F463530

General Info

Members Datasets Scaffolds Average Seq Length
559 269 547 287

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10001656|Ga0070676_100016569
Length 317
Sequence MEPNIAIPLTASLTHTSIESLPLVAADPGGPVDVRQDQLQSWIGRSERFEDTVYPTPVVALTATLDHPAAPLGPGTPLPPLWHWLYFLPTHRQSEIGPDGHAKRGSFLPPVPLPRRMWAGSQFDFRSPIRVGDRVARTSIIDDVTVKDGRSGKLVFVKVRHEVRCNEAGEPALIEFHDIVYRAAQGPTDVAPPPQPAPTDATWRREIVPDDVLLFRYSALTFNGHRIHYDRQYVTQVEGYPGLIVHGPLIATLLMDLLRRQMPDADVASFRFKAVRPTFDLNPFHVSGQAHADGKTIRLWASDHEGWLTMDATATLR

Samples

Sample ID Description Type Environment
1 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221672 Variovorax sp. Root434 Isolate Unclassified
6 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
7 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
8 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
9 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
10 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
11 2904456579 Variovorax sp. 2002 Isolate Unclassified
12 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
178 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
184 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
187 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
188 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
191 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
192 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
193 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
196 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
202 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
257 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
258 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 0
Isolates 2.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0.72
Rhizoplane 4.47
Rhizosphere 84.26
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001278 3300002773 Bacteria 11330
2 JGI25151J46595_10003564 3300003187 Bacteria 8538
3 JGI25153J46596_10001018 3300003215 Bacteria 17040
4 Ga0055526_1001244 3300003771 Bacteria 18280
5 Ga0070676_10001656 3300005328 Bacteria 11344
6 Ga0070676_10010396 3300005328 Bacteria 5048
7 Ga0070676_10116429 3300005328 Bacteria 1671
8 Ga0070676_10120746 3300005328 Bacteria 1644
9 Ga0070690_100021694 3300005330 Bacteria 3923
10 Ga0070690_100036267 3300005330 Bacteria 3098
11 Ga0070670_100061134 3300005331 Bacteria 3234
12 Ga0070670_100126338 3300005331 Bacteria 2207
13 Ga0070670_100131895 3300005331 Bacteria 2158
14 Ga0070670_100160325 3300005331 Bacteria 1949
15 Ga0070670_100283584 3300005331 Bacteria 1446
16 Ga0070670_100405162 3300005331 Bacteria 1204
17 Ga0070670_100645231 3300005331 Bacteria 949
18 Ga0070677_10010100 3300005333 Bacteria 3218
19 Ga0070677_10022039 3300005333 Bacteria 2342
20 Ga0068869_100015211 3300005334 Bacteria 5156
21 Ga0068869_100043324 3300005334 Bacteria 3232
22 Ga0070666_10002356 3300005335 Bacteria 11412
23 Ga0070666_10015312 3300005335 Bacteria 4889
24 Ga0070666_10029851 3300005335 Bacteria 3587
25 Ga0070666_10073615 3300005335 Bacteria 2327
26 Ga0068868_100004021 3300005338 Bacteria 10266
27 Ga0068868_100015163 3300005338 Bacteria 5694
28 Ga0068868_100136762 3300005338 Bacteria 2009
29 Ga0068868_100264170 3300005338 Bacteria 1452
30 Ga0068868_100411940 3300005338 Bacteria 1168
31 Ga0070689_100016060 3300005340 Bacteria 5475
32 Ga0070689_100394356 3300005340 Bacteria 1169
33 Ga0070687_100003277 3300005343 Bacteria 6259
34 Ga0070661_100007761 3300005344 Bacteria 7402
35 Ga0070661_100233393 3300005344 Bacteria 1414
36 Ga0070661_100469664 3300005344 Bacteria 1003
37 Ga0070668_100002946 3300005347 Bacteria 12590
38 Ga0070669_100064434 3300005353 Bacteria 2699
39 Ga0070669_100107577 3300005353 Bacteria 2112
40 Ga0070675_100008803 3300005354 Bacteria 7840
41 Ga0070675_100079934 3300005354 Bacteria 2725
42 Ga0070675_100112092 3300005354 Bacteria 2309
43 Ga0070675_100207205 3300005354 Bacteria 1703
44 Ga0070671_100000534 3300005355 Bacteria 26702
45 Ga0070671_100001751 3300005355 Bacteria 16492
46 Ga0070671_100004653 3300005355 Bacteria 10882
47 Ga0070671_100009290 3300005355 Bacteria 7897
48 Ga0070671_100081834 3300005355 Bacteria 2700
49 Ga0070671_100175961 3300005355 Bacteria 1811
50 Ga0070674_100004521 3300005356 Bacteria 7942
51 Ga0070673_100003867 3300005364 Bacteria 9404
52 Ga0070673_100011490 3300005364 Bacteria 6044
53 Ga0070673_100323417 3300005364 Bacteria 1363
54 Ga0070688_100101391 3300005365 Bacteria 1899
55 Ga0070659_100178861 3300005366 Bacteria 1740
56 Ga0070659_100448678 3300005366 Bacteria 1094
57 Ga0070667_100272255 3300005367 Bacteria 1518
58 Ga0070667_100489373 3300005367 Bacteria 1127
59 Ga0070705_100378387 3300005440 Bacteria 1041
60 Ga0070700_100296782 3300005441 Bacteria 1178
