F463553

General Info

Members Datasets Scaffolds Average Seq Length
559 250 531 433

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10075800|Ga0157371_100758003
Length 469
Sequence LNIKKKFVSNNIVLSQQLIALMTDSQEVSFNNKYIIGISFISALGGYLFGFDFAVISGALPFLRSEFLLTPWWEGFLTGSLALGCIVXXXXAGKLSDRYGRKPGLLLSALIFAVSSFGMAFSGSLTMFIMMRFAAGIGVGMASMLSPMYIAEVSPAKVRGRNVAINQLTIVLGILITNLVNYGLADKGADAWRWMFGLGMVPSVLFLVGVLWLPESPRWLIKAGKPEEAKKILDKIGSAVFVENTISDINASLLGTTKLSYKAVFAKSVRPAVMVGIVLAAFQQLCGINVVFNYTSTIFESVGADLDRQLFETVSIGFVNLIFTLVAMWQVDKLGRRPLMLAGSLGLSIVYIILAILLQNQASPAFVSVFVLLAIAMYATSLAPVTWVLISEIFPNKIRGLASSVAVLSLWVSYFILVFTFPVLASKLGTYGPFYLYAGICILGFLFTKAKVRETKGKTLEEVEMVMAH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541278 Niastella sp. CF465 Isolate Unclassified
5 2738541283 Pedobacter sp. OK701 Isolate Unclassified
6 2738541284 Pedobacter sp. YR016 Isolate Unclassified
7 2739367656 Pedobacter sp. CF523 Isolate Unclassified
8 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
9 2818991437 Pedobacter terrae 518 Isolate Unclassified
10 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
11 2818991444 Filimonas endophytica 3197 Isolate Unclassified
12 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
18 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
19 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
20 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
21 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
22 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
23 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
24 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
25 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
26 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
27 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
28 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
29 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
30 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
35 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
36 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
37 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
38 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
46 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
56 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
57 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
103 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
156 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
157 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
158 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
178 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
179 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
180 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
202 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
211 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
228 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
231 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
239 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
242 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
243 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
244 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
245 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.63
Metatranscriptomes 0
Isolates 5.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 0
Rhizoplane 0.18
Rhizosphere 80.68
Stem 0
Stem Tuber 0
Unclassified 11.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_466296 2162886007 Bacteria 30659
2 JGI24737J22298_10002220 3300001990 Bacteria 6925
3 JGI24735J21928_10000044 3300002067 Bacteria 57824
4 JGI25162J39368_1000094 3300002737 Bacteria 98697
5 JGI25162J39368_1002229 3300002737 Bacteria 7941
6 JGI25165J46597_1001508 3300003214 Bacteria 11817
7 rootH1_10000027 3300003316 Bacteria 6016
8 rootH1_10000027 3300003323 Bacteria 5996
9 rootH1_10005913 3300003316 Bacteria 3162
10 rootH1_10028094 3300003316 Bacteria 13539
11 rootH1_10076092 3300003316 Bacteria 8003
12 rootH2_10001521 3300003320 Bacteria 67147
13 rootH2_10035311 3300003320 Bacteria 15199
14 rootH2_10096738 3300003320 Bacteria 3665
15 rootH2_10200132 3300003320 Bacteria 3510
16 rootH2_10257480 3300003320 Bacteria 2843
17 rootL2_10006460 3300003322 Bacteria 5443
18 rootL2_10108754 3300003322 Bacteria 2072
19 rootL2_10173107 3300003322 Bacteria 2481
20 rootL2_10193289 3300003322 Bacteria 5076
21 rootH1_10004461 3300003323 Bacteria 20456
22 rootH1_10005179 3300003316 Bacteria 7339
23 rootH1_10005179 3300003323 Bacteria 16526
24 rootH1_10100901 3300003323 Bacteria 3935
25 rootH1_10112412 3300003323 Bacteria 8915
26 rootH1_10157279 3300003323 Bacteria 3104
27 rootH1_10161604 3300003323 Bacteria 5670
28 JGI25160J50197_1000749 3300003354 Bacteria 17612
29 Ga0055535_1001493 3300003761 Bacteria 11659
30 Ga0055536_1000008 3300003781 Bacteria 335729
31 Ga0055530_10001780 3300003791 Bacteria 14983
32 Ga0055531_10000255 3300003794 Bacteria 56959
33 Ga0065714_10001936 3300005288 Bacteria 75145
34 Ga0065714_10002328 3300005288 Bacteria 46814
35 Ga0065714_10002329 3300005288 Bacteria 24237
36 Ga0065714_10003211 3300005288 Bacteria 8036
37 Ga0065714_10064438 3300005288 Bacteria 113441
38 Ga0065714_10079517 3300005288 Bacteria 2508
39 Ga0065704_10000199 3300005289 Bacteria 297176
40 Ga0065704_10088743 3300005289 Bacteria 2914
41 Ga0065712_10005812 3300005290 Unclassified 3164
42 Ga0065707_10024861 3300005295 Unclassified 2714
43 Ga0070658_10000434 3300005327 Bacteria 36390
44 Ga0070676_10000053 3300005328 Bacteria 37051
45 Ga0070670_100031914 3300005331 Bacteria 4535
46 Ga0070670_100120067 3300005331 Unclassified 2267
47 Ga0070680_100020002 3300005336 Bacteria 5307
48 Ga0070680_100036987 3300005336 Unclassified 3945
49 Ga0070682_100000811 3300005337 Bacteria 18338
50 Ga0068868_100005533 3300005338 Bacteria 8884
51 Ga0068868_100006338 3300005338 Bacteria 8364
52 Ga0070660_100001051 3300005339 Bacteria 18590
53 Ga0070660_100021579 3300005339 Unclassified 4751
54 Ga0070660_100033914 3300005339 Bacteria 3852
55 Ga0070660_100180575 3300005339 Bacteria 1708
56 Ga0070689_100098618 3300005340 Bacteria 2311
57 Ga0070691_10018412 3300005341 Unclassified 3220
58 Ga0070687_100044734 3300005343 Unclassified 2257
59 Ga0070673_100001414 3300005364 Bacteria 14048
60 Ga0070659_100002930 3300005366 Bacteria 12162
61 Ga0070659_100005603 3300005366 Bacteria 9028
62 Ga0070659_100017855 3300005366 Bacteria 5345
63 Ga0070659_100052142 3300005366 Bacteria 3217
64 Ga0070659_100119298 3300005366 Unclassified 2135
65 Ga0070659_100211126 3300005366 Bacteria 1600
66 Ga0070663_100011342 3300005455 Bacteria 5591
67 Ga0070698_100021191 3300005471 Bacteria 6811
68 Ga0070679_100015145 3300005530 Bacteria 7410
69 Ga0070679_100049058 3300005530 Unclassified 4205
70 Ga0068853_100000568 3300005539 Bacteria 25297
71 Ga0068853_100030399 3300005539 Unclassified 4562
72 Ga0068853_100035355 3300005539 Bacteria 4243
73 Ga0068853_100065925 3300005539 Bacteria 3143
74 Ga0068853_100105444 3300005539 Bacteria 2497
75 Ga0070672_100093686 3300005543 Unclassified 2427
76 Ga0070665_100000017 3300005548 Bacteria 448013
77 Ga0070665_100000041 3300005548 Bacteria 297849
78 Ga0068855_100000229 3300005563 Bacteria 71835
79 Ga0068855_100000730 3300005563 Bacteria 40377
80 Ga0068855_100001155 3300005563 Bacteria 32713
81 Ga0068855_100004742 3300005563 Bacteria 16601
82 Ga0068855_100025359 3300005563 Bacteria 7095
83 Ga0068855_100027449 3300005563 Bacteria 6810
84 Ga0068855_100041961 3300005563 Bacteria 5421
85 Ga0068855_100082527 3300005563 Bacteria 3725
86 Ga0068855_100114663 3300005563 Bacteria 3089
87 Ga0068855_100161791 3300005563 Bacteria 2540
88 Ga0068855_100224911 3300005563 Bacteria 2103
89 Ga0068855_100292695 3300005563 Bacteria 1805
90 Ga0068855_100317541 3300005563 Bacteria 1723
91 Ga0070664_100022082 3300005564 Bacteria 5248
92 Ga0070664_100036987 3300005564 Bacteria 4103
93 Ga0068857_100007826 3300005577 Bacteria 9215
94 Ga0068857_100041959 3300005577 Unclassified 4057
95 Ga0068854_100133307 3300005578 Bacteria 1899
96 Ga0068856_100000924 3300005614 Bacteria 31455
97 Ga0068856_100015341 3300005614 Bacteria 7404
98 Ga0068856_100061198 3300005614 Bacteria 3719
99 Ga0068856_100133462 3300005614 Bacteria 2488
100 Ga0068856_100217644 3300005614 Bacteria 1925
101 Ga0068856_100238683 3300005614 Bacteria 1833
102 Ga0068852_100000306 3300005616 Bacteria 33010
103 Ga0068852_100005366 3300005616 Bacteria 9163
104 Ga0068852_100009267 3300005616 Bacteria 7296
105 Ga0068852_100010690 3300005616 Bacteria 6872
106 Ga0068852_100116130 3300005616 Bacteria 2441
107 Ga0068852_100250932 3300005616 Bacteria 1695
108 Ga0068859_100014625 3300005617 Bacteria 7883
109 Ga0068859_100057873 3300005617 Bacteria 3904
110 Ga0068864_100000976 3300005618 Bacteria 23994
111 Ga0068870_10009858 3300005840 Bacteria 4362
112 Ga0068863_100215079 3300005841 Unclassified 1851
113 Ga0068863_100281138 3300005841 Unclassified 1612
