F463555

General Info

Members Datasets Scaffolds Average Seq Length
559 233 1118 145

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_12119631|Ga0157369_121196311
Length 168
Sequence LVILDRDERCVKLQNYSITKLQNSLLRIGQSHYDSLRQHGEETYPHECCGVLLGRFDDDGTRVVTSLARAGNTRIDSPQNRYNIDPKELVRIQREGREREEDIIGFYHSHPDHPAQWSKTDLAEAHWFGCSYVITSVEKGKAVLTNSFELTGFDENDKQLVDEKIEIV

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
85 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
128 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
129 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
150 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
151 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
222 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
223 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
224 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.04
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 15.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_12119631 3300013105 Bacteria 570
2 LJNas_1000192 3300000546 Bacteria 10251
3 rootH1_10320061 3300003323 Unclassified 1188
4 Ga0070683_100038138 3300005329 Bacteria 4402
5 Ga0070690_100115752 3300005330 Bacteria 1794
6 Ga0070670_100036414 3300005331 Bacteria 4234
7 Ga0068869_100065970 3300005334 Bacteria 2666
8 Ga0070680_100040539 3300005336 Bacteria 3771
9 Ga0070680_100101741 3300005336 Bacteria 2385
10 Ga0070682_100338844 3300005337 Bacteria 1117
11 Ga0068868_100025635 3300005338 Bacteria 4488
12 Ga0068868_100052668 3300005338 Bacteria 3204
13 Ga0070660_100545220 3300005339 Bacteria 967
14 Ga0070689_100026605 3300005340 Bacteria 4356
15 Ga0070687_100336780 3300005343 Bacteria 969
16 Ga0070673_100082209 3300005364 Bacteria 2614
17 Ga0070659_101407099 3300005366 Bacteria 620
18 Ga0070709_10016930 3300005434 Unclassified 4172
19 Ga0070709_10236086 3300005434 Unclassified 1311
20 Ga0070709_11354234 3300005434 Bacteria 575
21 Ga0070714_100001617 3300005435 Bacteria 16386
22 Ga0070714_100051140 3300005435 Bacteria 3522
23 Ga0070714_100060170 3300005435 Bacteria 3259
24 Ga0070714_100078796 3300005435 Bacteria 2864
25 Ga0070714_100101648 3300005435 Bacteria 2533
26 Ga0070714_100162278 3300005435 Bacteria 2023
27 Ga0070714_100199226 3300005435 Bacteria 1831
28 Ga0070714_100386768 3300005435 Unclassified 1320
29 Ga0070714_100475651 3300005435 Bacteria 1189
30 Ga0070714_100577382 3300005435 Bacteria 1078
31 Ga0070714_100715899 3300005435 Bacteria 966
32 Ga0070714_100776324 3300005435 Bacteria 927
33 Ga0070714_100790300 3300005435 Bacteria 919
34 Ga0070714_100906665 3300005435 Bacteria 856
35 Ga0070714_102226035 3300005435 Bacteria 534
36 Ga0070713_100001070 3300005436 Bacteria 17503
37 Ga0070713_100018852 3300005436 Bacteria 5253
38 Ga0070713_100021771 3300005436 Bacteria 4940
39 Ga0070713_100029289 3300005436 Bacteria 4358
40 Ga0070713_100057955 3300005436 Bacteria 3228
41 Ga0070713_100083385 3300005436 Bacteria 2732
42 Ga0070713_100093276 3300005436 Bacteria 2594
43 Ga0070713_100403108 3300005436 Bacteria 1277
44 Ga0070713_100658429 3300005436 Unclassified 998
45 Ga0070713_101701725 3300005436 Unclassified 612
46 Ga0070713_102447262 3300005436 Unclassified 505
47 Ga0070710_10015996 3300005437 Bacteria 3808
48 Ga0070710_10020454 3300005437 Bacteria 3433
49 Ga0070710_10095928 3300005437 Bacteria 1757
50 Ga0070710_10096613 3300005437 Viruses 1751
51 Ga0070710_10700038 3300005437 Bacteria 715
52 Ga0070711_100001143 3300005439 Bacteria 14230
53 Ga0070711_100005263 3300005439 Bacteria 7719
54 Ga0070711_100022497 3300005439 Bacteria 4087
55 Ga0070711_100210316 3300005439 Bacteria 1506
56 Ga0070711_100362885 3300005439 Bacteria 1167
57 Ga0070711_100446878 3300005439 Bacteria 1058
58 Ga0070711_100489271 3300005439 Bacteria 1013
59 Ga0070708_100026469 3300005445 Bacteria 4965
60 Ga0070708_100050270 3300005445 Unclassified 3690
61 Ga0070708_100077682 3300005445 Bacteria 3000
62 Ga0070678_100049234 3300005456 Bacteria 3040
63 Ga0070681_10001119 3300005458 Bacteria 22976
64 Ga0070681_10617495 3300005458 Bacteria 998
65 Ga0068867_100002410 3300005459 Bacteria 13153
66 Ga0070706_100000556 3300005467 Bacteria 43474
67 Ga0070706_100227571 3300005467 Bacteria 1741
68 Ga0070706_100329866 3300005467 Unclassified 1423
69 Ga0070707_100025045 3300005468 Bacteria 5659
70 Ga0070707_100166812 3300005468 Viruses 2146
71 Ga0070698_100002213 3300005471 Bacteria 21527
72 Ga0070699_100018442 3300005518 Bacteria 5995
73 Ga0070679_100014600 3300005530 Bacteria 7547
74 Ga0070684_100060167 3300005535 Bacteria 3321
75 Ga0070684_100165834 3300005535 Bacteria 2005
76 Ga0070684_100206045 3300005535 Bacteria 1792
77 Ga0070697_100011925 3300005536 Bacteria 6804
78 Ga0070697_100020532 3300005536 Bacteria 5227
79 Ga0070697_100082061 3300005536 Bacteria 2657
80 Ga0068853_100799466 3300005539 Bacteria 903
81 Ga0068853_101631369 3300005539 Bacteria 625
82 Ga0070693_100004934 3300005547 Bacteria 6369
83 Ga0070693_100367233 3300005547 Bacteria 989
84 Ga0070704_101641677 3300005549 Bacteria 593
85 Ga0068855_100000605 3300005563 Bacteria 44009
86 Ga0068855_100009953 3300005563 Bacteria 11463
87 Ga0068855_100013792 3300005563 Bacteria 9743
88 Ga0068855_100383244 3300005563 Bacteria 1543
89 Ga0068855_100404620 3300005563 Bacteria 1495
90 Ga0070664_100091777 3300005564 Bacteria 2629
91 Ga0070664_100114256 3300005564 Unclassified 2359
92 Ga0068857_100000815 3300005577 Bacteria 23344
93 Ga0068857_100011517 3300005577 Bacteria 7694
94 Ga0068854_100010397 3300005578 Bacteria 6033
95 Ga0068854_100067834 3300005578 Bacteria 2600
96 Ga0068856_100001172 3300005614 Bacteria 27586
97 Ga0068856_100001229 3300005614 Bacteria 26872
98 Ga0068856_100002225 3300005614 Bacteria 20054
99 Ga0068856_100086819 3300005614 Bacteria 3109
100 Ga0068856_100195199 3300005614 Bacteria 2038
101 Ga0068856_101950328 3300005614 Bacteria 598