61 Ga0070708_100097203 3300005445 Bacteria 2692
62 Ga0070708_100297401 3300005445 Bacteria 1520
63 Ga0070708_100485915 3300005445 Bacteria 1165
64 Ga0070678_100000398 3300005456 Bacteria 20455
65 Ga0070678_100009895 3300005456 Bacteria 5796
66 Ga0070678_100062895 3300005456 Bacteria 2743
67 Ga0070678_100122902 3300005456 Bacteria 2050
68 Ga0070678_100141001 3300005456 Bacteria 1929
69 Ga0070662_100008969 3300005457 Bacteria 6523
70 Ga0070662_100012076 3300005457 Bacteria 5718
71 Ga0070662_100046524 3300005457 Bacteria 3117
72 Ga0070662_100510467 3300005457 Bacteria 1003
73 Ga0068867_100004355 3300005459 Bacteria 9969
74 Ga0068867_100017384 3300005459 Bacteria 5109
75 Ga0068867_100130031 3300005459 Bacteria 1955
76 Ga0068867_100176986 3300005459 Bacteria 1693
77 Ga0068867_100285587 3300005459 Bacteria 1355
78 Ga0070706_100007532 3300005467 Bacteria 10201
79 Ga0070707_100358842 3300005468 Bacteria 1416
80 Ga0070699_100478102 3300005518 Bacteria 1131
81 Ga0068853_100016921 3300005539 Bacteria 6010
82 Ga0068853_100024284 3300005539 Bacteria 5081
83 Ga0068853_100250042 3300005539 Bacteria 1626
84 Ga0070672_100003734 3300005543 Bacteria 9910
85 Ga0070672_100004240 3300005543 Bacteria 9374
86 Ga0070672_100054960 3300005543 Bacteria 3118
87 Ga0070672_100409990 3300005543 Bacteria 1162
88 Ga0070665_100004618 3300005548 Bacteria 14398
89 Ga0070665_100016303 3300005548 Bacteria 7451
90 Ga0070665_100194216 3300005548 Bacteria 2031
91 Ga0068855_100216125 3300005563 Bacteria 2152
92 Ga0070664_100382730 3300005564 Bacteria 1285
93 Ga0068857_100028905 3300005577 Bacteria 4892
94 Ga0068857_100056586 3300005577 Bacteria 3481
95 Ga0068857_100058719 3300005577 Bacteria 3417
96 Ga0068854_100065746 3300005578 Bacteria 2637
97 Ga0068854_100072859 3300005578 Bacteria 2516
98 Ga0068854_100073459 3300005578 Bacteria 2507
99 Ga0068854_100174439 3300005578 Bacteria 1675
100 Ga0068854_100241109 3300005578 Bacteria 1440
101 Ga0068852_100002662 3300005616 Bacteria 12347
102 Ga0068852_100039777 3300005616 Bacteria 3961
103 Ga0068852_100148541 3300005616 Bacteria 2177
104 Ga0068852_100234058 3300005616 Bacteria 1752
105 Ga0068852_100301682 3300005616 Bacteria 1550
106 Ga0068852_100490102 3300005616 Bacteria 1222
107 Ga0068859_100087895 3300005617 Bacteria 3157
108 Ga0068859_100359453 3300005617 Bacteria 1551
109 Ga0068864_100009957 3300005618 Bacteria 7843
110 Ga0068864_100048639 3300005618 Bacteria 3646
111 Ga0068864_100083208 3300005618 Bacteria 2810
112 Ga0068866_10033634 3300005718 Bacteria 2489
113 Ga0068866_10045628 3300005718 Bacteria 2199
114 Ga0068861_100048529 3300005719 Bacteria 3210
115 Ga0068861_100204657 3300005719 Bacteria 1659
116 Ga0068851_10095804 3300005834 Bacteria 1568
117 Ga0068851_10130710 3300005834 Bacteria 1357
118 Ga0068851_10130713 3300005834 Bacteria 1357
119 Ga0068851_10137060 3300005834 Bacteria 1328
120 Ga0068870_10022067 3300005840 Bacteria 3124
121 Ga0068863_100001931 3300005841 Bacteria 20577
122 Ga0068863_100012511 3300005841 Bacteria 8188
123 Ga0068863_100067113 3300005841 Bacteria 3393
124 Ga0068863_100084529 3300005841 Bacteria 3007
125 Ga0068863_100210912 3300005841 Bacteria 1871
126 Ga0068863_100233499 3300005841 Bacteria 1774
127 Ga0068858_100013092 3300005842 Bacteria 7822
128 Ga0068858_100074254 3300005842 Bacteria 3157
129 Ga0068858_100218660 3300005842 Bacteria 1804
130 Ga0068860_100011527 3300005843 Bacteria 8714
131 Ga0068860_100013623 3300005843 Bacteria 7970
132 Ga0068860_100024666 3300005843 Bacteria 5807
133 Ga0068860_100258039 3300005843 Bacteria 1698
134 Ga0068862_100048424 3300005844 Bacteria 3628
135 Ga0068862_100287658 3300005844 Bacteria 1508
136 Ga0075363_100024634 3300006048 Bacteria 3061
137 Ga0075362_10009683 3300006177 Bacteria 3736
138 Ga0075362_10013812 3300006177 Bacteria 3243
139 Ga0075367_10006462 3300006178 Bacteria 5925
140 Ga0075367_10094150 3300006178 Bacteria 1826
141 Ga0075366_10006457 3300006195 Bacteria 6426
142 Ga0075366_10084447 3300006195 Bacteria 1898
143 Ga0075366_10098253 3300006195 Bacteria 1756
144 Ga0075366_10108795 3300006195 Bacteria 1667
145 Ga0075366_10119299 3300006195 Bacteria 1589
146 Ga0097621_100023757 3300006237 Bacteria 4777
147 Ga0097621_100384221 3300006237 Bacteria 1255
148 Ga0097621_100545876 3300006237 Bacteria 1054
149 Ga0097621_100667916 3300006237 Bacteria 955
150 Ga0075370_10005574 3300006353 Bacteria 6275
151 Ga0075370_10005601 3300006353 Bacteria 6263
152 Ga0068871_100020371 3300006358 Bacteria 5079
153 Ga0068871_100141939 3300006358 Bacteria 2043
154 Ga0068871_100320893 3300006358 Bacteria 1364
155 Ga0068871_100578135 3300006358 Bacteria 1020
156 Ga0075430_100053192 3300006846 Bacteria 3410
157 Ga0075430_100097174 3300006846 Bacteria 2461
158 Ga0075429_100000252 3300006880 Bacteria 36895