114 Ga0068860_100000491 3300005843 Bacteria 48922
115 Ga0075366_10136009 3300006195 Bacteria 1484
116 Ga0097621_100000369 3300006237 Bacteria 31242
117 Ga0097621_100133834 3300006237 Bacteria 2112
118 Ga0068871_100000513 3300006358 Bacteria 26609
119 Ga0068865_100000133 3300006881 Bacteria 38624
120 Ga0068865_100000310 3300006881 Bacteria 26942
121 Ga0097620_100014625 3300006931 Bacteria 7883
122 Ga0097620_100057874 3300006931 Bacteria 3904
123 Ga0105240_10000126 3300009093 Bacteria 157403
124 Ga0105240_10000147 3300009093 Bacteria 142340
125 Ga0105240_10000168 3300009093 Bacteria 133212
126 Ga0105240_10001469 3300009093 Bacteria 40290
127 Ga0105240_10001927 3300009093 Bacteria 34500
128 Ga0105240_10004968 3300009093 Bacteria 19989
129 Ga0105240_10005895 3300009093 Bacteria 18149
130 Ga0105240_10021127 3300009093 Bacteria 8664
131 Ga0105240_10025982 3300009093 Bacteria 7691
132 Ga0105240_10039408 3300009093 Bacteria 6050
133 Ga0105240_10081685 3300009093 Unclassified 3971
134 Ga0111539_10178610 3300009094 Bacteria 2480
135 Ga0114129_10007293 3300009147 Bacteria 15742
136 Ga0105241_10000270 3300009174 Bacteria 38746
137 Ga0105241_10001046 3300009174 Bacteria 21092
138 Ga0105241_10001279 3300009174 Bacteria 19207
139 Ga0105241_10020689 3300009174 Bacteria 4862
140 Ga0105241_10046684 3300009174 Bacteria 3290
141 Ga0105241_10075341 3300009174 Bacteria 2629
142 Ga0105241_10076742 3300009174 Bacteria 2607
143 Ga0105242_10172967 3300009176 Bacteria 1899
144 Ga0105237_10000206 3300009545 Bacteria 84005
145 Ga0105237_10000263 3300009545 Bacteria 74133
146 Ga0105237_10000504 3300009545 Bacteria 55287
147 Ga0105237_10000962 3300009545 Bacteria 38751
148 Ga0105237_10000993 3300009545 Bacteria 38153
149 Ga0105237_10002695 3300009545 Bacteria 21736
150 Ga0105237_10003064 3300009545 Bacteria 20158
151 Ga0105237_10003527 3300009545 Bacteria 18543
152 Ga0105237_10004889 3300009545 Bacteria 15348
153 Ga0105237_10005709 3300009545 Bacteria 13993
154 Ga0105237_10007620 3300009545 Bacteria 11833
155 Ga0105237_10012639 3300009545 Bacteria 8888
156 Ga0105237_10031241 3300009545 Bacteria 5401
157 Ga0105237_10033780 3300009545 Bacteria 5182
158 Ga0105237_10044219 3300009545 Bacteria 4484
159 Ga0105238_10001257 3300009551 Bacteria 25488
160 Ga0105238_10039594 3300009551 Bacteria 4779
161 Ga0105238_10050024 3300009551 Bacteria 4208
162 Ga0105238_10062583 3300009551 Bacteria 3721
163 Ga0105238_10066158 3300009551 Bacteria 3616
164 Ga0105239_10000016 3300010375 Bacteria 293142
165 Ga0105239_10000021 3300010375 Bacteria 259369
166 Ga0105239_10000101 3300010375 Bacteria 119610
167 Ga0105239_10000718 3300010375 Bacteria 47004
168 Ga0105239_10000896 3300010375 Bacteria 42315
169 Ga0105239_10001035 3300010375 Bacteria 38751
170 Ga0105239_10004693 3300010375 Bacteria 16230
171 Ga0105239_10009228 3300010375 Bacteria 11158
172 Ga0105239_10016300 3300010375 Bacteria 8216
173 Ga0105239_10028055 3300010375 Bacteria 6195
174 Ga0105239_10032473 3300010375 Bacteria 5736
175 Ga0105239_10046003 3300010375 Bacteria 4782
176 Ga0105239_10087590 3300010375 Bacteria 3432
177 Ga0157373_10000015 3300013100 Bacteria 183381
178 Ga0157373_10000018 3300013100 Bacteria 169293
179 Ga0157373_10023122 3300013100 Bacteria 4507
180 Ga0157373_10029427 3300013100 Unclassified 3956
181 Ga0157371_10000542 3300013102 Bacteria 44953
182 Ga0157371_10003393 3300013102 Bacteria 14471
183 Ga0157371_10005101 3300013102 Bacteria 11201
184 Ga0157371_10006506 3300013102 Bacteria 9622
185 Ga0157371_10006762 3300013102 Bacteria 9375
186 Ga0157371_10007304 3300013102 Bacteria 8973
187 Ga0157371_10011939 3300013102 Bacteria 6661
188 Ga0157371_10015963 3300013102 Bacteria 5617
189 Ga0157371_10075800 3300013102 Unclassified 2382
190 Ga0157371_10105727 3300013102 Bacteria 1997
191 Ga0157371_10112929 3300013102 Bacteria 1929
192 Ga0157370_10000446 3300013104 Bacteria 51488
193 Ga0157370_10000474 3300013104 Bacteria 50140
194 Ga0157370_10003898 3300013104 Bacteria 17381
195 Ga0157370_10011410 3300013104 Bacteria 9296
196 Ga0157370_10032312 3300013104 Bacteria 5111
197 Ga0157370_10037479 3300013104 Bacteria 4700
198 Ga0157370_10081785 3300013104 Bacteria 3039
199 Ga0157370_10152118 3300013104 Unclassified 2153
200 Ga0157370_10200872 3300013104 Bacteria 1849
201 Ga0157370_10215892 3300013104 Bacteria 1777
202 Ga0157369_10000439 3300013105 Bacteria 55404
203 Ga0157369_10009068 3300013105 Bacteria 11387
204 Ga0157369_10014339 3300013105 Bacteria 8949
205 Ga0157369_10080377 3300013105 Bacteria 3491
206 Ga0157369_10098984 3300013105 Bacteria 3109
207 Ga0157369_10268440 3300013105 Bacteria 1778
208 Ga0157369_10296272 3300013105 Bacteria 1683
209 Ga0157374_10000599 3300013296 Bacteria 31938
210 Ga0157374_10014904 3300013296 Bacteria 6813
211 Ga0157378_10011362 3300013297 Bacteria 7794
212 Ga0157378_10029309 3300013297 Bacteria 4859
213 Ga0163162_10000026 3300013306 Bacteria 178701
214 Ga0163162_10000778 3300013306 Bacteria 29690
215 Ga0163162_10001178 3300013306 Bacteria 24409
216 Ga0163162_10002670 3300013306 Bacteria 16914
217 Ga0163162_10053450 3300013306 Bacteria 4060
218 Ga0157372_10000015 3300013307 Bacteria 225365
219 Ga0157372_10000346 3300013307 Bacteria 51170
220 Ga0157372_10000680 3300013307 Bacteria 37376
221 Ga0157372_10000735 3300013307 Bacteria 35709
222 Ga0157372_10002159 3300013307 Bacteria 21396
223 Ga0157372_10003320 3300013307 Bacteria 17386
224 Ga0157372_10008802 3300013307 Bacteria 10719
225 Ga0157372_10013232 3300013307 Bacteria 8806
226 Ga0157372_10022589 3300013307 Bacteria 6808
227 Ga0157372_10051670 3300013307 Bacteria 4574
228 Ga0157372_10062482 3300013307 Bacteria 4173
229 Ga0157372_10092533 3300013307 Bacteria 3440
230 Ga0157372_10119225 3300013307 Bacteria 3029
231 Ga0157372_10265952 3300013307 Bacteria 1991
232 Ga0157372_10296187 3300013307 Bacteria 1881
233 Ga0157375_10347838 3300013308 Bacteria 1648
234 Ga0157380_10011724 3300014326 Bacteria 6338
235 Ga0182008_10000001 3300014497 Bacteria 540790
236 Ga0157376_10123309 3300014969 Bacteria 2300
237 Ga0182006_1002670 3300015261 Bacteria 9599
238 Ga0182006_1027607 3300015261 Bacteria 2315
239 Ga0182005_1000202 3300015265 Bacteria 40206
240 Ga0163161_10000365 3300017792 Bacteria 37837
241 Ga0163161_10103835 3300017792 Bacteria 2118
242 Ga0207427_100219 3300025231 Bacteria 49678
243 Ga0209437_100077 3300025233 Bacteria 286656
244 Ga0209437_100363 3300025233 Bacteria 49686
245 Ga0209258_100282 3300025242 Bacteria 85032
246 Ga0209026_1000357 3300025250 Bacteria 43020
247 Ga0209026_1002923 3300025250 Bacteria 5987
248 Ga0209026_1008946 3300025250 Bacteria 2026
249 Ga0209148_1000247 3300025254 Bacteria 86505
250 Ga0209233_1000017 3300025261 Bacteria 898076
251 Ga0209455_1009419 3300025272 Bacteria 2568
252 Ga0209676_1000042 3300025292 Bacteria 424130
253 Ga0209050_1000035 3300025298 Bacteria 424005
254 Ga0207426_1000170 3300025302 Bacteria 164216
255 Ga0209257_1000071 3300025304 Bacteria 335832
256 Ga0207656_10049877 3300025321 Bacteria 1806
257 Ga0207642_10082507 3300025899 Unclassified 1565
258 Ga0207647_10000574 3300025904 Bacteria 28662
259 Ga0207647_10002245 3300025904 Bacteria 14722
260 Ga0207645_10000440 3300025907 Bacteria 34498
261 Ga0207643_10021862 3300025908 Bacteria 3519
262 Ga0207643_10027656 3300025908 Bacteria 3145
263 Ga0207705_10000482 3300025909 Bacteria 34233
264 Ga0207705_10076584 3300025909 Unclassified 2432
265 Ga0207654_10000184 3300025911 Bacteria 38751
266 Ga0207654_10043669 3300025911 Unclassified 2542
267 Ga0207707_10003153 3300025912 Bacteria 14634
268 Ga0207695_10000013 3300025913 Bacteria 821265
269 Ga0207695_10000023 3300025913 Bacteria 657903
270 Ga0207695_10000031 3300025913 Bacteria 526801
271 Ga0207695_10001274 3300025913 Bacteria 42874
272 Ga0207695_10001380 3300025913 Bacteria 41073
273 Ga0207695_10027307 3300025913 Bacteria 6358
274 Ga0207695_10057140 3300025913 Bacteria 4056
275 Ga0207695_10093616 3300025913 Bacteria 3014
276 Ga0207695_10100449 3300025913 Bacteria 2889
277 Ga0207671_10000297 3300025914 Bacteria 73234
278 Ga0207671_10000316 3300025914 Bacteria 71241
279 Ga0207671_10000957 3300025914 Bacteria 35834
280 Ga0207671_10002372 3300025914 Bacteria 20248
281 Ga0207671_10002996 3300025914 Bacteria 17314
282 Ga0207671_10004115 3300025914 Bacteria 14064
283 Ga0207671_10004574 3300025914 Bacteria 13145
284 Ga0207671_10008091 3300025914 Bacteria 8978
285 Ga0207671_10014013 3300025914 Bacteria 6360
286 Ga0207671_10016757 3300025914 Bacteria 5683
287 Ga0207671_10018858 3300025914 Bacteria 5287
288 Ga0207671_10021557 3300025914 Bacteria 4885
289 Ga0207671_10059448 3300025914 Bacteria 2834
290 Ga0207671_10099726 3300025914 Unclassified 2198
291 Ga0207660_10006527 3300025917 Bacteria 7567
292 Ga0207660_10038208 3300025917 Unclassified 3350
293 Ga0207662_10046259 3300025918 Bacteria 2574
294 Ga0207657_10004064 3300025919 Bacteria 15524
295 Ga0207657_10023840 3300025919 Bacteria 5687
296 Ga0207657_10034672 3300025919 Unclassified 4535
