga0496108_0105631
1011 Ga0496108_0365516
1012 Ga0496108_0985359
1013 Ga0496109_0018488
1014 Ga0496109_0059858
1015 Ga0496110_0075993
1016 Ga0496110_0107610
1017 Ga0496110_0119999
1018 Ga0496111_0004880
1019 Ga0496111_0007157
1020 Ga0496111_0040959
1021 Ga0496112_0191417
1022 Ga0496112_1270485
1023 Ga0496113_0067591
1024 Ga0496113_0111441
1025 Ga0496114_0006524
1026 Ga0496114_0010427
1027 Ga0496114_0062735
1028 Ga0496114_0198774
1029 Ga0496114_1386123
1030 Ga0496115_0000502
1031 Ga0496115_0009011
1032 Ga0496115_0168602
1033 Ga0496115_0437714
1034 Ga0496115_1070904
1035 Ga0501031_0160795
1036 Ga0501033_0379656
1037 Ga0501034_1067023
1038 Ga0501036_0130472
1039 Ga0501036_1088473
1040 Ga0501037_0144409
1041 Ga0501038_0024898
1042 Ga0501039_0022138
1043 Ga0501039_0842971
1044 Ga0501040_0030595
1045 Ga0501040_0223878
1046 Ga0501041_0145370
1047 Ga0501041_0489253
1048 Ga0501041_0798368
1049 Ga0501042_0378985
1050 Ga0501042_1207378
1051 Ga0501042_1251864
1052 Ga0501043_0247602
1053 Ga0501046_0185599
1054 Ga0501046_0733420
1055 Ga0501048_0056870
1056 Ga0501068_0056249
1057 Ga0501068_0404151
1058 Ga0501069_0044560
1059 Ga0501070_0109449
1060 Ga0501071_0039433
1061 Ga0501071_0047160
1062 Ga0501072_0009522
1063 Ga0501072_0128097
1064 Ga0501072_0250256
1065 Ga0501073_0031110
1066 Ga0501074_0171982
1067 Ga0501074_1330544
1068 Ga0501075_0059189
1069 Ga0501075_0061081
1070 Ga0501076_0024216
1071 Ga0501076_0042033
1072 Ga0501077_0016783
1073 Ga0501077_0035214
1074 Ga0501079_0013764
1075 Ga0501080_0049734
1076 Ga0501080_0121355
1077 Ga0501081_0046065
1078 Ga0501081_0135690
1079 Ga0501081_0173983
1080 Ga0501083_0021585
1081 Ga0501035_0383982
1082 Ga0501045_0008493
1083 nmdc:mga0yw44_1019127_c1
1084 nmdc:mga05p37_18869_c1
1085 nmdc:mga05p37_751280_c1
1086 nmdc:mga09592_1145883_c1
1087 nmdc:mga09592_27192_c1
1088 nmdc:mga08y16_1695892_c1
1089 nmdc:mga08y16_175027_c1
1090 nmdc:mga08y16_65124_c1
1091 nmdc:mga0n895_15418_c1
1092 nmdc:mga0n895_2033020_c1
1093 nmdc:mga0n895_23968_c1
1094 nmdc:mga0n895_463_c1
1095 nmdc:mga0n895_55435_c1
1096 nmdc:mga0rr50_111649_c1
1097 nmdc:mga0rr50_12300_c1
1098 nmdc:mga0rr50_48010_c1
1099 nmdc:mga08x19_162418_c1
1100 nmdc:mga08x19_53638_c1
1101 nmdc:mga08x19_9453_c1
1102 nmdc:mga0a205_1316773_c1
1103 nmdc:mga0a205_304184_c1
1104 nmdc:mga0a205_3324_c1
1105 nmdc:mga0a205_363843_c1
1106 nmdc:mga0a205_41996_c1
1107 nmdc:mga0a205_625648_c1
1108 Ga0495601_0005579
1109 Ga0495612_0074575
1110 Ga0495612_0299735
1111 Ga0495619_0481683
1112 Ga0495619_1000525
1113 Ga0501084_0003825
1114 Ga0501084_0111834
1115 Ga0501082_0016555
1116 Ga0466962_0004488
1117 Ga0466962_0014467
1118 Ga0466962_0322345
1119 Ga0530510_0037663
1120 Ga0530510_0817044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.578 10 81
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.5595 10 81
3lvy-assembly3.cif.gz_F crystal structure of carboxymuconolactone decarboxylase family protein smu.961 from streptococcus mutans 0.5485 6 79
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.5041 10 81
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.4898 10 81
ID Description Score Start End Superfamily
af_A4HXU1_714_811_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6249 14 79 1.20.1290.10
af_Q54WU6_150_269_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.6112 12 79 1.20.1290.10
3td9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.5822 6 39 3.40.50.2300
4nleB03 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase Protein R1; domain 1;Fumarase/aspartase (C-terminal domain) 0.5761 13 34 1.10.40.30
3c1lG01 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;AhpD-like 0.5735 10 59 1.20.5.810
ID Description Score Start End GO Terms
AF-A0A355B3U1-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8774 46 81 GO:0051920
AF-A0A6L4B680-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8675 46 81 GO:0051920
AF-A0A7V3RPY6-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.838 39 81
AF-A0A355B3U1-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8213 46 81 GO:0051920
AF-A0A2W6AN68-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.8189 27 81

Map