159 Ga0075429_100001373 3300006880 Bacteria 19922
160 Ga0068865_100100586 3300006881 Bacteria 2116
161 Ga0097620_100087897 3300006931 Bacteria 3157
162 Ga0097620_100359424 3300006931 Bacteria 1551
163 Ga0099826_10006947 3300006948 Bacteria 8298
164 Ga0105245_10013791 3300009098 Bacteria 7038
165 Ga0105245_10223609 3300009098 Bacteria 1818
166 Ga0105245_10585136 3300009098 Bacteria 1141
167 Ga0105243_10045820 3300009148 Bacteria 3438
168 Ga0105243_10567456 3300009148 Unclassified 1087
169 Ga0105243_10724162 3300009148 Bacteria 972
170 Ga0105241_10270527 3300009174 Bacteria 1447
171 Ga0105242_10096666 3300009176 Bacteria 2496
172 Ga0105248_10041700 3300009177 Bacteria 5146
173 Ga0105248_10093377 3300009177 Bacteria 3388
174 Ga0105248_10191457 3300009177 Bacteria 2305
175 Ga0105248_10303353 3300009177 Bacteria 1798
176 Ga0105248_10364616 3300009177 Bacteria 1627
177 Ga0105237_10021948 3300009545 Bacteria 6556
178 Ga0105237_10072295 3300009545 Bacteria 3443
179 Ga0105237_10162135 3300009545 Bacteria 2235
180 Ga0105237_10228775 3300009545 Bacteria 1860
181 Ga0105249_10287445 3300009553 Bacteria 1644
182 Ga0105239_10139175 3300010375 Bacteria 2704
183 Ga0105239_10142125 3300010375 Bacteria 2675
184 Ga0157373_10018374 3300013100 Bacteria 5092
185 Ga0157371_10384322 3300013102 Bacteria 1025
186 Ga0157370_10008352 3300013104 Bacteria 11168
187 Ga0157374_10740824 3300013296 Unclassified 997
188 Ga0157378_10031192 3300013297 Bacteria 4707
189 Ga0157378_10073491 3300013297 Bacteria 3074
190 Ga0157378_10302885 3300013297 Bacteria 1547
191 Ga0157378_10636974 3300013297 Bacteria 1080
192 Ga0163162_10003041 3300013306 Bacteria 16027
193 Ga0163162_10026576 3300013306 Bacteria 5722
194 Ga0163162_10347520 3300013306 Bacteria 1616
195 Ga0163162_10428509 3300013306 Bacteria 1455
196 Ga0163162_10496963 3300013306 Bacteria 1350
197 Ga0163162_10500344 3300013306 Bacteria 1346
198 Ga0157375_10018251 3300013308 Bacteria 6359
199 Ga0157375_10071975 3300013308 Bacteria 3472
200 Ga0157375_10639313 3300013308 Bacteria 1221
201 Ga0157375_10709841 3300013308 Bacteria 1159
202 Ga0157380_10122653 3300014326 Bacteria 2204
203 Ga0182008_10000821 3300014497 Bacteria 21644
204 Ga0157377_10144756 3300014745 Bacteria 1464
205 Ga0157379_10228061 3300014968 Bacteria 1688
206 Ga0157379_10282418 3300014968 Bacteria 1511
207 Ga0157379_10448294 3300014968 Bacteria 1191
208 Ga0157376_10065565 3300014969 Bacteria 3067
209 Ga0157376_10293402 3300014969 Bacteria 1536
210 Ga0182007_10001410 3300015262 Bacteria 12931
211 Ga0182007_10006552 3300015262 Bacteria 4991
212 Ga0183362_10001 3300015683 Bacteria 2046624
213 Ga0163161_10000455 3300017792 Bacteria 33945
214 Ga0163161_10059094 3300017792 Bacteria 2788
215 Ga0163161_10064797 3300017792 Bacteria 2666
216 Ga0163161_10244860 3300017792 Bacteria 1396
217 Ga0207425_1000710 3300025245 Bacteria 17927
218 Ga0209129_1000175 3300025258 Bacteria 93817
219 Ga0209025_1002169 3300025294 Bacteria 21834
220 Ga0209025_1028925 3300025294 Bacteria 2698
221 Ga0209564_1000136 3300025295 Bacteria 185198
222 Ga0209758_1002351 3300025297 Bacteria 19494
223 Ga0209256_1011882 3300025299 Bacteria 3417
224 Ga0207656_10073068 3300025321 Bacteria 1528
225 Ga0207656_10078945 3300025321 Bacteria 1476
226 Ga0207656_10094744 3300025321 Bacteria 1360
227 Ga0207655_1003776 3300025728 Bacteria 11096
228 Ga0207682_10002457 3300025893 Bacteria 8294
229 Ga0207682_10006893 3300025893 Bacteria 4558
230 Ga0207642_10014171 3300025899 Bacteria 2933
231 Ga0207642_10237851 3300025899 Bacteria 1027
232 Ga0207688_10057426 3300025901 Bacteria 2188
233 Ga0207688_10197644 3300025901 Bacteria 1205
234 Ga0207680_10001975 3300025903 Bacteria 9595
235 Ga0207680_10021042 3300025903 Bacteria 3523
236 Ga0207647_10094228 3300025904 Bacteria 1784
237 Ga0207645_10000826 3300025907 Bacteria 25958
238 Ga0207645_10005745 3300025907 Bacteria 8953
239 Ga0207645_10015239 3300025907 Bacteria 5117
240 Ga0207645_10027960 3300025907 Bacteria 3640
241 Ga0207645_10044329 3300025907 Bacteria 2846
242 Ga0207643_10003681 3300025908 Bacteria 8254
243 Ga0207643_10035911 3300025908 Bacteria 2780
244 Ga0207684_10005490 3300025910 Bacteria 11680
245 Ga0207671_10035824 3300025914 Bacteria 3680
246 Ga0207649_10017203 3300025920 Bacteria 4096
247 Ga0207681_10110758 3300025923 Bacteria 1996
248 Ga0207681_10128608 3300025923 Bacteria 1869
249 Ga0207681_10379900 3300025923 Bacteria 1137
250 Ga0207694_10277186 3300025924 Bacteria 1377
251 Ga0207650_10060178 3300025925 Bacteria 2834
252 Ga0207650_10063987 3300025925 Bacteria 2752
253 Ga0207659_10001543 3300025926 Bacteria 13671
254 Ga0207659_10005705 3300025926 Bacteria 7579
255 Ga0207659_10022475 3300025926 Bacteria 4200
256 Ga0207687_10359340 3300025927 Bacteria 1188