297 Ga0207652_10004993 3300025921 Bacteria 10746
298 Ga0207652_10005780 3300025921 Bacteria 10036
299 Ga0207652_10009935 3300025921 Bacteria 7660
300 Ga0207694_10002091 3300025924 Bacteria 16492
301 Ga0207694_10032463 3300025924 Bacteria 3996
302 Ga0207694_10087572 3300025924 Bacteria 2453
303 Ga0207690_10000759 3300025932 Bacteria 20828
304 Ga0207690_10024572 3300025932 Bacteria 3775
305 Ga0207690_10044117 3300025932 Bacteria 2938
306 Ga0207690_10178620 3300025932 Unclassified 1596
307 Ga0207670_10151819 3300025936 Bacteria 1720
308 Ga0207669_10088833 3300025937 Bacteria 2005
309 Ga0207704_10000010 3300025938 Bacteria 188125
310 Ga0207704_10000120 3300025938 Bacteria 42425
311 Ga0207691_10064987 3300025940 Unclassified 3304
312 Ga0207689_10045659 3300025942 Unclassified 3622
313 Ga0207679_10042790 3300025945 Bacteria 3257
314 Ga0207679_10102257 3300025945 Unclassified 2243
315 Ga0207667_10000197 3300025949 Bacteria 87987
316 Ga0207667_10001217 3300025949 Bacteria 32222
317 Ga0207667_10010389 3300025949 Bacteria 10882
318 Ga0207667_10021359 3300025949 Bacteria 7173
319 Ga0207667_10039748 3300025949 Bacteria 5011
320 Ga0207667_10091830 3300025949 Bacteria 3136
321 Ga0207667_10107289 3300025949 Bacteria 2881
322 Ga0207667_10216366 3300025949 Bacteria 1963
323 Ga0207667_10274631 3300025949 Bacteria 1723
324 Ga0207651_10003447 3300025960 Bacteria 7772
325 Ga0207712_10102919 3300025961 Bacteria 2127
326 Ga0207677_10015405 3300026023 Bacteria 4497
327 Ga0207677_10049302 3300026023 Bacteria 2840
328 Ga0207703_10043478 3300026035 Bacteria 3606
329 Ga0207639_10014162 3300026041 Bacteria 5600
330 Ga0207678_10160399 3300026067 Bacteria 1921
331 Ga0207702_10034225 3300026078 Bacteria 4247
332 Ga0207702_10059707 3300026078 Bacteria 3249
333 Ga0207702_10091360 3300026078 Bacteria 2665
334 Ga0207702_10166085 3300026078 Bacteria 2019
335 Ga0207702_10179635 3300026078 Bacteria 1948
336 Ga0207648_10002447 3300026089 Bacteria 19963
337 Ga0207648_10035278 3300026089 Bacteria 4407
338 Ga0207676_10016416 3300026095 Bacteria 5362
339 Ga0207674_10008302 3300026116 Bacteria 12020
340 Ga0207674_10014223 3300026116 Bacteria 8793
341 Ga0207674_10208217 3300026116 Unclassified 1905
342 Ga0207675_100243099 3300026118 Unclassified 1740
343 Ga0207698_10003067 3300026142 Bacteria 10013
344 Ga0207698_10026144 3300026142 Bacteria 4126
345 Ga0207698_10086354 3300026142 Bacteria 2551
346 Ga0207698_10107001 3300026142 Bacteria 2334
347 Ga0268266_10000014 3300028379 Bacteria 644033
348 Ga0268266_10000037 3300028379 Bacteria 342368
349 Ga0268264_10000674 3300028381 Bacteria 39908
350 Ga0307517_10002284 3300028786 Bacteria 30925
351 Ga0307515_10000001 3300028794 Bacteria 4259510
352 Ga0307515_10000280 3300028794 Bacteria 125330
353 Ga0307515_10003886 3300028794 Bacteria 31200
354 Ga0307515_10063752 3300028794 Bacteria 5167
355 Ga0307511_10000264 3300030521 Bacteria 54303
356 Ga0316176_1048616 3300030732 Bacteria 40116
357 Ga0316183_1018086 3300030742 Bacteria 5775
358 Ga0316181_1069399 3300030744 Bacteria 5011
359 Ga0265327_10000411 3300031251 Bacteria 78751
360 Ga0307513_10071485 3300031456 Bacteria 3621
361 Ga0307513_10110373 3300031456 Bacteria 2746
362 Ga0307509_10018041 3300031507 Bacteria 8103
363 Ga0307509_10045122 3300031507 Bacteria 4757
364 Ga0307408_100001128 3300031548 Bacteria 20333
365 Ga0307408_100001139 3300031548 Bacteria 20205
366 Ga0307408_100002494 3300031548 Bacteria 12880
367 Ga0307508_10000644 3300031616 Bacteria 42035
368 Ga0316576_10061672 3300031727 Bacteria 2749
369 Ga0307516_10000656 3300031730 Bacteria 46771
370 Ga0307516_10144430 3300031730 Bacteria 2146
371 Ga0307405_10000046 3300031731 Bacteria 71442
372 Ga0307405_10015870 3300031731 Bacteria 4092
373 Ga0307412_10000017 3300031911 Bacteria 294698
374 Ga0307412_10002541 3300031911 Bacteria 10141
375 Ga0307414_10001044 3300032004 Bacteria 14161
376 Ga0307414_10005303 3300032004 Bacteria 7086
377 Ga0307414_10155409 3300032004 Bacteria 1810
378 Ga0307507_10001142 3300033179 Bacteria 58894
379 Ga0307510_10009647 3300033180 Bacteria 11505
380 Ga0307510_10033263 3300033180 Bacteria 5794
381 Ga0316584_0124463 3300036712 Bacteria 1926
382 Ga0395899_0000001 3300037312 Bacteria 1750322
383 Ga0395899_0000181 3300037312 Bacteria 92672
384 Ga0395899_0000717 3300037312 Bacteria 33215
385 Ga0395899_0000806 3300037312 Bacteria 30625
386 Ga0395899_0004001 3300037312 Bacteria 11614
387 Ga0395899_0005474 3300037312 Bacteria 9847
388 Ga0395899_0100112 3300037312 Bacteria 2093
389 Ga0395900_0000014 3300037418 Bacteria 386513
390 Ga0395900_0002459 3300037418 Bacteria 20402
391 Ga0395900_0005331 3300037418 Bacteria 13474
392 Ga0395900_0009414 3300037418 Bacteria 10015
393 Ga0395900_0012319 3300037418 Bacteria 8748
394 Ga0395900_0099969 3300037418 Bacteria 2979
395 Ga0395900_0125910 3300037418 Bacteria 2628
396 Ga0395900_0211550 3300037418 Bacteria 1958
397 Ga0395900_0281162 3300037418 Unclassified 1656
398 Ga0395898_0002747 3300037466 Bacteria 20291
399 Ga0395898_0009073 3300037466 Bacteria 10472
400 Ga0395898_0015129 3300037466 Bacteria 7918
401 Ga0395898_0105748 3300037466 Bacteria 2699
402 Ga0395898_0238949 3300037466 Bacteria 1733
403 Ga0395905_0000037 3300037471 Bacteria 261808
404 Ga0395905_0000819 3300037471 Bacteria 40842
405 Ga0395905_0001794 3300037471 Bacteria 24895
406 Ga0395901_0000219 3300038443 Bacteria 71884
407 Ga0395901_0002632 3300038443 Bacteria 18151
408 Ga0395901_0008449 3300038443 Bacteria 10405
409 Ga0395901_0025905 3300038443 Bacteria 6023
410 Ga0395901_0051155 3300038443 Bacteria 4294
411 Ga0400483_016155 3300039062 Bacteria 13502
412 Ga0400483_231526 3300039062 Bacteria 9538
413 Ga0439445_0011601 3300042004 Bacteria 2105
414 Ga0439457_027749 3300042014 Bacteria 1253
415 Ga0439462_0009518 3300042015 Bacteria 2457
416 Ga0439462_0042735 3300042015 Bacteria 1211
417 Ga0439434_0009670 3300042435 Bacteria 2835
418 Ga0451577_0025309 3300042876 Bacteria 5387
419 Ga0451577_0095655 3300042876 Bacteria 2652
420 Ga0466969_0000052 3300044656 Bacteria 60425
421 Ga0466972_0000008 3300044658 Bacteria 264518
422 Ga0466972_0000020 3300044658 Bacteria 197336
423 Ga0466972_0001211 3300044658 Bacteria 12411
424 Ga0466972_0007337 3300044658 Bacteria 5537
425 Ga0466966_0005448 3300044684 Bacteria 8368
426 Ga0466966_0056036 3300044684 Bacteria 2494
427 Ga0466966_0074066 3300044684 Bacteria 2129
428 Ga0466961_0021074 3300044693 Bacteria 4195
429 Ga0453684_0007582 3300044712 Bacteria 19895
430 Ga0453684_0030621 3300044712 Bacteria 7596
431 Ga0453684_0041284 3300044712 Bacteria 6245
432 Ga0453684_0066924 3300044712 Bacteria 4572
433 Ga0453684_0143333 3300044712 Bacteria 2849
434 Ga0453684_0249062 3300044712 Bacteria 2041
435 Ga0466971_0004044 3300044719 Bacteria 6309
436 Ga0466957_0000239 3300044842 Bacteria 26161
437 Ga0466957_0015641 3300044842 Bacteria 4433
438 Ga0466957_0030262 3300044842 Bacteria 3232
439 Ga0466959_0000084 3300045049 Bacteria 59368
440 Ga0466959_0002016 3300045049 Bacteria 12821
441 Ga0451576_0037096 3300045051 Bacteria 5164
442 Ga0466958_0051875 3300045836 Bacteria 2485
443 Ga0495627_022022 3300046453 Unclassified 2101
444 Ga0495638_0046190 3300046460 Unclassified 2737
445 Ga0495650_0000231 3300046471 Bacteria 113969
446 Ga0495650_0029554 3300046471 Bacteria 2497
447 Ga0495585_0000037 3300046492 Bacteria 133335
448 Ga0495585_0015075 3300046492 Bacteria 4493
449 Ga0495596_0029183 3300046500 Bacteria 2213
450 Ga0495606_0000060 3300046507 Bacteria 185907
451 Ga0495606_0005180 3300046507 Bacteria 12610
452 Ga0495606_0005353 3300046507 Bacteria 12323
453 Ga0495606_0099225 3300046507 Bacteria 1776
454 Ga0495610_0000093 3300046512 Bacteria 105873
455 Ga0495616_0008927 3300046513 Bacteria 5891
456 Ga0495631_0038658 3300046518 Unclassified 2120
457 Ga0495637_0022196 3300046520 Bacteria 2899
458 Ga0495648_0004193 3300046524 Bacteria 12383
459 Ga0495648_0019829 3300046524 Bacteria 4710
460 Ga0495652_0219171 3300046529 Unclassified 1431
461 Ga0495598_0011499 3300046537 Bacteria 2149
462 Ga0495609_0014279 3300046538 Bacteria 3738
463 Ga0495622_0035607 3300046557 Bacteria 2321
464 Ga0495633_0000023 3300046558 Bacteria 226510
465 Ga0495633_0000641 3300046558 Bacteria 32663
466 Ga0495668_0000012 3300046616 Bacteria 458817
467 Ga0495668_0020335 3300046616 Bacteria 3819
468 Ga0495611_0000100 3300046648 Bacteria 59688
469 Ga0495625_0000191 3300046660 Bacteria 97363
470 Ga0495625_0001093 3300046660 Bacteria 35233
471 Ga0495625_0001735 3300046660 Bacteria 25214
472 Ga0495625_0090399 3300046660 Bacteria 2118
473 Ga0495625_0098709 3300046660 Bacteria 2008
474 Ga0495661_0002843 3300046665 Bacteria 13106
475 Ga0495661_0010372 3300046665 Bacteria 6359
476 Ga0495649_0000010 3300046694 Bacteria 430552
477 Ga0495649_0000061 3300046694 Bacteria 97338
478 Ga0495683_0030179 3300047323 Bacteria 2767
479 Ga0495687_000144 3300047443 Bacteria 108217
480 Ga0495687_002703 3300047443 Bacteria 13756