102 Ga0068852_100144100 3300005616 Bacteria 2208
103 Ga0068852_100240108 3300005616 Bacteria 1731
104 Ga0068859_100001113 3300005617 Bacteria 27438
105 Ga0068864_100001145 3300005618 Bacteria 22127
106 Ga0068864_100027086 3300005618 Bacteria 4837
107 Ga0068866_10103216 3300005718 Bacteria 1577
108 Ga0068866_10223706 3300005718 Bacteria 1137
109 Ga0068851_10386207 3300005834 Bacteria 821
110 Ga0068870_10431593 3300005840 Bacteria 864
111 Ga0068863_100017251 3300005841 Bacteria 6924
112 Ga0068858_100016787 3300005842 Bacteria 6874
113 Ga0068858_100026042 3300005842 Bacteria 5439
114 Ga0068858_100130037 3300005842 Bacteria 2360
115 Ga0068860_100199551 3300005843 Bacteria 1938
116 Ga0068860_100241264 3300005843 Unclassified 1758
117 Ga0070717_10004741 3300006028 Bacteria 9886
118 Ga0070717_10009705 3300006028 Bacteria 7244
119 Ga0070717_10012237 3300006028 Bacteria 6542
120 Ga0070717_10026221 3300006028 Bacteria 4647
121 Ga0070717_10043776 3300006028 Unclassified 3654
122 Ga0070717_10052538 3300006028 Unclassified 3357
123 Ga0070717_10109926 3300006028 Bacteria 2350
124 Ga0070717_10126662 3300006028 Bacteria 2193
125 Ga0070717_10171780 3300006028 Unclassified 1886
126 Ga0070717_10194096 3300006028 Bacteria 1775
127 Ga0070717_10405608 3300006028 Bacteria 1225
128 Ga0070717_10546143 3300006028 Bacteria 1049
129 Ga0070717_10589684 3300006028 Bacteria 1008
130 Ga0070717_10610829 3300006028 Unclassified 989
131 Ga0070717_10639441 3300006028 Bacteria 966
132 Ga0070717_10684006 3300006028 Bacteria 932
133 Ga0070717_10923209 3300006028 Bacteria 795
134 Ga0070715_10120280 3300006163 Bacteria 1251
135 Ga0070716_100005164 3300006173 Bacteria 6310
136 Ga0070716_100008103 3300006173 Bacteria 5202
137 Ga0070716_100016325 3300006173 Unclassified 3829
138 Ga0070716_100205166 3300006173 Unclassified 1313
139 Ga0070716_101252675 3300006173 Unclassified 598
140 Ga0070712_100001117 3300006175 Bacteria 16165
141 Ga0070712_100008348 3300006175 Bacteria 6512
142 Ga0070712_100039595 3300006175 Bacteria 3226
143 Ga0070712_100046898 3300006175 Unclassified 2989
144 Ga0070712_100145343 3300006175 Bacteria 1814
145 Ga0070712_101379948 3300006175 Bacteria 615
146 Ga0097621_100000727 3300006237 Bacteria 23037
147 Ga0097621_100008272 3300006237 Bacteria 7486
148 Ga0097621_100026474 3300006237 Bacteria 4550
149 Ga0097621_100038291 3300006237 Bacteria 3848
150 Ga0097621_100166130 3300006237 Bacteria 1900
151 Ga0068871_100000535 3300006358 Bacteria 25899
152 Ga0068871_100004412 3300006358 Bacteria 9781
153 Ga0068871_100029865 3300006358 Bacteria 4287
154 Ga0068871_100122637 3300006358 Bacteria 2197
155 Ga0068871_100209912 3300006358 Unclassified 1684
156 Ga0075434_100062447 3300006871 Bacteria 3708
157 Ga0068865_101188967 3300006881 Bacteria 675
158 Ga0075436_100001249 3300006914 Bacteria 17271
159 Ga0075436_100005356 3300006914 Bacteria 8830
160 Ga0075436_100049577 3300006914 Bacteria 2898
161 Ga0075436_100160328 3300006914 Bacteria 1585
162 Ga0075436_100201698 3300006914 Unclassified 1409
163 Ga0097620_100001113 3300006931 Bacteria 27438
164 Ga0075435_100015823 3300007076 Bacteria 5678
165 Ga0075435_100163645 3300007076 Bacteria 1875
166 Ga0099794_10191363 3300007265 Bacteria 1046
167 Ga0099795_10034053 3300007788 Unclassified 1772
168 Ga0099795_10429209 3300007788 Unclassified 605
169 Ga0105240_10020222 3300009093 Bacteria 8886
170 Ga0105240_10058494 3300009093 Bacteria 4812
171 Ga0105240_10099493 3300009093 Unclassified 3539
172 Ga0105245_10025587 3300009098 Bacteria 5190
173 Ga0114129_11556497 3300009147 Unclassified 811
174 Ga0105241_10057904 3300009174 Bacteria 2974
175 Ga0105248_10109450 3300009177 Bacteria 3115
176 Ga0105248_10683856 3300009177 Bacteria 1158
177 Ga0105237_10570459 3300009545 Bacteria 1138
178 Ga0105237_10840108 3300009545 Unclassified 925
179 Ga0105237_11223322 3300009545 Bacteria 758
180 Ga0105237_12082067 3300009545 Bacteria 576
181 Ga0105238_10001026 3300009551 Bacteria 28422
182 Ga0105238_11469049 3300009551 Bacteria 710
183 Ga0105239_10023174 3300010375 Bacteria 6843
184 Ga0105239_10364507 3300010375 Bacteria 1632
185 Ga0105246_10024984 3300011119 Bacteria 3890
186 Ga0157373_10006610 3300013100 Bacteria 8649
187 Ga0157373_10057040 3300013100 Bacteria 2771
188 Ga0157373_10284954 3300013100 Bacteria 1171
189 Ga0157371_10052622 3300013102 Bacteria 2891
190 Ga0157371_10056664 3300013102 Bacteria 2780
191 Ga0157371_10287363 3300013102 Bacteria 1189
192 Ga0157370_10015863 3300013104 Bacteria 7644
193 Ga0157370_10178316 3300013104 Bacteria 1975
194 Ga0157369_10000353 3300013105 Bacteria 61209
195 Ga0157369_10032077 3300013105 Bacteria 5778
196 Ga0157369_10048026 3300013105 Bacteria 4632
197 Ga0157369_10078635 3300013105 Bacteria 3533
198 Ga0157369_10195593 3300013105 Bacteria 2123
199 Ga0157374_10000232 3300013296 Bacteria 51675
200 Ga0157374_10000999 3300013296 Bacteria 24519
201 Ga0157374_10003773 3300013296 Bacteria 12742
202 Ga0157374_10089763 3300013296 Unclassified 2929
203 Ga0157378_10000493 3300013297 Bacteria 37407
204 Ga0157378_10000833 3300013297 Bacteria 28671
205 Ga0157378_10003997 3300013297 Bacteria 13024
206 Ga0157378_12410242 3300013297 Bacteria 578
207 Ga0157372_10000565 3300013307 Bacteria 40736
208 Ga0157372_10001006 3300013307 Bacteria 30802
209 Ga0157372_10002849 3300013307 Bacteria 18696
210 Ga0157372_10007642 3300013307 Bacteria 11495
211 Ga0157372_10010811 3300013307 Bacteria 9717
212 Ga0157372_10011500 3300013307 Bacteria 9413
213 Ga0157372_10200170 3300013307 Unclassified 2313
214 Ga0157372_10228711 3300013307 Bacteria 2156
215 Ga0157372_10516168 3300013307 Bacteria 1393
216 Ga0157372_12214626 3300013307 Bacteria 631
217 Ga0182008_10505832 3300014497 Bacteria 665
218 Ga0157377_10674951 3300014745 Bacteria 747
219 Ga0157376_10006887 3300014969 Bacteria 8049
220 Ga0157376_10251905 3300014969 Bacteria 1650
221 Ga0182005_1088581 3300015265 Bacteria 859