257 Ga0207700_10000778 3300025928 Bacteria 18406
258 Ga0207644_10016181 3300025931 Bacteria 5018
259 Ga0207644_10019721 3300025931 Bacteria 4578
260 Ga0207644_10026660 3300025931 Bacteria 3985
261 Ga0207644_10076898 3300025931 Bacteria 2457
262 Ga0207644_10278898 3300025931 Bacteria 1341
263 Ga0207644_10311044 3300025931 Bacteria 1272
264 Ga0207706_10003957 3300025933 Bacteria 14039
265 Ga0207706_10012395 3300025933 Bacteria 7766
266 Ga0207706_10350869 3300025933 Bacteria 1283
267 Ga0207706_10405561 3300025933 Bacteria 1181
268 Ga0207686_10019645 3300025934 Bacteria 3846
269 Ga0207686_10134261 3300025934 Bacteria 1701
270 Ga0207709_10004788 3300025935 Bacteria 7757
271 Ga0207709_10027761 3300025935 Bacteria 3265
272 Ga0207669_10000571 3300025937 Bacteria 16059
273 Ga0207669_10070304 3300025937 Bacteria 2194
274 Ga0207669_10131755 3300025937 Bacteria 1719
275 Ga0207669_10407884 3300025937 Unclassified 1066
276 Ga0207704_10017603 3300025938 Bacteria 3710
277 Ga0207704_10186501 3300025938 Bacteria 1504
278 Ga0207691_10003141 3300025940 Bacteria 16144
279 Ga0207691_10004497 3300025940 Bacteria 13499
280 Ga0207691_10056580 3300025940 Bacteria 3572
281 Ga0207691_10124646 3300025940 Bacteria 2280
282 Ga0207691_10145528 3300025940 Bacteria 2086
283 Ga0207691_10154746 3300025940 Bacteria 2014
284 Ga0207691_10445463 3300025940 Bacteria 1102
285 Ga0207711_10024344 3300025941 Bacteria 5071
286 Ga0207711_10044869 3300025941 Bacteria 3775
287 Ga0207711_10049221 3300025941 Bacteria 3608
288 Ga0207711_10055944 3300025941 Bacteria 3388
289 Ga0207711_10162989 3300025941 Bacteria 2019
290 Ga0207689_10002401 3300025942 Bacteria 17436
291 Ga0207689_10021604 3300025942 Bacteria 5411
292 Ga0207689_10024922 3300025942 Bacteria 5014
293 Ga0207667_10232038 3300025949 Bacteria 1889
294 Ga0207651_10001433 3300025960 Bacteria 10856
295 Ga0207651_10006294 3300025960 Bacteria 6192
296 Ga0207651_10014813 3300025960 Bacteria 4513
297 Ga0207651_10032669 3300025960 Bacteria 3346
298 Ga0207651_10667700 3300025960 Bacteria 913
299 Ga0207712_10043545 3300025961 Bacteria 3097
300 Ga0207668_10056325 3300025972 Bacteria 2737
301 Ga0207668_10124052 3300025972 Bacteria 1960
302 Ga0207640_10017275 3300025981 Bacteria 4219
303 Ga0207640_10048699 3300025981 Bacteria 2741
304 Ga0207658_10014296 3300025986 Bacteria 5435
305 Ga0207658_10057630 3300025986 Bacteria 2888
306 Ga0207658_10058550 3300025986 Bacteria 2867
307 Ga0207658_10083324 3300025986 Bacteria 2457
308 Ga0207658_10346605 3300025986 Bacteria 1292
309 Ga0207677_10005265 3300026023 Bacteria 7007
310 Ga0207677_10102412 3300026023 Bacteria 2111
311 Ga0207677_10152915 3300026023 Bacteria 1783
312 Ga0207677_10239203 3300026023 Bacteria 1468
313 Ga0207703_10003506 3300026035 Bacteria 13120
314 Ga0207703_10041497 3300026035 Bacteria 3687
315 Ga0207639_10045975 3300026041 Bacteria 3291
316 Ga0207639_10130971 3300026041 Bacteria 2076
317 Ga0207639_10175738 3300026041 Bacteria 1818
318 Ga0207678_10043836 3300026067 Bacteria 3870
319 Ga0207678_10059048 3300026067 Bacteria 3300
320 Ga0207678_10110370 3300026067 Bacteria 2347
321 Ga0207678_10161850 3300026067 Bacteria 1911
322 Ga0207678_10166101 3300026067 Bacteria 1884
323 Ga0207708_10257034 3300026075 Bacteria 1409
324 Ga0207641_10006666 3300026088 Bacteria 9694
325 Ga0207641_10027261 3300026088 Bacteria 4718
326 Ga0207641_10055436 3300026088 Bacteria 3366
327 Ga0207641_10093075 3300026088 Bacteria 2641
328 Ga0207641_10093365 3300026088 Bacteria 2637
329 Ga0207641_10147091 3300026088 Bacteria 2131
330 Ga0207641_10237618 3300026088 Bacteria 1696
331 Ga0207648_10016057 3300026089 Bacteria 6860
332 Ga0207648_10028845 3300026089 Bacteria 4918
333 Ga0207648_10139034 3300026089 Bacteria 2140
334 Ga0207648_10370673 3300026089 Bacteria 1293
335 Ga0207676_10007619 3300026095 Bacteria 7687
336 Ga0207676_10093925 3300026095 Bacteria 2470
337 Ga0207676_10100612 3300026095 Bacteria 2395
338 Ga0207676_10125177 3300026095 Bacteria 2175
339 Ga0207676_10615710 3300026095 Bacteria 1044
340 Ga0207674_10016125 3300026116 Bacteria 8186
341 Ga0207674_10024347 3300026116 Bacteria 6471
342 Ga0207674_10110706 3300026116 Bacteria 2721
343 Ga0207675_100015712 3300026118 Bacteria 7060
344 Ga0207675_100046909 3300026118 Bacteria 4036
345 Ga0207683_10000463 3300026121 Bacteria 37729
346 Ga0207683_10019843 3300026121 Bacteria 5742
347 Ga0207683_10040790 3300026121 Bacteria 4053
348 Ga0207683_10089894 3300026121 Bacteria 2734
349 Ga0207683_10120320 3300026121 Bacteria 2357
350 Ga0207683_10523927 3300026121 Bacteria 1095
351 Ga0207698_10009889 3300026142 Bacteria 6099
352 Ga0207698_10020872 3300026142 Bacteria 4519
353 Ga0207698_10079337 3300026142 Bacteria 2640
354 Ga0207698_10354818 3300026142 Bacteria 1386