481 Ga0495686_0000004 3300047472 Bacteria 869019
482 Ga0495686_0000071 3300047472 Bacteria 216594
483 Ga0495686_0026706 3300047472 Unclassified 3777
484 Ga0495686_0031208 3300047472 Bacteria 3457
485 Ga0495686_0038489 3300047472 Unclassified 3058
486 Ga0495686_0045132 3300047472 Bacteria 2789
487 Ga0496121_0000026 3300048924 Bacteria 450157
488 Ga0496122_0001373 3300048925 Bacteria 39623
489 Ga0496123_0010050 3300048926 Bacteria 8424
490 Ga0496125_0050779 3300048928 Bacteria 3430
491 Ga0496126_0116479 3300048929 Bacteria 2322
492 Ga0495678_004082 3300049459 Bacteria 8658
493 Ga0501033_0033698 3300049570 Bacteria 3845
494 Ga0501033_0061896 3300049570 Bacteria 2757
495 Ga0501033_0162912 3300049570 Bacteria 1605
496 Ga0501034_0047009 3300049571 Unclassified 4359
497 Ga0501034_0102587 3300049571 Bacteria 2854
498 Ga0501034_0115052 3300049571 Unclassified 2678
499 Ga0501039_0211589 3300049575 Bacteria 1525
500 Ga0501047_0061473 3300049581 Bacteria 3624
501 Ga0501219_000091 3300049703 Bacteria 15479
502 Ga0501225_0000313 3300049705 Bacteria 15194
503 Ga0501044_0116710 3300049823 Bacteria 2674
504 Ga0501284_00037 3300050005 Bacteria 55085
505 nmdc:mga0k408_1220_c1 3300050493 Bacteria 14082
506 nmdc:mga05p37_5208_c1 3300050507 Bacteria 15258
507 Ga0500578_0000024 3300053086 Bacteria 151503
508 Ga0500578_0033161 3300053086 Bacteria 3320
509 Ga0500644_0000567 3300053088 Bacteria 14501
510 Ga0500646_0016329 3300053090 Bacteria 1938
511 Ga0500583_0000058 3300053092 Bacteria 68363
512 Ga0500583_0002307 3300053092 Bacteria 5704
513 Ga0500651_0000451 3300053093 Bacteria 21958
514 Ga0500569_001611 3300053109 Bacteria 4283
515 Ga0500607_017620 3300053121 Bacteria 4072
516 Ga0500618_000013 3300053125 Bacteria 183026
517 Ga0500642_0019392 3300053130 Bacteria 2652
518 Ga0500652_052105 3300053131 Bacteria 1673
519 Ga0500658_0002777 3300053134 Bacteria 6727
520 Ga0500559_0016035 3300053136 Bacteria 3165
521 Ga0500559_0017951 3300053136 Bacteria 2991
522 Ga0500577_0000506 3300053142 Bacteria 10029
523 Ga0500616_0059090 3300053153 Bacteria 1992
524 Ga0500622_0000199 3300053156 Bacteria 63518
525 Ga0500622_0000676 3300053156 Bacteria 30139
526 Ga0500622_0001133 3300053156 Bacteria 22246
527 Ga0500622_0001437 3300053156 Bacteria 19111
528 Ga0500622_0019691 3300053156 Bacteria 3582
529 Ga0500633_0009438 3300053160 Unclassified 2566
530 Ga0500611_000063 3300053727 Bacteria 44144
531 Ga0466962_0016666 3300061719 Bacteria 3544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300015261 Ga0182006_1027607 Ga0182006_10276073 323
2 3300053131 Ga0500652_052105 Ga0500652_052105_35_1129 331
3 3300037312 Ga0395899_0100112 Ga0395899_0100112_11_1066 333
4 3300053090 Ga0500646_0016329 Ga0500646_0016329_82_1188 354
5 3300042435 Ga0439434_0009670 Ga0439434_0009670_1722_2813 363
6 3300042014 Ga0439457_027749 Ga0439457_027749_87_1184 365
7 3300042015 Ga0439462_0042735 Ga0439462_0042735_73_1170 365
8 3300049571 Ga0501034_0102587 Ga0501034_0102587_1673_2830 385
9 3300003323 rootH1_10157279 rootH1_101572792 386
10 3300005563 Ga0068855_100161791 Ga0068855_1001617912 386
11 3300003316 rootH1_10005913 rootH1_100059132 388
12 3300031456 Ga0307513_10071485 Ga0307513_100714852 391
13 3300048924 Ga0496121_0000026 Ga0496121_0000026_81609_82964 391
14 3300044684 Ga0466966_0074066 Ga0466966_0074066_366_1703 393
15 3300044842 Ga0466957_0000239 Ga0466957_0000239_14704_16038 393
16 3300049581 Ga0501047_0061473 Ga0501047_0061473_2214_3548 393
17 3300003320 rootH2_10001521 rootH2_100015217 395
18 3300009545 Ga0105237_10005709 Ga0105237_100057092 396
19 3300025914 Ga0207671_10002996 Ga0207671_100029962 396
20 3300053088 Ga0500644_0000567 Ga0500644_0000567_2865_4178 396
21 3300053160 Ga0500633_0009438 Ga0500633_0009438_161_1474 396
22 3300048925 Ga0496122_0001373 Ga0496122_0001373_4658_6007 397
23 3300048926 Ga0496123_0010050 Ga0496123_0010050_3974_5323 397
24 3300048928 Ga0496125_0050779 Ga0496125_0050779_1562_2911 397
25 3300053086 Ga0500578_0033161 Ga0500578_0033161_987_2396 398
26 3300031548 Ga0307408_100001128 Ga0307408_1000011282 399
27 3300031911 Ga0307412_10002541 Ga0307412_100025412 399
28 3300046557 Ga0495622_0035607 Ga0495622_0035607_263_1465 400
29 3300013100 Ga0157373_10029427 Ga0157373_100294273 401
30 3300025250 Ga0209026_1008946 Ga0209026_10089462 401
31 3300044658 Ga0466972_0007337 Ga0466972_0007337_3401_4735 401
32 3300005339 Ga0070660_100033914 Ga0070660_1000339142 402
33 3300005366 Ga0070659_100005603 Ga0070659_1000056034 402
34 3300025932 Ga0207690_10000759 Ga0207690_100007592 402
35 3300044693 Ga0466961_0021074 Ga0466961_0021074_1292_2629 403
36 3300044719 Ga0466971_0004044 Ga0466971_0004044_382_1719 403
37 3300044842 Ga0466957_0030262 Ga0466957_0030262_1144_2481 403
38 3300045049 Ga0466959_0002016 Ga0466959_0002016_2136_3473 403
39 3300045836 Ga0466958_0051875 Ga0466958_0051875_439_1776 403
40 3300061719 Ga0466962_0016666 Ga0466962_0016666_1182_2519 403
41 3300028786 Ga0307517_10002284 Ga0307517_100022844 404
42 3300031507 Ga0307509_10045122 Ga0307509_100451221 404
43 3300031548 Ga0307408_100002494 Ga0307408_1000024944 405
44 3300046518 Ga0495631_0038658 Ga0495631_0038658_494_1852 405
45 3300003322 rootL2_10193289 rootL2_101932894 406
46 3300013105 Ga0157369_10080377 Ga0157369_100803772 406
47 3300030521 Ga0307511_10000264 Ga0307511_100002643 406
48 3300044658 Ga0466972_0000020 Ga0466972_0000020_35502_36839 406
49 3300046665 Ga0495661_0010372 Ga0495661_0010372_4205_5563 406
50 3300053092 Ga0500583_0000058 Ga0500583_0000058_52408_53742 406
51 3300003322 rootL2_10173107 rootL2_101731072 407
52 3300005563 Ga0068855_100317541 Ga0068855_1003175411 407
53 3300009093 Ga0105240_10005895 Ga0105240_1000589510 407
54 3300025949 Ga0207667_10274631 Ga0207667_102746312 407
55 3300005563 Ga0068855_100004742 Ga0068855_1000047425 409
56 3300005616 Ga0068852_100009267 Ga0068852_1000092673 409
57 3300009093 Ga0105240_10025982 Ga0105240_100259823 409
58 3300009174 Ga0105241_10075341 Ga0105241_100753412 409
59 3300013105 Ga0157369_10014339 Ga0157369_100143394 409
60 3300013307 Ga0157372_10000680 Ga0157372_100006807 409
61 3300025250 Ga0209026_1000357 Ga0209026_100035723 409
62 3300025913 Ga0207695_10093616 Ga0207695_100936163 409
63 3300025949 Ga0207667_10001217 Ga0207667_100012179 409
64 3300026116 Ga0207674_10008302 Ga0207674_100083023 409
65 3300031730 Ga0307516_10000656 Ga0307516_1000065612 409
66 3300045051 Ga0451576_0037096 Ga0451576_0037096_1386_2753 409
67 3300053121 Ga0500607_017620 Ga0500607_017620_1028_2341 409
68 3300037418 Ga0395900_0281162 Ga0395900_0281162_219_1580 410
69 3300037466 Ga0395898_0238949 Ga0395898_0238949_115_1461 410
70 3300046460 Ga0495638_0046190 Ga0495638_0046190_279_1610 410
71 3300025914 Ga0207671_10021557 Ga0207671_100215572 411
72 3300031730 Ga0307516_10144430 Ga0307516_101444301 411
73 3300053156 Ga0500622_0019691 Ga0500622_0019691_726_2102 411
74 3300013100 Ga0157373_10000018 Ga0157373_10000018117 412
75 3300013307 Ga0157372_10000346 Ga0157372_1000034636 412
76 3300037312 Ga0395899_0000717 Ga0395899_0000717_9238_10596 412
77 3300037418 Ga0395900_0000014 Ga0395900_0000014_192944_194302 412
78 3300037471 Ga0395905_0000037 Ga0395905_0000037_192934_194292 412
79 3300038443 Ga0395901_0000219 Ga0395901_0000219_1548_2906 412
80 3300044712 Ga0453684_0143333 Ga0453684_0143333_1400_2749 412
81 3300003322 rootL2_10006460 rootL2_100064603 413
82 3300005366 Ga0070659_100017855 Ga0070659_1000178552 413
83 3300005616 Ga0068852_100005366 Ga0068852_1000053665 413
84 3300009545 Ga0105237_10000504 Ga0105237_1000050432 413
85 3300010375 Ga0105239_10000021 Ga0105239_1000002152 413
86 3300010375 Ga0105239_10000896 Ga0105239_1000089625 413
87 3300025904 Ga0207647_10002245 Ga0207647_100022458 413
88 3300025914 Ga0207671_10016757 Ga0207671_100167572 413
89 3300025932 Ga0207690_10024572 Ga0207690_100245722 413
90 3300026142 Ga0207698_10086354 Ga0207698_100863542 413
91 3300042015 Ga0439462_0009518 Ga0439462_0009518_330_1664 413
92 3300013102 Ga0157371_10011939 Ga0157371_100119392 414
93 3300013307 Ga0157372_10013232 Ga0157372_100132329 414
94 3300005614 Ga0068856_100238683 Ga0068856_1002386832 415
95 3300044684 Ga0466966_0005448 Ga0466966_0005448_5069_6433 415
96 3300044842 Ga0466957_0015641 Ga0466957_0015641_1219_2553 415
97 3300005328 Ga0070676_10000053 Ga0070676_1000005323 416
98 3300005338 Ga0068868_100005533 Ga0068868_1000055332 416
99 3300005364 Ga0070673_100001414 Ga0070673_1000014149 416
100 3300005543 Ga0070672_100093686 Ga0070672_1000936863 416
101 3300005616 Ga0068852_100000306 Ga0068852_10000030611 416
102 3300006237 Ga0097621_100000369 Ga0097621_10000036914 416
103 3300006358 Ga0068871_100000513 Ga0068871_10000051314 416
104 3300006881 Ga0068865_100000310 Ga0068865_1000003108 416
105 3300009174 Ga0105241_10001046 Ga0105241_100010469 416
106 3300009545 Ga0105237_10000993 Ga0105237_1000099315 416
107 3300009551 Ga0105238_10039594 Ga0105238_100395943 416
108 3300013104 Ga0157370_10152118 Ga0157370_101521183 416