222 Ga0206353_11779135 3300020082 Bacteria 715
223 Ga0213874_10033002 3300021377 Bacteria 1507
224 Ga0213875_10142358 3300021388 Bacteria 1123
225 Ga0224570_100670 3300022730 Bacteria 2715
226 Ga0224572_1000267 3300024225 Bacteria 5379
227 Ga0224572_1028077 3300024225 Unclassified 1078
228 Ga0224572_1065715 3300024225 Unclassified 670
229 Ga0228598_1000341 3300024227 Bacteria 9190
230 Ga0228598_1002314 3300024227 Bacteria 4166
231 Ga0207692_10007357 3300025898 Bacteria 4512
232 Ga0207692_10032765 3300025898 Bacteria 2500
233 Ga0207692_10087333 3300025898 Bacteria 1683
234 Ga0207692_10172148 3300025898 Bacteria 1255
235 Ga0207692_10798072 3300025898 Bacteria 617
236 Ga0207642_10075500 3300025899 Bacteria 1619
237 Ga0207642_10200033 3300025899 Bacteria 1103
238 Ga0207685_10039802 3300025905 Bacteria 1747
239 Ga0207685_10829040 3300025905 Unclassified 511
240 Ga0207699_10004208 3300025906 Bacteria 6885
241 Ga0207699_10043904 3300025906 Bacteria 2599
242 Ga0207699_10077352 3300025906 Bacteria 2052
243 Ga0207684_10005106 3300025910 Bacteria 12235
244 Ga0207684_10233243 3300025910 Bacteria 1588
245 Ga0207684_10424647 3300025910 Unclassified 1142
246 Ga0207654_10132480 3300025911 Bacteria 1579
247 Ga0207654_10264064 3300025911 Bacteria 1159
248 Ga0207707_10001501 3300025912 Bacteria 21531
249 Ga0207707_10003208 3300025912 Bacteria 14521
250 Ga0207707_10286340 3300025912 Bacteria 1426
251 Ga0207707_10753907 3300025912 Bacteria 814
252 Ga0207695_10016411 3300025913 Bacteria 8664
253 Ga0207695_10099046 3300025913 Bacteria 2913
254 Ga0207695_10105293 3300025913 Bacteria 2809
255 Ga0207695_10194829 3300025913 Bacteria 1943
256 Ga0207671_10706916 3300025914 Bacteria 801
257 Ga0207693_10001917 3300025915 Bacteria 18197
258 Ga0207693_10009850 3300025915 Bacteria 7773
259 Ga0207693_10011594 3300025915 Bacteria 7130
260 Ga0207693_10036609 3300025915 Bacteria 3868
261 Ga0207693_10047757 3300025915 Bacteria 3362
262 Ga0207693_10280075 3300025915 Unclassified 1307
263 Ga0207663_10000765 3300025916 Bacteria 14367
264 Ga0207663_10004885 3300025916 Bacteria 6710
265 Ga0207663_10016495 3300025916 Bacteria 4098
266 Ga0207663_10030666 3300025916 Bacteria 3174
267 Ga0207663_10738436 3300025916 Bacteria 781
268 Ga0207663_11214326 3300025916 Unclassified 607
269 Ga0207660_10231890 3300025917 Bacteria 1452
270 Ga0207660_10994425 3300025917 Bacteria 684
271 Ga0207657_10476481 3300025919 Bacteria 979
272 Ga0207649_10271165 3300025920 Bacteria 1230
273 Ga0207652_10048688 3300025921 Bacteria 3624
274 Ga0207652_10773046 3300025921 Bacteria 854
275 Ga0207646_10000341 3300025922 Bacteria 63056
276 Ga0207646_10087640 3300025922 Bacteria 2785
277 Ga0207694_10001534 3300025924 Bacteria 19645
278 Ga0207650_10254938 3300025925 Bacteria 1421
279 Ga0207687_10069912 3300025927 Bacteria 2505
280 Ga0207700_10021275 3300025928 Bacteria 4425
281 Ga0207700_10045101 3300025928 Unclassified 3251
282 Ga0207700_10049888 3300025928 Bacteria 3116
283 Ga0207700_10091522 3300025928 Bacteria 2402
284 Ga0207700_10192561 3300025928 Bacteria 1714
285 Ga0207700_10193849 3300025928 Bacteria 1709
286 Ga0207700_10491405 3300025928 Bacteria 1085
287 Ga0207700_10671220 3300025928 Unclassified 924
288 Ga0207700_10846583 3300025928 Unclassified 818
289 Ga0207700_11011248 3300025928 Bacteria 744
290 Ga0207700_11074535 3300025928 Bacteria 720
291 Ga0207700_11957171 3300025928 Unclassified 513
292 Ga0207664_10000440 3300025929 Bacteria 29677
293 Ga0207664_10004229 3300025929 Bacteria 9702
294 Ga0207664_10028062 3300025929 Bacteria 4274
295 Ga0207664_10033336 3300025929 Bacteria 3955
296 Ga0207664_10131100 3300025929 Bacteria 2110
297 Ga0207664_10282131 3300025929 Bacteria 1458
298 Ga0207664_10345248 3300025929 Unclassified 1317
299 Ga0207664_10402578 3300025929 Bacteria 1217
300 Ga0207664_10473238 3300025929 Bacteria 1120
301 Ga0207664_10608975 3300025929 Unclassified 981
302 Ga0207664_10722368 3300025929 Bacteria 896
303 Ga0207664_10872238 3300025929 Bacteria 809
304 Ga0207664_10973004 3300025929 Bacteria 761
305 Ga0207664_11165635 3300025929 Bacteria 688
306 Ga0207644_10021594 3300025931 Unclassified 4389
307 Ga0207706_10654653 3300025933 Bacteria 899
308 Ga0207670_10214521 3300025936 Bacteria 1470
309 Ga0207665_10000047 3300025939 Bacteria 76975
310 Ga0207665_10001358 3300025939 Bacteria 16495
311 Ga0207665_10014215 3300025939 Bacteria 5238
312 Ga0207665_10953373 3300025939 Unclassified 682
313 Ga0207711_10069487 3300025941 Bacteria 3053
314 Ga0207711_11000391 3300025941 Bacteria 776
315 Ga0207689_10125815 3300025942 Bacteria 2109
316 Ga0207661_10038136 3300025944 Bacteria 3764
317 Ga0207661_10231207 3300025944 Bacteria 1637
318 Ga0207661_11241918 3300025944 Bacteria 685
319 Ga0207679_10178085 3300025945 Bacteria 1756
320 Ga0207667_10000319 3300025949 Bacteria 66938
321 Ga0207667_10017148 3300025949 Bacteria 8164
322 Ga0207667_10017879 3300025949 Bacteria 7968
323 Ga0207667_10386429 3300025949 Bacteria 1426
324 Ga0207667_10702273 3300025949 Bacteria 1014
325 Ga0207651_10162915 3300025960 Bacteria 1750
326 Ga0207651_10187932 3300025960 Bacteria 1645
327 Ga0207640_10030711 3300025981 Bacteria 3312
328 Ga0207640_10050863 3300025981 Bacteria 2691
329 Ga0207677_10005229 3300026023 Bacteria 7024
330 Ga0207677_10025214 3300026023 Bacteria 3706
331 Ga0207703_10023498 3300026035 Bacteria 4843
332 Ga0207703_10036755 3300026035 Bacteria 3899
333 Ga0207703_10266631 3300026035 Bacteria 1550
334 Ga0207639_10182518 3300026041 Unclassified 1786
335 Ga0207639_11986491 3300026041 Unclassified 543
336 Ga0207702_10000408 3300026078 Bacteria 49067
337 Ga0207702_10000595 3300026078 Bacteria 40019
338 Ga0207702_10023470 3300026078 Bacteria 5116
339 Ga0207702_10092349 3300026078 Bacteria 2652
340 Ga0207702_10101926 3300026078 Bacteria 2536
341 Ga0207702_10235025 3300026078 Bacteria 1714
342 Ga0207702_11823867 3300026078 Bacteria 600