355 Ga0207698_10468585 3300026142 Bacteria 1219
356 Ga0209282_1063854 3300027666 Bacteria 2039
357 Ga0268266_10011978 3300028379 Bacteria 7507
358 Ga0268266_10043800 3300028379 Bacteria 3825
359 Ga0268266_10111513 3300028379 Bacteria 2424
360 Ga0268266_10178681 3300028379 Bacteria 1931
361 Ga0268266_10188566 3300028379 Bacteria 1882
362 Ga0268265_10124179 3300028380 Bacteria 2133
363 Ga0268265_10165258 3300028380 Bacteria 1885
364 Ga0268265_10204212 3300028380 Bacteria 1716
365 Ga0268265_10535364 3300028380 Bacteria 1110
366 Ga0268264_10347615 3300028381 Bacteria 1410
367 Ga0268264_10497527 3300028381 Bacteria 1188
368 Ga0265324_10058861 3300029957 Bacteria 1314
369 Ga0265331_10000584 3300031250 Bacteria 32625
370 Ga0265327_10000120 3300031251 Bacteria 171108
371 Ga0307513_10039048 3300031456 Bacteria 5265
372 Ga0307513_10242931 3300031456 Bacteria 1604
373 Ga0307509_10067401 3300031507 Bacteria 3750
374 Ga0307408_100003655 3300031548 Bacteria 10482
375 Ga0307408_100196958 3300031548 Bacteria 1627
376 Ga0307516_10076654 3300031730 Bacteria 3195
377 Ga0307405_10013385 3300031731 Bacteria 4373
378 Ga0307410_10005131 3300031852 Bacteria 6884
379 Ga0307406_10004975 3300031901 Bacteria 7241
380 Ga0307406_10156807 3300031901 Bacteria 1631
381 Ga0307407_10007138 3300031903 Bacteria 5036
382 Ga0307412_10007226 3300031911 Bacteria 6299
383 Ga0307412_10105903 3300031911 Bacteria 1998
384 Ga0307409_100220337 3300031995 Bacteria 1712
385 Ga0307416_100054608 3300032002 Bacteria 3212
386 Ga0307416_100112690 3300032002 Bacteria 2401
387 Ga0307414_10011995 3300032004 Bacteria 5109
388 Ga0307411_10038023 3300032005 Bacteria 3031
389 Ga0307415_100077455 3300032126 Bacteria 2361
390 Ga0373946_0200221 3300035171 Bacteria 956
391 Ga0373935_0248656 3300035692 Bacteria 1244
392 Ga0373937_0176620 3300036401 Bacteria 2005
393 Ga0373925_0157029 3300037068 Bacteria 1790
394 Ga0395905_0045696 3300037471 Bacteria 4107
395 Ga0439436_0000092 3300041404 Bacteria 21425
396 Ga0439436_0000765 3300041404 Bacteria 8700
397 Ga0439436_0002159 3300041404 Bacteria 5882
398 Ga0439436_0041210 3300041404 Bacteria 1322
399 Ga0439439_0000021 3300041406 Bacteria 22666
400 Ga0439447_002462 3300041407 Bacteria 6737
401 Ga0439466_0004033 3300041411 Bacteria 5668
402 Ga0439466_0046235 3300041411 Bacteria 1438
403 Ga0439466_0048803 3300041411 Bacteria 1391
404 Ga0439465_0011337 3300041413 Bacteria 2797
405 Ga0439465_0037369 3300041413 Bacteria 1561
406 Ga0451853_1576222 3300041512 Bacteria 1815
407 Ga0439431_0011132 3300041997 Bacteria 2051
408 Ga0439431_0057859 3300041997 Bacteria 1015
409 Ga0439433_0000171 3300041999 Bacteria 10131
410 Ga0439442_001937 3300042002 Bacteria 4067
411 Ga0439442_005458 3300042002 Bacteria 2543
412 Ga0439445_0003359 3300042004 Bacteria 3590
413 Ga0439445_0022658 3300042004 Bacteria 1585
414 Ga0439445_0030789 3300042004 Bacteria 1392
415 Ga0439432_000936 3300042006 Bacteria 10984
416 Ga0439449_0000003 3300042007 Bacteria 94735
417 Ga0439449_0002393 3300042007 Bacteria 7339
418 Ga0439449_0004373 3300042007 Bacteria 5452
419 Ga0439449_0011900 3300042007 Bacteria 3271
420 Ga0439452_001024 3300042010 Bacteria 12386
421 Ga0439452_001607 3300042010 Bacteria 8928
422 Ga0439452_020073 3300042010 Bacteria 1757
423 Ga0439457_008629 3300042014 Bacteria 2396
424 Ga0439462_0000090 3300042015 Bacteria 14033
425 Ga0439462_0002699 3300042015 Bacteria 4167
426 Ga0439462_0002999 3300042015 Bacteria 4008
427 Ga0439462_0015039 3300042015 Bacteria 1991
428 Ga0450911_000447 3300042115 Bacteria 13425
429 Ga0450919_000220 3300042121 Bacteria 6343
430 Ga0450890_006694 3300042127 Bacteria 1473
431 Ga0450897_001318 3300042128 Bacteria 1667
432 Ga0450897_001755 3300042128 Bacteria 1527
433 Ga0450898_000619 3300042134 Bacteria 4265
434 Ga0450906_007321 3300042145 Bacteria 2183
435 Ga0450906_011701 3300042145 Bacteria 1637
436 Ga0450910_030711 3300042147 Bacteria 843
437 Ga0439446_0009526 3300042156 Bacteria 2602
438 Ga0439446_0018809 3300042156 Bacteria 1939
439 Ga0439458_0048445 3300042157 Bacteria 1045
440 Ga0450908_009765 3300042184 Bacteria 1778
441 Ga0439434_0000809 3300042435 Bacteria 9017
442 Ga0439434_0001183 3300042435 Bacteria 7512
443 Ga0439434_0009002 3300042435 Bacteria 2934
444 Ga0439434_0015535 3300042435 Bacteria 2271
445 Ga0439434_0020902 3300042435 Bacteria 1966
446 Ga0439464_0014721 3300042439 Bacteria 2106
447 Ga0450918_000061 3300042531 Bacteria 21919
448 Ga0450918_000214 3300042531 Bacteria 13184
449 Ga0451577_0012006 3300042876 Bacteria 8156
450 Ga0453684_0000789 3300044712 Bacteria 108459
451 Ga0451576_0004381 3300045051 Bacteria 18394
452 Ga0495651_0086582 3300046462 Bacteria 2357
453 Ga0495650_0005268 3300046471 Bacteria 8469
454 Ga0495650_0005465 3300046471 Bacteria 8243