109 3300013296 Ga0157374_10000599 Ga0157374_100005998 416
110 3300013297 Ga0157378_10029309 Ga0157378_100293093 416
111 3300015265 Ga0182005_1000202 Ga0182005_100020213 416
112 3300025899 Ga0207642_10082507 Ga0207642_100825071 416
113 3300025907 Ga0207645_10000440 Ga0207645_100004407 416
114 3300025938 Ga0207704_10000120 Ga0207704_100001207 416
115 3300025960 Ga0207651_10003447 Ga0207651_100034473 416
116 3300026023 Ga0207677_10049302 Ga0207677_100493023 416
117 3300026089 Ga0207648_10002447 Ga0207648_100024479 416
118 3300053136 Ga0500559_0017951 Ga0500559_0017951_1155_2468 416
119 3300013105 Ga0157369_10268440 Ga0157369_102684402 417
120 3300005578 Ga0068854_100133307 Ga0068854_1001333071 418
121 3300009174 Ga0105241_10046684 Ga0105241_100466842 418
122 3300047472 Ga0495686_0026706 Ga0495686_0026706_1726_3114 418
123 3300005336 Ga0070680_100036987 Ga0070680_1000369872 419
124 3300005339 Ga0070660_100021579 Ga0070660_1000215792 419
125 3300005366 Ga0070659_100002930 Ga0070659_1000029303 419
126 3300005530 Ga0070679_100049058 Ga0070679_1000490583 419
127 3300005563 Ga0068855_100041961 Ga0068855_1000419612 419
128 3300009545 Ga0105237_10000206 Ga0105237_1000020638 419
129 3300009551 Ga0105238_10062583 Ga0105238_100625832 419
130 3300013102 Ga0157371_10105727 Ga0157371_101057272 419
131 3300013307 Ga0157372_10265952 Ga0157372_102659523 419
132 3300025914 Ga0207671_10000316 Ga0207671_1000031622 419
133 3300025917 Ga0207660_10038208 Ga0207660_100382082 419
134 3300025919 Ga0207657_10034672 Ga0207657_100346721 419
135 3300025932 Ga0207690_10178620 Ga0207690_101786201 419
136 3300026116 Ga0207674_10208217 Ga0207674_102082171 419
137 3300003761 Ga0055535_1001493 Ga0055535_10014932 420
138 3300025242 Ga0209258_100282 Ga0209258_10028242 420
139 3300025254 Ga0209148_1000247 Ga0209148_100024712 420
140 3300053086 Ga0500578_0000024 Ga0500578_0000024_139375_140712 420
141 3300005338 Ga0068868_100006338 Ga0068868_1000063383 421
142 3300005616 Ga0068852_100010690 Ga0068852_1000106902 421
143 3300006881 Ga0068865_100000133 Ga0068865_10000013317 421
144 3300009093 Ga0105240_10001469 Ga0105240_100014698 421
145 3300009174 Ga0105241_10000270 Ga0105241_1000027017 421
146 3300009545 Ga0105237_10000962 Ga0105237_1000096217 421
147 3300009551 Ga0105238_10001257 Ga0105238_100012579 421
148 3300010375 Ga0105239_10001035 Ga0105239_1000103517 421
149 3300010375 Ga0105239_10004693 Ga0105239_100046934 421
150 3300025911 Ga0207654_10000184 Ga0207654_100001847 421
151 3300025913 Ga0207695_10001274 Ga0207695_1000127417 421
152 3300025914 Ga0207671_10000297 Ga0207671_100002979 421
153 3300025924 Ga0207694_10002091 Ga0207694_100020912 421
154 3300025938 Ga0207704_10000010 Ga0207704_1000001017 421
155 3300026023 Ga0207677_10015405 Ga0207677_100154052 421
156 3300026142 Ga0207698_10026144 Ga0207698_100261444 421
157 3300044712 Ga0453684_0030621 Ga0453684_0030621_1636_2955 421
158 3300053109 Ga0500569_001611 Ga0500569_001611_793_2106 421
159 3300053134 Ga0500658_0002777 Ga0500658_0002777_559_1872 421
160 3300053142 Ga0500577_0000506 Ga0500577_0000506_1405_2718 421
161 3300005539 Ga0068853_100105444 Ga0068853_1001054442 422
162 3300013306 Ga0163162_10002670 Ga0163162_100026702 422
163 3300046471 Ga0495650_0000231 Ga0495650_0000231_90117_91475 422
164 3300046513 Ga0495616_0008927 Ga0495616_0008927_760_2118 422
165 3300046660 Ga0495625_0000191 Ga0495625_0000191_5096_6454 422
166 3300046665 Ga0495661_0002843 Ga0495661_0002843_2681_4039 422
167 3300046694 Ga0495649_0000061 Ga0495649_0000061_90885_92243 422
168 3300047472 Ga0495686_0045132 Ga0495686_0045132_291_1649 422
169 3300003316 rootH1_10028094 rootH1_100280945 423
170 3300005290 Ga0065712_10005812 Ga0065712_100058123 423
171 3300005331 Ga0070670_100031914 Ga0070670_1000319143 423
172 3300005343 Ga0070687_100044734 Ga0070687_1000447342 423
173 3300005617 Ga0068859_100057873 Ga0068859_1000578733 423
174 3300006931 Ga0097620_100057874 Ga0097620_1000578743 423
175 3300025908 Ga0207643_10027656 Ga0207643_100276562 423
176 3300025918 Ga0207662_10046259 Ga0207662_100462592 423
177 3300025940 Ga0207691_10064987 Ga0207691_100649872 423
178 3300025942 Ga0207689_10045659 Ga0207689_100456593 423
179 3300026118 Ga0207675_100243099 Ga0207675_1002430992 423
180 3300046520 Ga0495637_0022196 Ga0495637_0022196_204_1562 423
181 3300049570 Ga0501033_0061896 Ga0501033_0061896_1327_2673 423
182 3300049705 Ga0501225_0000313 Ga0501225_0000313_11922_13259 423
183 3300001990 JGI24737J22298_10002220 JGI24737J22298_100022203 424
184 3300002067 JGI24735J21928_10000044 JGI24735J21928_1000004445 424
185 3300003323 rootH1_10005179 rootH1_100051792 424
186 3300005455 Ga0070663_100011342 Ga0070663_1000113422 424
187 3300005539 Ga0068853_100035355 Ga0068853_1000353553 424
188 3300005563 Ga0068855_100292695 Ga0068855_1002926952 424
189 3300009093 Ga0105240_10001927 Ga0105240_1000192711 424
190 3300009174 Ga0105241_10076742 Ga0105241_100767422 424
191 3300009551 Ga0105238_10066158 Ga0105238_100661582 424
192 3300013102 Ga0157371_10007304 Ga0157371_100073043 424
193 3300013105 Ga0157369_10000439 Ga0157369_1000043931 424
194 3300013105 Ga0157369_10098984 Ga0157369_100989842 424
195 3300013307 Ga0157372_10000015 Ga0157372_100000158 424
196 3300013307 Ga0157372_10002159 Ga0157372_1000215912 424
197 3300013307 Ga0157372_10003320 Ga0157372_100033204 424
198 3300013307 Ga0157372_10092533 Ga0157372_100925332 424
199 3300025913 Ga0207695_10001380 Ga0207695_1000138021 424
200 3300026067 Ga0207678_10160399 Ga0207678_101603992 424
201 3300037312 Ga0395899_0000181 Ga0395899_0000181_87926_89290 424
202 3300037418 Ga0395900_0125910 Ga0395900_0125910_548_1912 424
203 3300044712 Ga0453684_0007582 Ga0453684_0007582_2077_3360 424
204 3300046492 Ga0495585_0000037 Ga0495585_0000037_92395_93753 424
205 3300047472 Ga0495686_0000071 Ga0495686_0000071_93830_95185 424
206 3300053156 Ga0500622_0000199 Ga0500622_0000199_2875_4227 424
207 3300009545 Ga0105237_10044219 Ga0105237_100442192 425
208 3300013307 Ga0157372_10296187 Ga0157372_102961872 425
209 3300028794 Ga0307515_10063752 Ga0307515_100637522 425
210 3300031731 Ga0307405_10015870 Ga0307405_100158702 425
211 3300003323 rootH1_10112412 rootH1_101124126 426
212 3300005616 Ga0068852_100250932 Ga0068852_1002509322 426
213 3300013307 Ga0157372_10062482 Ga0157372_100624822 426
214 3300031507 Ga0307509_10018041 Ga0307509_100180415 426
215 3300031731 Ga0307405_10000046 Ga0307405_1000004615 426
216 3300046507 Ga0495606_0099225 Ga0495606_0099225_281_1627 426
217 3300003320 rootH2_10257480 rootH2_102574802 427
218 3300005563 Ga0068855_100082527 Ga0068855_1000825272 427
219 3300010375 Ga0105239_10000101 Ga0105239_1000010185 427
220 3300025250 Ga0209026_1002923 Ga0209026_10029232 427
221 3300025949 Ga0207667_10091830 Ga0207667_100918301 427
222 3300009093 Ga0105240_10000126 Ga0105240_1000012645 428
223 3300013102 Ga0157371_10000542 Ga0157371_100005424 428
224 3300013104 Ga0157370_10003898 Ga0157370_100038983 428
225 3300013104 Ga0157370_10215892 Ga0157370_102158921 428
226 3300013307 Ga0157372_10022589 Ga0157372_100225893 428
227 3300025913 Ga0207695_10000013 Ga0207695_10000013366 428
228 3300031548 Ga0307408_100001139 Ga0307408_10000113912 428
229 3300033180 Ga0307510_10033263 Ga0307510_100332632 428
230 3300047323 Ga0495683_0030179 Ga0495683_0030179_724_2082 428
231 3300003316 rootH1_10000027 rootH1_100000273 429
232 3300005339 Ga0070660_100001051 Ga0070660_1000010512 429
233 3300005563 Ga0068855_100025359 Ga0068855_1000253592 429
234 3300005616 Ga0068852_100116130 Ga0068852_1001161302 429
235 3300013104 Ga0157370_10037479 Ga0157370_100374793 429
236 3300013105 Ga0157369_10296272 Ga0157369_102962721 429
237 3300025919 Ga0207657_10004064 Ga0207657_100040647 429
238 3300025949 Ga0207667_10039748 Ga0207667_100397484 429
239 3300026089 Ga0207648_10035278 Ga0207648_100352783 429
240 3300026142 Ga0207698_10107001 Ga0207698_101070012 429
241 3300037418 Ga0395900_0099969 Ga0395900_0099969_205_1551 429
242 3300037466 Ga0395898_0105748 Ga0395898_0105748_1009_2355 429
243 3300005288 Ga0065714_10064438 Ga0065714_1006443846 430
244 3300005564 Ga0070664_100036987 Ga0070664_1000369872 430
245 3300005614 Ga0068856_100133462 Ga0068856_1001334621 430
246 3300009545 Ga0105237_10002695 Ga0105237_1000269513 430
247 3300009545 Ga0105237_10003064 Ga0105237_100030642 430
248 3300013102 Ga0157371_10005101 Ga0157371_100051013 430
249 3300013296 Ga0157374_10014904 Ga0157374_100149042 430
250 3300013307 Ga0157372_10008802 Ga0157372_100088023 430
251 3300025914 Ga0207671_10008091 Ga0207671_100080912 430
252 3300025914 Ga0207671_10014013 Ga0207671_100140132 430
253 3300025945 Ga0207679_10042790 Ga0207679_100427902 430
254 3300037312 Ga0395899_0004001 Ga0395899_0004001_594_1913 430
255 3300037418 Ga0395900_0012319 Ga0395900_0012319_6825_8144 430
256 3300037466 Ga0395898_0009073 Ga0395898_0009073_605_1924 430
257 3300037471 Ga0395905_0001794 Ga0395905_0001794_19028_20368 430