343 Ga0207702_11895642 3300026078 Bacteria 587
344 Ga0207641_10012922 3300026088 Bacteria 6851
345 Ga0207676_10017245 3300026095 Bacteria 5233
346 Ga0207676_10047024 3300026095 Bacteria 3342
347 Ga0207674_10002377 3300026116 Bacteria 23787
348 Ga0207674_10009762 3300026116 Bacteria 10933
349 Ga0207698_10125775 3300026142 Bacteria 2180
350 Ga0207698_10140357 3300026142 Bacteria 2081
351 Ga0207698_10344980 3300026142 Bacteria 1404
352 Ga0265354_1005803 3300028016 Unclassified 1241
353 Ga0265356_1000062 3300028017 Bacteria 17622
354 Ga0265356_1009767 3300028017 Bacteria 1078
355 Ga0265355_1002079 3300028036 Bacteria 1370
356 Ga0268264_10209149 3300028381 Bacteria 1790
357 Ga0268264_10405125 3300028381 Unclassified 1312
358 Ga0265336_10214465 3300028666 Bacteria 572
359 Ga0265338_10093651 3300028800 Bacteria 2474
360 Ga0265338_10392383 3300028800 Bacteria 991
361 Ga0265762_1003108 3300030760 Bacteria 2966
362 Ga0265762_1055937 3300030760 Bacteria 801
363 Ga0265765_1001490 3300030879 Bacteria 2157
364 Ga0265760_10000528 3300031090 Bacteria 10748
365 Ga0265760_10006542 3300031090 Unclassified 3333
366 Ga0265760_10017724 3300031090 Bacteria 2046
367 Ga0265339_10346701 3300031249 Bacteria 701
368 Ga0265316_10585210 3300031344 Bacteria 792
369 Ga0265342_10555539 3300031712 Bacteria 582
370 Ga0307405_10657132 3300031731 Unclassified 863
371 Ga0307413_11198731 3300031824 Unclassified 660
372 Ga0307410_10020439 3300031852 Bacteria 4050
373 Ga0307410_10043028 3300031852 Bacteria 2989
374 Ga0307410_11040538 3300031852 Unclassified 707
375 Ga0307407_10180715 3300031903 Unclassified 1398
376 Ga0307412_11974003 3300031911 Unclassified 540
377 Ga0307409_100000640 3300031995 Bacteria 15448
378 Ga0307409_100062633 3300031995 Bacteria 2913
379 Ga0307416_100206963 3300032002 Bacteria 1867
380 Ga0307416_100271124 3300032002 Bacteria 1666
381 Ga0307414_10235668 3300032004 Bacteria 1512
382 Ga0307411_10006793 3300032005 Bacteria 5760
383 Ga0307411_10426354 3300032005 Bacteria 1103
384 Ga0307415_100041570 3300032126 Bacteria 3053
385 Ga0316215_1007882 3300033544 Unclassified 1043
386 Ga0316214_1042770 3300033545 Unclassified 651
387 Ga0316212_1022410 3300033547 Bacteria 885
388 Ga0373926_0075980 3300035083 Unclassified 1238
389 Ga0373934_0254390 3300035086 Unclassified 726
390 Ga0373940_0063628 3300035088 Bacteria 1060
391 Ga0373944_0019596 3300035089 Viruses 1943
392 Ga0373923_0005052 3300035111 Viruses 4444
393 Ga0373923_0129184 3300035111 Bacteria 1134
394 Ga0373932_0319655 3300035112 Bacteria 583
395 Ga0373936_0002371 3300035113 Bacteria 7050
396 Ga0373936_0008875 3300035113 Unclassified 3790
397 Ga0373936_0163929 3300035113 Bacteria 969
398 Ga0373945_0187712 3300035116 Unclassified 853
399 Ga0373954_0050605 3300035118 Bacteria 1949
400 Ga0373954_0064126 3300035118 Bacteria 1737
401 Ga0373954_0354435 3300035118 Bacteria 725
402 Ga0373956_0016067 3300035119 Viruses 3139
403 Ga0373957_0115728 3300035120 Viruses 1082
404 Ga0373943_0000241 3300035170 Bacteria 22571
405 Ga0373943_0035984 3300035170 Unclassified 2369
406 Ga0373943_0216018 3300035170 Bacteria 1066
407 Ga0373943_0380017 3300035170 Bacteria 813
408 Ga0373943_0442727 3300035170 Unclassified 754
409 Ga0373943_0666132 3300035170 Bacteria 615
410 Ga0373946_0013358 3300035171 Viruses 3087
411 Ga0373946_0025687 3300035171 Unclassified 2318
412 Ga0373946_0118656 3300035171 Bacteria 1205
413 Ga0373955_0094885 3300035172 Bacteria 1705
414 Ga0373955_0162336 3300035172 Bacteria 1319
415 Ga0373942_0038133 3300035207 Bacteria 1302
416 Ga0373924_0034453 3300035410 Bacteria 2049
417 Ga0373931_0070701 3300035691 Unclassified 1905
418 Ga0373931_0287435 3300035691 Bacteria 1012
419 Ga0373935_0000998 3300035692 Bacteria 15413
420 Ga0373935_0107988 3300035692 Bacteria 1843
421 Ga0373935_0279330 3300035692 Unclassified 1175
422 Ga0373935_0518195 3300035692 Bacteria 867
423 Ga0373927_0000016 3300035695 Bacteria 154151
424 Ga0373927_0140516 3300035695 Bacteria 1579
425 Ga0373927_0248250 3300035695 Unclassified 1170
426 Ga0373927_0927836 3300035695 Bacteria 574
427 Ga0373933_0018238 3300035724 Bacteria 3945
428 Ga0373933_0098497 3300035724 Bacteria 1812
429 Ga0373933_0311714 3300035724 Bacteria 1019
430 Ga0373947_0000042 3300035725 Bacteria 62180
431 Ga0373947_0019941 3300035725 Bacteria 3870
432 Ga0373947_0028335 3300035725 Unclassified 3283
433 Ga0373947_0028681 3300035725 Unclassified 3265
434 Ga0373947_0274481 3300035725 Unclassified 1120
435 Ga0373947_0428313 3300035725 Unclassified 895
436 Ga0373937_0028716 3300036401 Viruses 5035
437 Ga0373937_0114696 3300036401 Bacteria 2508
438 Ga0373937_0116370 3300036401 Bacteria 2490
439 Ga0373937_0416260 3300036401 Bacteria 1275
440 Ga0373937_0859362 3300036401 Unclassified 856
441 Ga0373925_0000744 3300037068 Bacteria 29911
442 Ga0373925_0004581 3300037068 Bacteria 10446
443 Ga0373925_0017365 3300037068 Bacteria 5215
444 Ga0373925_0026058 3300037068 Viruses 4275
445 Ga0373925_0034619 3300037068 Bacteria 3723
446 Ga0373925_0084971 3300037068 Bacteria 2412
447 Ga0373925_0124940 3300037068 Bacteria 2001
448 Ga0373925_0234957 3300037068 Bacteria 1467
449 Ga0373925_0357073 3300037068 Viruses 1187
450 Ga0373925_0384485 3300037068 Bacteria 1143
451 Ga0373925_0731894 3300037068 Bacteria 815
452 Ga0395905_0842861 3300037471 Bacteria 820
453 Ga0436364_0260541 3300037853 Bacteria 2038
454 Ga0436365_0602899 3300039437 Bacteria 639
455 Ga0436365_1032459 3300039437 Bacteria 3227
456 Ga0436365_1145925 3300039437 Unclassified 894
457 Ga0436360_1185229 3300039438 Unclassified 691
458 Ga0436363_1441320 3300039450 Bacteria 3157
459 Ga0436363_1451128 3300039450 Bacteria 4895
460 Ga0436362_0016315 3300039453 Bacteria 1387
461 Ga0466966_0179233 3300044684 Unclassified 1286
462 Ga0466966_0979855 3300044684 Unclassified 510
463 Ga0466957_0333254 3300044842 Bacteria 1026
464 Ga0451576_0069897 3300045051 Bacteria 3654