455 Ga0495580_0016185 3300046472 Bacteria 5604
456 Ga0495639_0094652 3300046475 Bacteria 1405
457 Ga0495594_0025711 3300046499 Bacteria 3165
458 Ga0495643_0031229 3300046522 Bacteria 2966
459 Ga0495666_0037981 3300046526 Bacteria 2342
460 Ga0495642_0157473 3300046528 Bacteria 984
461 Ga0495665_0006189 3300046531 Bacteria 6465
462 Ga0495645_0148836 3300046543 Bacteria 1628
463 Ga0495622_0069399 3300046557 Bacteria 1627
464 Ga0495656_0006776 3300046615 Bacteria 4026
465 Ga0495656_0031968 3300046615 Bacteria 2138
466 Ga0495588_0037506 3300046674 Bacteria 2463
467 Ga0495646_0135380 3300046680 Bacteria 1383
468 Ga0495658_0191077 3300046683 Bacteria 1273
469 Ga0495624_0023189 3300046690 Bacteria 4094
470 Ga0495600_0247320 3300046809 Bacteria 1135
471 Ga0495604_0028126 3300047317 Bacteria 4472
472 Ga0495636_0000270 3300047318 Bacteria 20561
473 Ga0495685_089973 3300047447 Bacteria 1018
474 Ga0495681_0085685 3300047470 Bacteria 1399
475 Ga0495684_0143418 3300047471 Bacteria 1790
476 Ga0496101_0275266 3300048904 Bacteria 1315
477 Ga0496102_0000852 3300048905 Bacteria 29264
478 Ga0496104_0029371 3300048907 Bacteria 5099
479 Ga0496104_0101152 3300048907 Bacteria 2759
480 Ga0496105_0018628 3300048908 Bacteria 5587
481 Ga0496107_0111136 3300048910 Bacteria 2014
482 Ga0496107_0322247 3300048910 Bacteria 1150
483 Ga0496108_0099726 3300048911 Bacteria 2476
484 Ga0496108_0205535 3300048911 Bacteria 1709
485 Ga0496108_0386989 3300048911 Bacteria 1221
486 Ga0496108_0437499 3300048911 Bacteria 1142
487 Ga0496108_0496341 3300048911 Bacteria 1066
488 Ga0496109_0052712 3300048912 Bacteria 3709
489 Ga0496109_0061321 3300048912 Bacteria 3438
490 Ga0496109_0247320 3300048912 Bacteria 1679
491 Ga0496109_0418496 3300048912 Bacteria 1266
492 Ga0496110_0007171 3300048913 Bacteria 8876
493 Ga0496110_0173544 3300048913 Bacteria 1956
494 Ga0496110_0422115 3300048913 Bacteria 1216
495 Ga0496110_0542452 3300048913 Bacteria 1057
496 Ga0496112_0002412 3300048915 Bacteria 15055
497 Ga0496112_0009210 3300048915 Bacteria 8874
498 Ga0496112_0184411 3300048915 Bacteria 2050
499 Ga0496112_0288970 3300048915 Bacteria 1586
500 Ga0496114_0366136 3300048917 Bacteria 1275
501 Ga0496116_0074533 3300048919 Bacteria 2134
502 Ga0496118_0022943 3300048921 Bacteria 5437
503 Ga0496119_0192756 3300048922 Bacteria 1061
504 Ga0496121_0021940 3300048924 Bacteria 6228
505 Ga0496121_0055111 3300048924 Bacteria 3315
506 Ga0496122_0177168 3300048925 Bacteria 1277
507 Ga0496125_0048389 3300048928 Bacteria 3547
508 Ga0496126_0065880 3300048929 Bacteria 3240
509 Ga0501031_0035945 3300049568 Bacteria 3231
510 Ga0501032_0007274 3300049569 Bacteria 8099
511 Ga0501033_0001305 3300049570 Bacteria 22157
512 Ga0501037_0001243 3300049573 Bacteria 18791
513 Ga0501043_0000003 3300049579 Bacteria 318844
514 Ga0501068_0018987 3300049584 Bacteria 3985
515 Ga0501069_0000263 3300049585 Bacteria 23824
516 Ga0501070_0000774 3300049586 Bacteria 29131
517 Ga0501071_0035556 3300049587 Bacteria 3548
518 Ga0501073_0045197 3300049589 Bacteria 3102
519 Ga0501074_0000565 3300049590 Bacteria 22957
520 Ga0501198_000027 3300049649 Bacteria 65442
521 Ga0501222_000026 3300049662 Bacteria 63988
522 Ga0501080_0000071 3300049742 Bacteria 67464
523 Ga0501083_0000083 3300049744 Bacteria 63951
524 Ga0501035_0000083 3300049822 Bacteria 117302
525 Ga0501035_0042879 3300049822 Bacteria 4079
526 Ga0501044_0003070 3300049823 Bacteria 18892
527 nmdc:mga03683_24673_c1 3300050489 Bacteria 2355
528 nmdc:mga03n38_44918_c1 3300050490 Bacteria 1943
529 nmdc:mga0k408_120936_c1 3300050493 Bacteria 1551
530 nmdc:mga0k408_132771_c1 3300050493 Bacteria 1478
531 nmdc:mga0k408_178330_c1 3300050493 Bacteria 1267
532 nmdc:mga0k408_24016_c1 3300050493 Bacteria 3443
533 nmdc:mga0k408_32418_c1 3300050493 Bacteria 2985
534 nmdc:mga0k408_986_c1 3300050493 Bacteria 15635
535 nmdc:mga06z11_15689_c1 3300050494 Bacteria 3388
536 nmdc:mga06z11_89443_c1 3300050494 Bacteria 1669
537 nmdc:mga07m45_10533_c2 3300050496 Bacteria 2302
538 nmdc:mga07m45_116355_c1 3300050496 Bacteria 1542
539 nmdc:mga07m45_14972_c1 3300050496 Bacteria 4140
540 nmdc:mga07m45_1838_c1 3300050496 Bacteria 9802
541 nmdc:mga07m45_3092_c1 3300050496 Bacteria 7957
542 nmdc:mga07m45_5811_c1 3300050496 Bacteria 6184
543 nmdc:mga07m45_79596_c1 3300050496 Bacteria 1871
544 nmdc:mga09592_1513_c1 3300050508 Bacteria 18722
545 nmdc:mga09592_50340_c1 3300050508 Bacteria 3514
546 nmdc:mga0qj67_142385_c1 3300050509 Bacteria 1944
547 Ga0495595_0073826 3300053084 Bacteria 1616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025899 Ga0207642_10237851 Ga0207642_102378512 243
2 3300042147 Ga0450910_030711 Ga0450910_030711_53_826 247
3 3300042007 Ga0439449_0011900 Ga0439449_0011900_2035_2916 255