258 3300038443 Ga0395901_0051155 Ga0395901_0051155_2467_3786 430
259 3300005614 Ga0068856_100000924 Ga0068856_1000009245 432
260 3300009545 Ga0105237_10031241 Ga0105237_100312412 432
261 3300013104 Ga0157370_10011410 Ga0157370_100114102 432
262 3300025914 Ga0207671_10004574 Ga0207671_100045742 432
263 3300026078 Ga0207702_10091360 Ga0207702_100913602 432
264 3300028794 Ga0307515_10000001 Ga0307515_100000012930 432
265 3300037312 Ga0395899_0000806 Ga0395899_0000806_10315_11658 432
266 3300037418 Ga0395900_0005331 Ga0395900_0005331_4421_5764 432
267 3300037466 Ga0395898_0002747 Ga0395898_0002747_8261_9604 432
268 3300038443 Ga0395901_0002632 Ga0395901_0002632_1444_2787 432
269 iso_pu_bacteria 2896109856 2896111097 432
270 3300002737 JGI25162J39368_1000094 JGI25162J39368_100009464 433
271 3300005366 Ga0070659_100211126 Ga0070659_1002111261 433
272 3300009174 Ga0105241_10020689 Ga0105241_100206893 433
273 3300010375 Ga0105239_10000718 Ga0105239_1000071826 433
274 3300025233 Ga0209437_100077 Ga0209437_100077183 433
275 3300025914 Ga0207671_10099726 Ga0207671_100997261 433
276 3300031251 Ga0265327_10000411 Ga0265327_1000041123 433
277 3300046660 Ga0495625_0098709 Ga0495625_0098709_511_1857 433
278 3300049459 Ga0495678_004082 Ga0495678_004082_6276_7622 433
279 3300005288 Ga0065714_10002329 Ga0065714_1000232925 434
280 3300005563 Ga0068855_100224911 Ga0068855_1002249111 434
281 3300010375 Ga0105239_10032473 Ga0105239_100324732 434
282 3300047443 Ga0495687_002703 Ga0495687_002703_4239_5585 434
283 3300053153 Ga0500616_0059090 Ga0500616_0059090_182_1531 434
284 3300017792 Ga0163161_10000365 Ga0163161_1000036516 435
285 3300046512 Ga0495610_0000093 Ga0495610_0000093_37282_38631 435
286 3300053727 Ga0500611_000063 Ga0500611_000063_40265_41599 435
287 3300003781 Ga0055536_1000008 Ga0055536_100000892 436
288 3300003791 Ga0055530_10001780 Ga0055530_100017802 436
289 3300013102 Ga0157371_10015963 Ga0157371_100159632 436
290 3300013104 Ga0157370_10000446 Ga0157370_1000044616 436
291 3300025292 Ga0209676_1000042 Ga0209676_100004291 436
292 3300025298 Ga0209050_1000035 Ga0209050_100003590 436
293 3300005617 Ga0068859_100014625 Ga0068859_1000146253 437
294 3300006931 Ga0097620_100014625 Ga0097620_1000146253 437
295 3300031456 Ga0307513_10110373 Ga0307513_101103732 437
296 3300032004 Ga0307414_10001044 Ga0307414_100010445 437
297 3300042004 Ga0439445_0011601 Ga0439445_0011601_378_1715 437
298 3300046453 Ga0495627_022022 Ga0495627_022022_182_1516 437
299 3300046558 Ga0495633_0000641 Ga0495633_0000641_22127_23461 437
300 iso_pu_bacteria 2929239360 2929243164 437
301 3300005336 Ga0070680_100020002 Ga0070680_1000200023 438
302 3300005337 Ga0070682_100000811 Ga0070682_10000081122 438
303 3300005341 Ga0070691_10018412 Ga0070691_100184122 438
304 3300005577 Ga0068857_100007826 Ga0068857_1000078263 438
305 3300009094 Ga0111539_10178610 Ga0111539_101786102 438
306 3300013102 Ga0157371_10112929 Ga0157371_101129291 438
307 3300013307 Ga0157372_10119225 Ga0157372_101192252 438
308 3300025904 Ga0207647_10000574 Ga0207647_100005743 438
309 3300025912 Ga0207707_10003153 Ga0207707_100031539 438
310 3300025917 Ga0207660_10006527 Ga0207660_100065274 438
311 3300025921 Ga0207652_10004993 Ga0207652_100049932 438
312 3300025932 Ga0207690_10044117 Ga0207690_100441172 438
313 3300026116 Ga0207674_10014223 Ga0207674_100142237 438
314 3300053130 Ga0500642_0019392 Ga0500642_0019392_1220_2578 438
315 3300003354 JGI25160J50197_1000749 JGI25160J50197_100074913 439
316 3300005366 Ga0070659_100052142 Ga0070659_1000521422 439
317 3300013104 Ga0157370_10081785 Ga0157370_100817852 439
318 3300025302 Ga0207426_1000170 Ga0207426_1000170101 439
319 3300053156 Ga0500622_0000676 Ga0500622_0000676_8454_9782 439
320 3300003320 rootH2_10096738 rootH2_100967383 440
321 3300003323 rootH1_10161604 rootH1_101616041 440
322 3300003794 Ga0055531_10000255 Ga0055531_1000025531 440
323 3300005548 Ga0070665_100000041 Ga0070665_100000041119 440
324 3300005563 Ga0068855_100000229 Ga0068855_10000022937 440
325 3300005843 Ga0068860_100000491 Ga0068860_10000049117 440
326 3300009093 Ga0105240_10000147 Ga0105240_1000014717 440
327 3300009093 Ga0105240_10000168 Ga0105240_1000016812 440
328 3300009093 Ga0105240_10004968 Ga0105240_100049683 440
329 3300009545 Ga0105237_10004889 Ga0105237_100048897 440
330 3300009545 Ga0105237_10007620 Ga0105237_100076205 440
331 3300010375 Ga0105239_10016300 Ga0105239_100163004 440
332 3300010375 Ga0105239_10046003 Ga0105239_100460033 440
333 3300013306 Ga0163162_10001178 Ga0163162_1000117817 440
334 3300025304 Ga0209257_1000071 Ga0209257_100007131 440
335 3300025913 Ga0207695_10000023 Ga0207695_10000023290 440
336 3300025913 Ga0207695_10000031 Ga0207695_10000031279 440
337 3300025913 Ga0207695_10100449 Ga0207695_101004492 440
338 3300025914 Ga0207671_10002372 Ga0207671_1000237211 440
339 3300025914 Ga0207671_10004115 Ga0207671_100041156 440
340 3300028379 Ga0268266_10000014 Ga0268266_1000001476 440
341 3300028381 Ga0268264_10000674 Ga0268264_1000067416 440
342 3300033180 Ga0307510_10009647 Ga0307510_100096472 440
343 3300044658 Ga0466972_0001211 Ga0466972_0001211_4744_6075 440
344 3300046507 Ga0495606_0005180 Ga0495606_0005180_5088_6431 440
345 3300046524 Ga0495648_0004193 Ga0495648_0004193_7749_9080 440
346 3300046648 Ga0495611_0000100 Ga0495611_0000100_53761_55095 440
347 3300046660 Ga0495625_0090399 Ga0495625_0090399_109_1440 440
348 3300047443 Ga0495687_000144 Ga0495687_000144_99814_101145 440
349 3300047472 Ga0495686_0000004 Ga0495686_0000004_674025_675359 440
350 3300047472 Ga0495686_0031208 Ga0495686_0031208_1139_2464 440
351 3300048929 Ga0496126_0116479 Ga0496126_0116479_184_1512 440
352 3300053092 Ga0500583_0002307 Ga0500583_0002307_571_1902 440
353 3300053156 Ga0500622_0001437 Ga0500622_0001437_17197_18525 440
354 iso_pu_bacteria 2738541278 2738729947 440
355 3300002737 JGI25162J39368_1002229 JGI25162J39368_10022294 441
356 3300003214 JGI25165J46597_1001508 JGI25165J46597_10015085 441
357 3300003316 rootH1_10076092 rootH1_100760924 441
358 3300003320 rootH2_10035311 rootH2_100353113 441
359 3300003320 rootH2_10200132 rootH2_102001322 441
360 3300003322 rootL2_10108754 rootL2_101087541 441
361 3300003323 rootH1_10004461 rootH1_100044613 441
362 3300003323 rootH1_10100901 rootH1_101009012 441
363 3300005288 Ga0065714_10079517 Ga0065714_100795172 441
364 3300005295 Ga0065707_10024861 Ga0065707_100248612 441
365 3300005340 Ga0070689_100098618 Ga0070689_1000986183 441
366 3300005539 Ga0068853_100000568 Ga0068853_10000056811 441
367 3300005539 Ga0068853_100030399 Ga0068853_1000303993 441
368 3300005548 Ga0070665_100000017 Ga0070665_10000001787 441
369 3300005563 Ga0068855_100027449 Ga0068855_1000274494 441
370 3300005618 Ga0068864_100000976 Ga0068864_1000009767 441
371 3300005840 Ga0068870_10009858 Ga0068870_100098583 441
372 3300005841 Ga0068863_100281138 Ga0068863_1002811381 441
373 3300006237 Ga0097621_100133834 Ga0097621_1001338342 441
374 3300009093 Ga0105240_10021127 Ga0105240_100211273 441
375 3300009093 Ga0105240_10081685 Ga0105240_100816853 441
376 3300009176 Ga0105242_10172967 Ga0105242_101729672 441
377 3300009545 Ga0105237_10000263 Ga0105237_1000026319 441
378 3300009545 Ga0105237_10012639 Ga0105237_100126392 441
379 3300009545 Ga0105237_10033780 Ga0105237_100337802 441
380 3300009551 Ga0105238_10050024 Ga0105238_100500242 441
381 3300010375 Ga0105239_10009228 Ga0105239_100092282 441
382 3300010375 Ga0105239_10028055 Ga0105239_100280552 441
383 3300010375 Ga0105239_10087590 Ga0105239_100875902 441
384 3300013306 Ga0163162_10000026 Ga0163162_1000002665 441
385 3300013306 Ga0163162_10000778 Ga0163162_100007784 441
386 3300013308 Ga0157375_10347838 Ga0157375_103478381 441
387 3300014969 Ga0157376_10123309 Ga0157376_101233093 441
388 3300017792 Ga0163161_10103835 Ga0163161_101038352 441
389 3300025231 Ga0207427_100219 Ga0207427_10021928 441
390 3300025233 Ga0209437_100363 Ga0209437_10036328 441
391 3300025261 Ga0209233_1000017 Ga0209233_1000017810 441
392 3300025272 Ga0209455_1009419 Ga0209455_10094192 441
393 3300025908 Ga0207643_10021862 Ga0207643_100218623 441
394 3300025911 Ga0207654_10043669 Ga0207654_100436691 441
395 3300025913 Ga0207695_10027307 Ga0207695_100273073 441
396 3300025914 Ga0207671_10000957 Ga0207671_1000095716 441
397 3300025914 Ga0207671_10018858 Ga0207671_100188582 441
398 3300025924 Ga0207694_10032463 Ga0207694_100324632 441
399 3300025924 Ga0207694_10087572 Ga0207694_100875722 441
400 3300025936 Ga0207670_10151819 Ga0207670_101518191 441
401 3300025949 Ga0207667_10021359 Ga0207667_100213592 441
402 3300025949 Ga0207667_10107289 Ga0207667_101072891 441
403 3300026041 Ga0207639_10014162 Ga0207639_100141622 441
404 3300026095 Ga0207676_10016416 Ga0207676_100164163 441
405 3300028379 Ga0268266_10000037 Ga0268266_10000037229 441
406 3300044658 Ga0466972_0000008 Ga0466972_0000008_99775_101202 441
407 3300044712 Ga0453684_0041284 Ga0453684_0041284_4188_5525 441