465 Ga0451576_0951395 3300045051 Bacteria 901
466 Ga0451576_2440112 3300045051 Bacteria 535
467 Ga0466958_0453739 3300045836 Bacteria 830
468 Ga0466958_0648143 3300045836 Unclassified 687
469 Ga0466967_0000657 3300045976 Bacteria 17383
470 Ga0466967_0403303 3300045976 Bacteria 1331
471 Ga0466967_0578948 3300045976 Bacteria 1106
472 Ga0495592_0529011 3300046454 Bacteria 728
473 Ga0495603_0593182 3300046455 Bacteria 634
474 Ga0495629_0150194 3300046459 Viruses 1619
475 Ga0495629_0524506 3300046459 Bacteria 797
476 Ga0495651_0137632 3300046462 Unclassified 1775
477 Ga0495651_0850467 3300046462 Unclassified 560
478 Ga0495653_0433001 3300046463 Unclassified 830
479 Ga0495580_0000318 3300046472 Bacteria 39377
480 Ga0495580_0000343 3300046472 Bacteria 37952
481 Ga0495580_0000933 3300046472 Bacteria 25557
482 Ga0495580_0003980 3300046472 Bacteria 12473
483 Ga0495580_0007710 3300046472 Bacteria 8630
484 Ga0495580_0038259 3300046472 Bacteria 3437
485 Ga0495580_0077528 3300046472 Unclassified 2318
486 Ga0495580_0090957 3300046472 Unclassified 2124
487 Ga0495580_0095430 3300046472 Bacteria 2068
488 Ga0495580_0104613 3300046472 Bacteria 1967
489 Ga0495580_0167534 3300046472 Bacteria 1519
490 Ga0495582_0002758 3300046473 Viruses 9796
491 Ga0495582_0006228 3300046473 Bacteria 6645
492 Ga0495582_0327682 3300046473 Bacteria 881
493 Ga0495664_0005390 3300046477 Bacteria 7022
494 Ga0495664_0506498 3300046477 Bacteria 721
495 Ga0495594_0795002 3300046499 Bacteria 533
496 Ga0495608_0328264 3300046511 Unclassified 944
497 Ga0495628_0204947 3300046516 Viruses 1485
498 Ga0495630_0128275 3300046517 Bacteria 1926
499 Ga0495630_0658633 3300046517 Bacteria 802
500 Ga0495665_0000457 3300046531 Bacteria 20486
501 Ga0495665_0052585 3300046531 Bacteria 2156
502 Ga0495665_0311930 3300046531 Bacteria 804
503 Ga0495665_0438355 3300046531 Bacteria 661
504 Ga0495586_0235039 3300046535 Unclassified 1044
505 Ga0495609_0263900 3300046538 Bacteria 707
506 Ga0495588_0167158 3300046674 Bacteria 1163
507 Ga0495623_0043332 3300046679 Bacteria 2864
508 Ga0495623_0167169 3300046679 Viruses 1288
509 Ga0495658_0024983 3300046683 Bacteria 3189
510 Ga0495658_0219395 3300046683 Bacteria 1190
511 Ga0495613_0141908 3300046689 Bacteria 1716
512 Ga0495581_0190460 3300047315 Bacteria 1200
513 Ga0495674_0009027 3300047319 Bacteria 9475
514 Ga0495674_0063396 3300047319 Viruses 3215
515 Ga0495674_0250656 3300047319 Bacteria 1457
516 Ga0495676_0053188 3300047321 Viruses 3229
517 Ga0495676_0187727 3300047321 Bacteria 1444
518 Ga0495680_0875035 3300047322 Unclassified 582
519 Ga0495602_0137918 3300048088 Bacteria 1935
520 Ga0495602_0170468 3300048088 Bacteria 1690
521 Ga0495602_0219757 3300048088 Bacteria 1435
522 Ga0495602_0376912 3300048088 Bacteria 1017
523 Ga0496100_0628790 3300048903 Bacteria 835
524 Ga0496100_0887269 3300048903 Bacteria 700
525 Ga0496101_1156758 3300048904 Bacteria 607
526 Ga0496102_0017453 3300048905 Bacteria 6288
527 Ga0496102_0027808 3300048905 Bacteria 5051
528 Ga0496103_0178369 3300048906 Bacteria 1365
529 Ga0496104_0158183 3300048907 Viruses 2174
530 Ga0496104_0252623 3300048907 Bacteria 1676
531 Ga0496105_0151611 3300048908 Bacteria 1905
532 Ga0496109_1190827 3300048912 Unclassified 699
533 Ga0496112_0010137 3300048915 Bacteria 8536
534 Ga0496112_0060399 3300048915 Bacteria 3736
535 Ga0496112_0134860 3300048915 Bacteria 2439
536 Ga0496113_0115839 3300048916 Bacteria 2091
537 Ga0496113_0321215 3300048916 Bacteria 1241
538 Ga0496114_0355383 3300048917 Viruses 1296
539 Ga0496115_0311759 3300048918 Bacteria 1288
540 Ga0501298_007829 3300049521 Bacteria 1782
541 Ga0501300_042442 3300049523 Unclassified 688
542 Ga0501201_024495 3300049651 Unclassified 657
543 Ga0501259_033539 3300049688 Bacteria 980
544 Ga0501234_020367 3300049707 Bacteria 1055
545 Ga0501270_026083 3300049767 Bacteria 930
546 nmdc:mga09592_972303_c1 3300050508 Unclassified 711
547 nmdc:mga0n895_21241_c1 3300050512 Bacteria 6066
548 nmdc:mga0rr50_12355_c1 3300050513 Bacteria 5515
549 nmdc:mga0rr50_135035_c1 3300050513 Bacteria 1979
550 nmdc:mga0rr50_3783_c2 3300050513 Bacteria 7704
551 nmdc:mga0rr50_75857_c1 3300050513 Bacteria 2579
552 nmdc:mga08x19_1312_c1 3300050514 Bacteria 15434
553 nmdc:mga08x19_472_c1 3300050514 Bacteria 27166
554 nmdc:mga08x19_57811_c1 3300050514 Bacteria 2507
555 nmdc:mga08x19_646792_c1 3300050514 Bacteria 750
556 Ga0495612_0127273 3300053078 Bacteria 1099
557 Ga0495619_0265804 3300053085 Viruses 1189
558 Ga0495619_0568952 3300053085 Unclassified 777
559 Ga0466962_0499487 3300061719 Bacteria 615
560 Ga0157369_12119631
561 LJNas_1000192
562 rootH1_10320061
563 Ga0070683_100038138
564 Ga0070690_100115752
565 Ga0070670_100036414
566 Ga0068869_100065970
567 Ga0070680_100040539
568 Ga0070680_100101741
569 Ga0070682_100338844
570 Ga0068868_100025635
571 Ga0068868_100052668
572 Ga0070660_100545220
573 Ga0070689_100026605
574 Ga0070687_100336780
575 Ga0070673_100082209
576 Ga0070659_101407099
577 Ga0070709_10016930
578 Ga0070709_10236086
579 Ga0070709_11354234
580 Ga0070714_100001617
581 Ga0070714_100051140
582 Ga0070714_100060170
583 Ga0070714_100078796
584 Ga0070714_100101648
585 Ga0070714_100162278
586 Ga0070714_100199226
587 Ga0070714_100386768
588 Ga0070714_100475651
589 Ga0070714_100577382
590 Ga0070714_100715899
591 Ga0070714_100776324
592 Ga0070714_100790300
593 Ga0070714_100906665
594 Ga0070714_102226035
595 Ga0070713_100001070
596 Ga0070713_100018852
597 Ga0070713_100021771
598 Ga0070713_100029289
599 Ga0070713_100057955
600 Ga0070713_100083385
601 Ga0070713_100093276
602 Ga0070713_100403108
603 Ga0070713_100658429
604 Ga0070713_101701725
605 Ga0070713_102447262
606 Ga0070710_10015996
607 Ga0070710_10020454
608 Ga0070710_10095928
609 Ga0070710_10096613
610 Ga0070710_10700038
611 Ga0070711_100001143
612 Ga0070711_100005263
613 Ga0070711_100022497
614 Ga0070711_100210316