4 3300042015 Ga0439462_0015039 Ga0439462_0015039_327_1208 255
5 3300013297 Ga0157378_10073491 Ga0157378_100734911 258
6 3300031250 Ga0265331_10000584 Ga0265331_1000058432 258
7 3300031251 Ga0265327_10000120 Ga0265327_1000012048 258
8 3300048910 Ga0496107_0111136 Ga0496107_0111136_1180_1989 259
9 3300049568 Ga0501031_0035945 Ga0501031_0035945_545_1390 259
10 3300049569 Ga0501032_0007274 Ga0501032_0007274_4313_5158 259
11 3300049570 Ga0501033_0001305 Ga0501033_0001305_16152_16997 259
12 3300049573 Ga0501037_0001243 Ga0501037_0001243_4610_5455 259
13 3300049579 Ga0501043_0000003 Ga0501043_0000003_228756_229601 259
14 3300049585 Ga0501069_0000263 Ga0501069_0000263_18178_19023 259
15 3300049586 Ga0501070_0000774 Ga0501070_0000774_5152_5997 259
16 3300049587 Ga0501071_0035556 Ga0501071_0035556_2563_3408 259
17 3300049589 Ga0501073_0045197 Ga0501073_0045197_1548_2393 259
18 3300049590 Ga0501074_0000565 Ga0501074_0000565_16971_17816 259
19 3300049742 Ga0501080_0000071 Ga0501080_0000071_4586_5431 259
20 3300049744 Ga0501083_0000083 Ga0501083_0000083_4712_5557 259
21 3300049822 Ga0501035_0000083 Ga0501035_0000083_4780_5625 259
22 3300049823 Ga0501044_0003070 Ga0501044_0003070_12824_13669 259
23 3300009098 Ga0105245_10585136 Ga0105245_105851361 261
24 3300005548 Ga0070665_100194216 Ga0070665_1001942162 263
25 3300005578 Ga0068854_100174439 Ga0068854_1001744391 263
26 3300005718 Ga0068866_10045628 Ga0068866_100456281 263
27 3300005842 Ga0068858_100218660 Ga0068858_1002186602 263
28 3300009148 Ga0105243_10567456 Ga0105243_105674561 263
29 3300013296 Ga0157374_10740824 Ga0157374_107408242 263
30 3300013308 Ga0157375_10018251 Ga0157375_100182515 263
31 3300025937 Ga0207669_10407884 Ga0207669_104078841 263
32 3300026075 Ga0207708_10257034 Ga0207708_102570341 263
33 3300005441 Ga0070700_100296782 Ga0070700_1002967822 265
34 3300009545 Ga0105237_10162135 Ga0105237_101621353 266
35 3300014968 Ga0157379_10282418 Ga0157379_102824182 266
36 3300031507 Ga0307509_10067401 Ga0307509_100674013 267
37 3300005548 Ga0070665_100016303 Ga0070665_1000163034 269
38 3300009177 Ga0105248_10303353 Ga0105248_103033532 269
39 3300028379 Ga0268266_10043800 Ga0268266_100438004 269
40 3300031456 Ga0307513_10242931 Ga0307513_102429312 269
41 3300050493 nmdc:mga0k408_120936_c1 nmdc:mga0k408_120936_c1_99_938 269
42 3300005440 Ga0070705_100378387 Ga0070705_1003783871 270
43 3300009545 Ga0105237_10228775 Ga0105237_102287751 270
44 3300026116 Ga0207674_10110706 Ga0207674_101107062 270
45 3300045051 Ga0451576_0004381 Ga0451576_0004381_10570_11412 270
46 3300005366 Ga0070659_100178861 Ga0070659_1001788612 271
47 3300005457 Ga0070662_100012076 Ga0070662_1000120764 271
48 3300005539 Ga0068853_100250042 Ga0068853_1002500422 271
49 3300005563 Ga0068855_100216125 Ga0068855_1002161254 271
50 3300005577 Ga0068857_100056586 Ga0068857_1000565861 271
51 3300005578 Ga0068854_100065746 Ga0068854_1000657462 271
52 3300005616 Ga0068852_100148541 Ga0068852_1001485412 271
53 3300006358 Ga0068871_100320893 Ga0068871_1003208932 271
54 3300009148 Ga0105243_10045820 Ga0105243_100458201 271
55 3300009174 Ga0105241_10270527 Ga0105241_102705272 271
56 3300010375 Ga0105239_10142125 Ga0105239_101421252 271
57 3300013100 Ga0157373_10018374 Ga0157373_100183742 271
58 3300013104 Ga0157370_10008352 Ga0157370_100083526 271
59 3300014969 Ga0157376_10293402 Ga0157376_102934022 271
60 3300025728 Ga0207655_1003776 Ga0207655_10037767 271
61 3300025904 Ga0207647_10094228 Ga0207647_100942282 271
62 3300025935 Ga0207709_10004788 Ga0207709_100047886 271
63 3300025949 Ga0207667_10232038 Ga0207667_102320382 271
64 3300026041 Ga0207639_10175738 Ga0207639_101757382 271
65 3300026067 Ga0207678_10161850 Ga0207678_101618502 271
66 3300026116 Ga0207674_10016125 Ga0207674_100161258 271
67 3300026142 Ga0207698_10468585 Ga0207698_104685851 271
68 3300031731 Ga0307405_10013385 Ga0307405_100133855 271
69 3300031901 Ga0307406_10156807 Ga0307406_101568072 271
70 3300032004 Ga0307414_10011995 Ga0307414_100119953 271
71 3300042004 Ga0439445_0022658 Ga0439445_0022658_19_888 271
72 3300042115 Ga0450911_000447 Ga0450911_000447_4554_5423 271
73 3300048919 Ga0496116_0074533 Ga0496116_0074533_620_1480 271
74 3300048921 Ga0496118_0022943 Ga0496118_0022943_1824_2684 271
75 3300048922 Ga0496119_0192756 Ga0496119_0192756_89_949 271
76 3300048924 Ga0496121_0055111 Ga0496121_0055111_657_1517 271
77 3300048925 Ga0496122_0177168 Ga0496122_0177168_291_1151 271
78 3300050496 nmdc:mga07m45_3092_c1 nmdc:mga07m45_3092_c1_6097_6957 271
79 iso_pu_bacteria 2585428058 2587732818 271
80 iso_pu_bacteria 2939631187 2939632935 271
81 3300005328 Ga0070676_10116429 Ga0070676_101164292 272
82 3300005331 Ga0070670_100645231 Ga0070670_1006452311 272