408 3300046471 Ga0495650_0029554 Ga0495650_0029554_1015_2364 441
409 3300046529 Ga0495652_0219171 Ga0495652_0219171_25_1383 441
410 3300046537 Ga0495598_0011499 Ga0495598_0011499_34_1368 441
411 3300046694 Ga0495649_0000010 Ga0495649_0000010_354906_356264 441
412 3300047472 Ga0495686_0038489 Ga0495686_0038489_1604_2989 441
413 3300049571 Ga0501034_0047009 Ga0501034_0047009_1582_2940 441
414 3300049703 Ga0501219_000091 Ga0501219_000091_4510_5841 441
415 3300050005 Ga0501284_00037 Ga0501284_00037_47244_48575 441
416 iso_pu_bacteria 2896344016 2896346585 441
417 3300005339 Ga0070660_100180575 Ga0070660_1001805752 442
418 3300005366 Ga0070659_100119298 Ga0070659_1001192982 442
419 3300005530 Ga0070679_100015145 Ga0070679_1000151452 442
420 3300005539 Ga0068853_100065925 Ga0068853_1000659253 442
421 3300005563 Ga0068855_100000730 Ga0068855_10000073019 442
422 3300005563 Ga0068855_100001155 Ga0068855_10000115520 442
423 3300005563 Ga0068855_100114663 Ga0068855_1001146633 442
424 3300005577 Ga0068857_100041959 Ga0068857_1000419593 442
425 3300005614 Ga0068856_100061198 Ga0068856_1000611983 442
426 3300005841 Ga0068863_100215079 Ga0068863_1002150791 442
427 3300009174 Ga0105241_10001279 Ga0105241_100012796 442
428 3300009545 Ga0105237_10003527 Ga0105237_100035272 442
429 3300013102 Ga0157371_10006762 Ga0157371_100067621 442
430 3300013104 Ga0157370_10200872 Ga0157370_102008721 442
431 3300014326 Ga0157380_10011724 Ga0157380_100117244 442
432 3300025909 Ga0207705_10076584 Ga0207705_100765842 442
433 3300025914 Ga0207671_10059448 Ga0207671_100594483 442
434 3300025919 Ga0207657_10023840 Ga0207657_100238402 442
435 3300025921 Ga0207652_10009935 Ga0207652_100099353 442
436 3300025937 Ga0207669_10088833 Ga0207669_100888332 442
437 3300025949 Ga0207667_10010389 Ga0207667_100103892 442
438 3300025949 Ga0207667_10216366 Ga0207667_102163661 442
439 3300025961 Ga0207712_10102919 Ga0207712_101029192 442
440 3300026035 Ga0207703_10043478 Ga0207703_100434782 442
441 3300026078 Ga0207702_10059707 Ga0207702_100597071 442
442 3300026078 Ga0207702_10166085 Ga0207702_101660851 442
443 3300026142 Ga0207698_10003067 Ga0207698_100030672 442
444 3300036712 Ga0316584_0124463 Ga0316584_0124463_470_1810 442
445 3300039062 Ga0400483_016155 Ga0400483_016155_9042_10373 442
446 3300039062 Ga0400483_231526 Ga0400483_231526_7104_8435 442
447 3300042876 Ga0451577_0095655 Ga0451577_0095655_1023_2381 442
448 3300044656 Ga0466969_0000052 Ga0466969_0000052_11158_12498 442
449 3300044684 Ga0466966_0056036 Ga0466966_0056036_40_1380 442
450 3300044712 Ga0453684_0066924 Ga0453684_0066924_155_1513 442
451 3300045049 Ga0466959_0000084 Ga0466959_0000084_25448_26788 442
452 3300049570 Ga0501033_0162912 Ga0501033_0162912_41_1402 442
453 3300053136 Ga0500559_0016035 Ga0500559_0016035_205_1542 442
454 iso_pu_bacteria 2775506987 2776613601 442
455 iso_pu_bacteria 2883068021 2883072013 442
456 3300005327 Ga0070658_10000434 Ga0070658_1000043412 443
457 3300005471 Ga0070698_100021191 Ga0070698_1000211916 443
458 3300009147 Ga0114129_10007293 Ga0114129_100072936 443
459 3300025909 Ga0207705_10000482 Ga0207705_1000048213 443
460 3300025949 Ga0207667_10000197 Ga0207667_1000019720 443
461 3300031727 Ga0316576_10061672 Ga0316576_100616722 443
462 3300037312 Ga0395899_0005474 Ga0395899_0005474_7904_9259 443
463 3300037418 Ga0395900_0009414 Ga0395900_0009414_7188_8543 443
464 3300037466 Ga0395898_0015129 Ga0395898_0015129_3159_4514 443
465 3300038443 Ga0395901_0008449 Ga0395901_0008449_1644_2999 443
466 3300042876 Ga0451577_0025309 Ga0451577_0025309_493_1839 443
467 3300044712 Ga0453684_0249062 Ga0453684_0249062_215_1552 443
468 3300046616 Ga0495668_0020335 Ga0495668_0020335_2115_3455 443
469 3300050507 nmdc:mga05p37_5208_c1 nmdc:mga05p37_5208_c1_7075_8415 443
470 iso_pu_bacteria 2739367656 2739616691 443
471 iso_pu_bacteria 2818991444 2819590128 443
472 iso_pu_bacteria 2919437846 2919442582 443
473 3300005331 Ga0070670_100120067 Ga0070670_1001200672 444
474 3300005564 Ga0070664_100022082 Ga0070664_1000220822 444
475 3300009093 Ga0105240_10039408 Ga0105240_100394082 444
476 3300013307 Ga0157372_10051670 Ga0157372_100516701 444
477 3300025321 Ga0207656_10049877 Ga0207656_100498772 444
478 3300025945 Ga0207679_10102257 Ga0207679_101022572 444
479 3300031616 Ga0307508_10000644 Ga0307508_1000064418 444
480 3300037418 Ga0395900_0002459 Ga0395900_0002459_2649_4022 444
481 3300037471 Ga0395905_0000819 Ga0395905_0000819_35075_36448 444
482 3300038443 Ga0395901_0025905 Ga0395901_0025905_940_2313 444
483 3300049823 Ga0501044_0116710 Ga0501044_0116710_962_2317 444
484 iso_pu_bacteria 2585427687 2586208828 444
485 iso_pu_bacteria 2738541283 2738756180 444
486 iso_pu_bacteria 2738541284 2738763926 444
487 iso_pu_bacteria 2842722452 2842726221 444
488 iso_pu_bacteria 2842909656 2842910466 444
489 iso_pu_bacteria 2896109856 2896113891 444
490 iso_pu_bacteria 2954016120 2954017702 444
491 iso_pu_bacteria 2958512119 2958512846 444
492 3300013297 Ga0157378_10011362 Ga0157378_100113623 445
493 3300013306 Ga0163162_10053450 Ga0163162_100534503 445
494 iso_pu_bacteria 2818991442 2819577475 445
495 iso_pu_bacteria 2821136567 2821138853 445
496 iso_pu_bacteria 2904467357 2904472568 445
497 iso_pu_bacteria 2977232053 2977234263 445
498 3300006195 Ga0075366_10136009 Ga0075366_101360091 446
499 3300053156 Ga0500622_0001133 Ga0500622_0001133_8623_9963 446
500 iso_pu_bacteria 2852627209 2852629740 446
501 3300005288 Ga0065714_10003211 Ga0065714_100032113 447
502 3300005614 Ga0068856_100015341 Ga0068856_1000153413 447
503 3300005614 Ga0068856_100217644 Ga0068856_1002176442 447
504 3300010375 Ga0105239_10000016 Ga0105239_1000001674 447
505 3300013100 Ga0157373_10023122 Ga0157373_100231222 447
506 3300013102 Ga0157371_10075800 Ga0157371_100758003 447
507 3300013104 Ga0157370_10032312 Ga0157370_100323122 447
508 3300013105 Ga0157369_10009068 Ga0157369_100090683 447
509 3300025913 Ga0207695_10057140 Ga0207695_100571402 447
510 3300025921 Ga0207652_10005780 Ga0207652_100057806 447
511 3300026078 Ga0207702_10034225 Ga0207702_100342252 447
512 3300026078 Ga0207702_10179635 Ga0207702_101796352 447
513 3300028794 Ga0307515_10000280 Ga0307515_1000028067 447
514 3300028794 Ga0307515_10003886 Ga0307515_1000388613 447
515 3300033179 Ga0307507_10001142 Ga0307507_1000114222 447
516 3300037312 Ga0395899_0000001 Ga0395899_0000001_131253_132611 447
517 3300037418 Ga0395900_0211550 Ga0395900_0211550_241_1617 447
518 3300046492 Ga0495585_0015075 Ga0495585_0015075_2293_3636 447
519 3300046500 Ga0495596_0029183 Ga0495596_0029183_147_1505 447
520 3300046507 Ga0495606_0005353 Ga0495606_0005353_224_1567 447
521 3300046524 Ga0495648_0019829 Ga0495648_0019829_83_1426 447
522 3300046538 Ga0495609_0014279 Ga0495609_0014279_2011_3354 447
523 3300046558 Ga0495633_0000023 Ga0495633_0000023_44703_46046 447
524 3300046616 Ga0495668_0000012 Ga0495668_0000012_112787_114130 447
525 3300046660 Ga0495625_0001093 Ga0495625_0001093_10450_11793 447
526 3300046660 Ga0495625_0001735 Ga0495625_0001735_22614_23957 447
527 3300049570 Ga0501033_0033698 Ga0501033_0033698_2252_3598 447
528 3300049571 Ga0501034_0115052 Ga0501034_0115052_1203_2549 447
529 3300049575 Ga0501039_0211589 Ga0501039_0211589_130_1476 447
530 3300050493 nmdc:mga0k408_1220_c1 nmdc:mga0k408_1220_c1_2012_3355 447
531 3300053125 Ga0500618_000013 Ga0500618_000013_3824_5167 447
532 iso_pu_bacteria 2599185184 2599481466 447
533 iso_pu_bacteria 2852623160 2852623975 447
534 iso_pu_bacteria 2884933994 2884937122 447
535 iso_pu_bacteria 2928078545 2928082830 447
536 iso_pu_bacteria 2928147474 2928149848 447
537 iso_pu_bacteria 2932082852 2932086501 447
538 2162886007 SwRhRL2b_contig_466296 SwRhRL2b_0870.00004180 448
539 3300005288 Ga0065714_10001936 Ga0065714_1000193639 448
540 3300005288 Ga0065714_10002328 Ga0065714_1000232820 448
541 3300005289 Ga0065704_10000199 Ga0065704_10000199113 448
542 3300005289 Ga0065704_10088743 Ga0065704_100887432 448
543 3300013100 Ga0157373_10000015 Ga0157373_10000015137 448
544 3300013102 Ga0157371_10003393 Ga0157371_100033932 448
545 3300013102 Ga0157371_10006506 Ga0157371_100065062 448
546 3300013104 Ga0157370_10000474 Ga0157370_1000047423 448
547 3300013307 Ga0157372_10000735 Ga0157372_100007351 448
548 3300014497 Ga0182008_10000001 Ga0182008_10000001405 448
549 3300015261 Ga0182006_1002670 Ga0182006_10026705 448
550 3300030732 Ga0316176_1048616 Ga0316176_10486167 448
551 3300030742 Ga0316183_1018086 Ga0316183_10180865 448
552 3300030744 Ga0316181_1069399 Ga0316181_10693994 448
553 3300031911 Ga0307412_10000017 Ga0307412_10000017179 448
554 3300032004 Ga0307414_10005303 Ga0307414_100053032 448
555 3300032004 Ga0307414_10155409 Ga0307414_101554092 448
556 3300046507 Ga0495606_0000060 Ga0495606_0000060_106131_107489 448
557 3300053093 Ga0500651_0000451 Ga0500651_0000451_6837_8183 448
558 iso_pu_bacteria 2818991437 2819549343 448
559 iso_pu_bacteria 2842903701 2842904141 448