615 Ga0070711_100362885
616 Ga0070711_100446878
617 Ga0070711_100489271
618 Ga0070708_100026469
619 Ga0070708_100050270
620 Ga0070708_100077682
621 Ga0070678_100049234
622 Ga0070681_10001119
623 Ga0070681_10617495
624 Ga0068867_100002410
625 Ga0070706_100000556
626 Ga0070706_100227571
627 Ga0070706_100329866
628 Ga0070707_100025045
629 Ga0070707_100166812
630 Ga0070698_100002213
631 Ga0070699_100018442
632 Ga0070679_100014600
633 Ga0070684_100060167
634 Ga0070684_100165834
635 Ga0070684_100206045
636 Ga0070697_100011925
637 Ga0070697_100020532
638 Ga0070697_100082061
639 Ga0068853_100799466
640 Ga0068853_101631369
641 Ga0070693_100004934
642 Ga0070693_100367233
643 Ga0070704_101641677
644 Ga0068855_100000605
645 Ga0068855_100009953
646 Ga0068855_100013792
647 Ga0068855_100383244
648 Ga0068855_100404620
649 Ga0070664_100091777
650 Ga0070664_100114256
651 Ga0068857_100000815
652 Ga0068857_100011517
653 Ga0068854_100010397
654 Ga0068854_100067834
655 Ga0068856_100001172
656 Ga0068856_100001229
657 Ga0068856_100002225
658 Ga0068856_100086819
659 Ga0068856_100195199
660 Ga0068856_101950328
661 Ga0068852_100144100
662 Ga0068852_100240108
663 Ga0068859_100001113
664 Ga0068864_100001145
665 Ga0068864_100027086
666 Ga0068866_10103216
667 Ga0068866_10223706
668 Ga0068851_10386207
669 Ga0068870_10431593
670 Ga0068863_100017251
671 Ga0068858_100016787
672 Ga0068858_100026042
673 Ga0068858_100130037
674 Ga0068860_100199551
675 Ga0068860_100241264
676 Ga0070717_10004741
677 Ga0070717_10009705
678 Ga0070717_10012237
679 Ga0070717_10026221
680 Ga0070717_10043776
681 Ga0070717_10052538
682 Ga0070717_10109926
683 Ga0070717_10126662
684 Ga0070717_10171780
685 Ga0070717_10194096
686 Ga0070717_10405608
687 Ga0070717_10546143
688 Ga0070717_10589684
689 Ga0070717_10610829
690 Ga0070717_10639441
691 Ga0070717_10684006
692 Ga0070717_10923209
693 Ga0070715_10120280
694 Ga0070716_100005164
695 Ga0070716_100008103
696 Ga0070716_100016325
697 Ga0070716_100205166
698 Ga0070716_101252675
699 Ga0070712_100001117
700 Ga0070712_100008348
701 Ga0070712_100039595
702 Ga0070712_100046898
703 Ga0070712_100145343
704 Ga0070712_101379948
705 Ga0097621_100000727
706 Ga0097621_100008272
707 Ga0097621_100026474
708 Ga0097621_100038291
709 Ga0097621_100166130
710 Ga0068871_100000535
711 Ga0068871_100004412
712 Ga0068871_100029865
713 Ga0068871_100122637
714 Ga0068871_100209912
715 Ga0075434_100062447
716 Ga0068865_101188967
717 Ga0075436_100001249
718 Ga0075436_100005356
719 Ga0075436_100049577
720 Ga0075436_100160328
721 Ga0075436_100201698
722 Ga0097620_100001113
723 Ga0075435_100015823
724 Ga0075435_100163645
725 Ga0099794_10191363
726 Ga0099795_10034053
727 Ga0099795_10429209
728 Ga0105240_10020222
729 Ga0105240_10058494
730 Ga0105240_10099493
731 Ga0105245_10025587
732 Ga0114129_11556497
733 Ga0105241_10057904
734 Ga0105248_10109450
735 Ga0105248_10683856
736 Ga0105237_10570459
737 Ga0105237_10840108
738 Ga0105237_11223322
739 Ga0105237_12082067
740 Ga0105238_10001026
741 Ga0105238_11469049
742 Ga0105239_10023174
743 Ga0105239_10364507
744 Ga0105246_10024984
745 Ga0157373_10006610
746 Ga0157373_10057040
747 Ga0157373_10284954
748 Ga0157371_10052622
749 Ga0157371_10056664
750 Ga0157371_10287363
751 Ga0157370_10015863
752 Ga0157370_10178316
753 Ga0157369_10000353
754 Ga0157369_10032077
755 Ga0157369_10048026
756 Ga0157369_10078635
757 Ga0157369_10195593
758 Ga0157374_10000232
759 Ga0157374_10000999
760 Ga0157374_10003773
761 Ga0157374_10089763
762 Ga0157378_10000493
763 Ga0157378_10000833
764 Ga0157378_10003997
765 Ga0157378_12410242
766 Ga0157372_10000565
767 Ga0157372_10001006
768 Ga0157372_10002849
769 Ga0157372_10007642
770 Ga0157372_10010811
771 Ga0157372_10011500
772 Ga0157372_10200170
773 Ga0157372_10228711
774 Ga0157372_10516168
775 Ga0157372_12214626
776 Ga0182008_10505832
777 Ga0157377_10674951
778 Ga0157376_10006887
779 Ga0157376_10251905
780 Ga0182005_1088581
781 Ga0206353_11779135
782 Ga0213874_10033002
783 Ga0213875_10142358
784 Ga0224570_100670
785 Ga0224572_1000267
786 Ga0224572_1028077
787 Ga0224572_1065715
788 Ga0228598_1000341
789 Ga0228598_1002314
790 Ga0207692_10007357
791 Ga0207692_10032765
792 Ga0207692_10087333
793 Ga0207692_10172148
794 Ga0207692_10798072
795 Ga0207642_10075500
796 Ga0207642_10200033
797 Ga0207685_10039802
798 Ga0207685_10829040
799 Ga0207699_10004208
800 Ga0207699_10043904
801 Ga0207699_10077352
802 Ga0207684_10005106
803 Ga0207684_10233243
804 Ga0207684_10424647
805 Ga0207654_10132480
806 Ga0207654_10264064
807 Ga0207707_10001501
808 Ga0207707_10003208
809 Ga0207707_10286340
810 Ga0207707_10753907
811 Ga0207695_10016411
812 Ga0207695_10099046
813 Ga0207695_10105293
814 Ga0207695_10194829
815 Ga0207671_10706916
816 Ga0207693_10001917
817 Ga0207693_10009850
818 Ga0207693_10011594
819 Ga0207693_10036609
820 Ga0207693_10047757
821 Ga0207693_10280075
822 Ga0207663_10000765
823 Ga0207663_10004885
824 Ga0207663_10016495
825 Ga0207663_10030666
826 Ga0207663_10738436
827 Ga0207663_11214326
828 Ga0207660_10231890
829 Ga0207660_10994425
830 Ga0207657_10476481
831 Ga0207649_10271165
832 Ga0207652_10048688
833 Ga0207652_10773046
834 Ga0207646_10000341
835 Ga0207646_10087640
836 Ga0207694_10001534
837 Ga0207650_10254938
838 Ga0207687_10069912
839 Ga0207700_10021275
840 Ga0207700_10045101
841 Ga0207700_10049888
842 Ga0207700_10091522
843 Ga0207700_10192561
844 Ga0207700_10193849
845 Ga0207700_10491405
846 Ga0207700_10671220
847 Ga0207700_10846583
848 Ga0207700_11011248
849 Ga0207700_11074535
850 Ga0207700_11957171
851 Ga0207664_10000440
852 Ga0207664_10004229
853 Ga0207664_10028062
854 Ga0207664_10033336
855 Ga0207664_10131100
856 Ga0207664_10282131
857 Ga0207664_10345248
858 Ga0207664_10402578
859 Ga0207664_10473238
860 Ga0207664_10608975
861 Ga0207664_10722368
862 Ga0207664_10872238
863 Ga0207664_10973004
864 Ga0207664_11165635
865 Ga0207644_10021594
866 Ga0207706_10654653
867 Ga0207670_10214521
868 Ga0207665_10000047
869 Ga0207665_10001358
870 Ga0207665_10014215
871 Ga0207665_10953373
872 Ga0207711_10069487
873 Ga0207711_11000391
874 Ga0207689_10125815
875 Ga0207661_10038136
876 Ga0207661_10231207
877 Ga0207661_11241918
878 Ga0207679_10178085
879 Ga0207667_10000319
880 Ga0207667_10017148
881 Ga0207667_10017879
882 Ga0207667_10386429
883 Ga0207667_10702273
884 Ga0207651_10162915
885 Ga0207651_10187932
886 Ga0207640_10030711
887 Ga0207640_10050863
888 Ga0207677_10005229
889 Ga0207677_10025214
890 Ga0207703_10023498
891 Ga0207703_10036755
892 Ga0207703_10266631
893 Ga0207639_10182518
894 Ga0207639_11986491
895 Ga0207702_10000408
896 Ga0207702_10000595
897 Ga0207702_10023470
898 Ga0207702_10092349
899 Ga0207702_10101926
900 Ga0207702_10235025
901 Ga0207702_11823867
902 Ga0207702_11895642
903 Ga0207641_10012922
904 Ga0207676_10017245
905 Ga0207676_10047024
906 Ga0207674_10002377
907 Ga0207674_10009762
908 Ga0207698_10125775
909 Ga0207698_10140357
910 Ga0207698_10344980
911 Ga0265354_1005803
912 Ga0265356_1000062
913 Ga0265356_1009767
914 Ga0265355_1002079
915 Ga0268264_10209149
916 Ga0268264_10405125
917 Ga0265336_10214465
918 Ga0265338_10093651
919 Ga0265338_10392383
920 Ga0265762_1003108
921 Ga0265762_1055937
922 Ga0265765_1001490
923 Ga0265760_10000528
924 Ga0265760_10006542
925 Ga0265760_10017724
926 Ga0265339_10346701
927 Ga0265316_10585210
928 Ga0265342_10555539
929 Ga0307405_10657132
930 Ga0307413_11198731
931 Ga0307410_10020439
932 Ga0307410_10043028
933 Ga0307410_11040538
934 Ga0307407_10180715
935 Ga0307412_11974003
936 Ga0307409_100000640
937 Ga0307409_100062633
938 Ga0307416_100206963
939 Ga0307416_100271124
940 Ga0307414_10235668
941 Ga0307411_10006793
942 Ga0307411_10426354
943 Ga0307415_100041570
944 Ga0316215_1007882
945 Ga0316214_1042770
946 Ga0316212_1022410
947 Ga0373926_0075980
948 Ga0373934_0254390
949 Ga0373940_0063628
950 Ga0373944_0019596
951 Ga0373923_0005052
952 Ga0373923_0129184
953 Ga0373932_0319655
954 Ga0373936_0002371
955 Ga0373936_0008875
956 Ga0373936_0163929
957 Ga0373945_0187712
958 Ga0373954_0050605
959 Ga0373954_0064126
960 Ga0373954_0354435
961 Ga0373956_0016067
962 Ga0373957_0115728
963 Ga0373943_0000241
964 Ga0373943_0035984
965 Ga0373943_0216018
966 Ga0373943_0380017
967 Ga0373943_0442727
968 Ga0373943_0666132
969 Ga0373946_0013358
970 Ga0373946_0025687
971 Ga0373946_0118656
972 Ga0373955_0094885
973 Ga0373955_0162336
974 Ga0373942_0038133
975 Ga0373924_0034453
976 Ga0373931_0070701
977 Ga0373931_0287435
978 Ga0373935_0000998
979 Ga0373935_0107988
980 Ga0373935_0279330
981 Ga0373935_0518195
982 Ga0373927_0000016
983 Ga0373927_0140516
984 Ga0373927_0248250
985 Ga0373927_0927836
986 Ga0373933_0018238
987 Ga0373933_0098497
988 Ga0373933_0311714
989 Ga0373947_0000042
990 Ga0373947_0019941
991 Ga0373947_0028335
992 Ga0373947_0028681
993 Ga0373947_0274481
994 Ga0373947_0428313
995 Ga0373937_0028716
996 Ga0373937_0114696
997 Ga0373937_0116370
998 Ga0373937_0416260
999 Ga0373937_0859362
1000 Ga0373925_0000744
1001 Ga0373925_0004581
1002 Ga0373925_0017365
1003 Ga0373925_0026058
1004 Ga0373925_0034619
1005 Ga0373925_0084971
1006 Ga0373925_0124940
1007 Ga0373925_0234957
1008 Ga0373925_0357073
1009 Ga0373925_0384485
1010 Ga0373925_0731894
1011 Ga0395905_0842861
1012 Ga0436364_0260541
1013 Ga0436365_0602899
1014 Ga0436365_1032459
1015 Ga0436365_1145925
1016 Ga0436360_1185229
1017 Ga0436363_1441320
1018 Ga0436363_1451128
1019 Ga0436362_0016315
1020 Ga0466966_0179233
1021 Ga0466966_0979855
1022 Ga0466957_0333254
1023 Ga0451576_0069897
1024 Ga0451576_0951395
1025 Ga0451576_2440112
1026 Ga0466958_0453739
1027 Ga0466958_0648143
1028 Ga0466967_0000657
1029 Ga0466967_0403303
1030 Ga0466967_0578948
1031 Ga0495592_0529011
1032 Ga0495603_0593182
1033 Ga0495629_0150194
1034 Ga0495629_0524506
1035 Ga0495651_0137632
1036 Ga0495651_0850467
1037 Ga0495653_0433001
1038 Ga0495580_0000318
1039 Ga0495580_0000343
1040 Ga0495580_0000933
1041 Ga0495580_0003980
1042 Ga0495580_0007710
1043 Ga0495580_0038259
1044 Ga0495580_0077528
1045 Ga0495580_0090957
1046 Ga0495580_0095430
1047 Ga0495580_0104613
1048 Ga0495580_0167534
1049 Ga0495582_0002758
1050 Ga0495582_0006228
1051 Ga0495582_0327682
1052 Ga0495664_0005390
1053 Ga0495664_0506498
1054 Ga0495594_0795002
1055 Ga0495608_0328264
1056 Ga0495628_0204947
1057 Ga0495630_0128275
1058 Ga0495630_0658633
1059 Ga0495665_0000457
1060 Ga0495665_0052585
1061 Ga0495665_0311930
1062 Ga0495665_0438355
1063 Ga0495586_0235039
1064 Ga0495609_0263900
1065 Ga0495588_0167158
1066 Ga0495623_0043332
1067 Ga0495623_0167169
1068 Ga0495658_0024983
1069 Ga0495658_0219395
1070 Ga0495613_0141908
1071 Ga0495581_0190460
1072 Ga0495674_0009027
1073 Ga0495674_0063396
1074 Ga0495674_0250656
1075 Ga0495676_0053188
1076 Ga0495676_0187727
1077 Ga0495680_0875035
1078 Ga0495602_0137918
1079 Ga0495602_0170468
1080 Ga0495602_0219757
1081 Ga0495602_0376912
1082 Ga0496100_0628790
1083 Ga0496100_0887269
1084 Ga0496101_1156758
1085 Ga0496102_0017453
1086 Ga0496102_0027808
1087 Ga0496103_0178369
1088 Ga0496104_0158183
1089 Ga0496104_0252623
1090 Ga0496105_0151611
1091 Ga0496109_1190827
1092 Ga0496112_0010137
1093 Ga0496112_0060399
1094 Ga0496112_0134860
1095 Ga0496113_0115839
1096 Ga0496113_0321215
1097 Ga0496114_0355383
1098 Ga0496115_0311759
1099 Ga0501298_007829
1100 Ga0501300_042442
1101 Ga0501201_024495
1102 Ga0501259_033539
1103 Ga0501234_020367
1104 Ga0501270_026083
1105 nmdc:mga09592_972303_c1
1106 nmdc:mga0n895_21241_c1
1107 nmdc:mga0rr50_12355_c1
1108 nmdc:mga0rr50_135035_c1
1109 nmdc:mga0rr50_3783_c2
1110 nmdc:mga0rr50_75857_c1
1111 nmdc:mga08x19_1312_c1
1112 nmdc:mga08x19_472_c1
1113 nmdc:mga08x19_57811_c1
1114 nmdc:mga08x19_646792_c1
1115 Ga0495612_0127273
1116 Ga0495619_0265804
1117 Ga0495619_0568952
1118 Ga0466962_0499487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14464