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

38

467

0.96

PF07690

MFS_1

Major Facilitator Superfamily

42

318

0.8

PF07690

MFS_1

Major Facilitator Superfamily

277

466

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9102 19 433
4yb9-assembly1.cif.gz_D crystal structure of the bovine fructose transporter glut5 in an open inward-facing conformation 0.9028 17 432
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.9006 16 433
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8959 19 433
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8925 16 433
ID Description Score Start End Superfamily
af_A0A0P0WGH5_53_382_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9583 10 316 1.20.1250.20
af_A0A0P0WGJ2_58_436_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9575 11 366 1.20.1250.20
af_K7TQZ4_34_446_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9573 11 394 1.20.1250.20
4ja3A03 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9546 251 432 1.20.1250.20
af_O95528_5_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9524 13 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q5RE67-F1-model_v4 MFS transporter 0.9793 1 265 GO:0016020
GO:0022857
AF-A0A519V664-F1-model_v4 MFS transporter 0.9748 1 193 GO:0016020
GO:0022857
AF-A0A519V664-F1-model_v4 MFS transporter 0.9699 1 193 GO:0016020
GO:0022857
AF-A0A4Q5RE67-F1-model_v4 MFS transporter 0.9685 1 265 GO:0016020
GO:0022857
AF-A0A7V3JMR2-F1-model_v4 MFS transporter 0.9671 12 446 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
88.82 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map