Prok-JAB

Prokaryotic homologs of the JAB domain

29

151

0.87

PF01398

JAB

JAB1/Mov34/MPN/PAD-1 ubiquitin protease

14

128

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8782 1 146
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8346 2 144
2kks-assembly1.cif.gz_A solution structure of protein dsy2949 from desulfitobacterium hafniense. northeast structural genomics consortium target dhr27 0.8282 1 146
5ld9-assembly1.cif.gz_A structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8164 2 144
5ld9-assembly1.cif.gz_B structure of deubiquitinating enzyme homolog, pyrococcus furiosus jamm1. 0.8134 1 144
ID Description Score Start End Superfamily
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8782 1 146 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8441 1 147 3.40.140.10
af_P9WHS1_10_146_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8385 1 147 3.40.140.10
2kksA00 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8282 1 146 3.40.140.10
af_Q55FM0_2_113_3.40.140.10 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;Cytidine Deaminase, domain 2 0.8184 2 95 3.40.140.10
ID Description Score Start End GO Terms
AF-A0A1Q7CBK1-F1-model_v4 MPN domain-containing protein 0.9902 1 144 GO:0006508
GO:0008235
GO:0008270
AF-A0A5M8SHL5-F1-model_v4 M67 family metallopeptidase 0.9876 1 146 GO:0006508
GO:0008235
GO:0008270
AF-A0A5M8SDD4-F1-model_v4 M67 family metallopeptidase 0.9857 5 144 GO:0006508
GO:0008235
GO:0008270
AF-A0A1Q7CBK1-F1-model_v4 MPN domain-containing protein 0.9833 1 144 GO:0006508
GO:0008235
GO:0008270
AF-A0A2V9V1L5-F1-model_v4 MPN domain-containing protein 0.9754 1 111 GO:0006508
GO:0008235
GO:0008270

Map