83 3300005355 Ga0070671_100081834 Ga0070671_1000818343 272
84 3300005459 Ga0068867_100285587 Ga0068867_1002855871 272
85 3300013297 Ga0157378_10302885 Ga0157378_103028852 272
86 3300025901 Ga0207688_10197644 Ga0207688_101976442 272
87 3300025907 Ga0207645_10044329 Ga0207645_100443292 272
88 3300025931 Ga0207644_10076898 Ga0207644_100768982 272
89 3300025937 Ga0207669_10131755 Ga0207669_101317552 272
90 3300026089 Ga0207648_10139034 Ga0207648_101390342 272
91 3300028379 Ga0268266_10111513 Ga0268266_101115132 272
92 3300031852 Ga0307410_10005131 Ga0307410_100051315 272
93 3300031901 Ga0307406_10004975 Ga0307406_100049752 272
94 3300031903 Ga0307407_10007138 Ga0307407_100071385 272
95 3300031911 Ga0307412_10007226 Ga0307412_100072262 272
96 3300031995 Ga0307409_100220337 Ga0307409_1002203372 272
97 3300032002 Ga0307416_100054608 Ga0307416_1000546082 272
98 3300032005 Ga0307411_10038023 Ga0307411_100380232 272
99 3300032126 Ga0307415_100077455 Ga0307415_1000774552 272
100 3300042157 Ga0439458_0048445 Ga0439458_0048445_12_905 272
101 iso_pu_bacteria 2643221628 2644159196 272
102 iso_pu_bacteria 2643221644 2644245275 272
103 iso_pu_bacteria 2643221672 2644401370 272
104 iso_pu_bacteria 2881101125 2881101528 272
105 iso_pu_bacteria 2904449895 2904450026 272
106 iso_pu_bacteria 2904456579 2904457158 272
107 3300006195 Ga0075366_10108795 Ga0075366_101087952 273
108 3300042015 Ga0439462_0002999 Ga0439462_0002999_920_1771 273
109 3300049584 Ga0501068_0018987 Ga0501068_0018987_2657_3511 273
110 3300044712 Ga0453684_0000789 Ga0453684_0000789_61007_61933 274
111 3300005338 Ga0068868_100136762 Ga0068868_1001367622 275
112 3300005456 Ga0070678_100122902 Ga0070678_1001229022 275
113 3300006048 Ga0075363_100024634 Ga0075363_1000246342 275
114 3300006195 Ga0075366_10006457 Ga0075366_100064575 275
115 3300006846 Ga0075430_100097174 Ga0075430_1000971742 275
116 3300025294 Ga0209025_1028925 Ga0209025_10289253 275
117 3300028379 Ga0268266_10178681 Ga0268266_101786813 275
118 3300035171 Ga0373946_0200221 Ga0373946_0200221_78_935 275
119 3300042876 Ga0451577_0012006 Ga0451577_0012006_1364_2224 275
120 3300046471 Ga0495650_0005268 Ga0495650_0005268_7371_8228 275
121 3300046522 Ga0495643_0031229 Ga0495643_0031229_1962_2819 275
122 3300046557 Ga0495622_0069399 Ga0495622_0069399_538_1395 275
123 3300048924 Ga0496121_0021940 Ga0496121_0021940_2767_3630 275
124 3300048928 Ga0496125_0048389 Ga0496125_0048389_1789_2658 275
125 3300048929 Ga0496126_0065880 Ga0496126_0065880_445_1314 275
126 3300050490 nmdc:mga03n38_44918_c1 nmdc:mga03n38_44918_c1_183_1235 275
127 3300050493 nmdc:mga0k408_32418_c1 nmdc:mga0k408_32418_c1_1064_2116 275
128 3300050496 nmdc:mga07m45_116355_c1 nmdc:mga07m45_116355_c1_290_1198 275
129 3300050496 nmdc:mga07m45_79596_c1 nmdc:mga07m45_79596_c1_424_1476 275
130 3300050509 nmdc:mga0qj67_142385_c1 nmdc:mga0qj67_142385_c1_119_988 275
131 iso_pu_bacteria 2524023205 2524443366 275
132 iso_pu_bacteria 2728368998 2728754106 275
133 iso_pu_bacteria 2744054633 2745075627 275
134 iso_pu_bacteria 2900634093 2900641829 275
135 3300002773 JGI25152J39213_1001278 JGI25152J39213_10012789 276
136 3300003187 JGI25151J46595_10003564 JGI25151J46595_100035646 276
137 3300003215 JGI25153J46596_10001018 JGI25153J46596_1000101810 276
138 3300003771 Ga0055526_1001244 Ga0055526_100124410 276
139 3300005328 Ga0070676_10001656 Ga0070676_100016569 276
140 3300005328 Ga0070676_10010396 Ga0070676_100103963 276
141 3300005328 Ga0070676_10120746 Ga0070676_101207462 276
142 3300005330 Ga0070690_100021694 Ga0070690_1000216942 276
143 3300005330 Ga0070690_100036267 Ga0070690_1000362672 276
144 3300005331 Ga0070670_100061134 Ga0070670_1000611342 276
145 3300005331 Ga0070670_100126338 Ga0070670_1001263382 276
146 3300005331 Ga0070670_100131895 Ga0070670_1001318952 276
147 3300005331 Ga0070670_100160325 Ga0070670_1001603252 276
148 3300005331 Ga0070670_100283584 Ga0070670_1002835842 276
149 3300005331 Ga0070670_100405162 Ga0070670_1004051622 276
150 3300005333 Ga0070677_10010100 Ga0070677_100101002 276
151 3300005333 Ga0070677_10022039 Ga0070677_100220392 276
152 3300005334 Ga0068869_100015211 Ga0068869_1000152112 276
153 3300005334 Ga0068869_100043324 Ga0068869_1000433244 276
154 3300005335 Ga0070666_10002356 Ga0070666_100023567 276
155 3300005335 Ga0070666_10015312 Ga0070666_100153123 276
156 3300005335 Ga0070666_10029851 Ga0070666_100298513 276
157 3300005335 Ga0070666_10073615 Ga0070666_100736152 276
158 3300005338 Ga0068868_100004021 Ga0068868_1000040217 276
159 3300005338 Ga0068868_100015163 Ga0068868_1000151631 276
160 3300005338 Ga0068868_100264170 Ga0068868_1002641702 276
161 3300005338 Ga0068868_100411940 Ga0068868_1004119401 276
162 3300005340 Ga0070689_100016060 Ga0070689_1000160604 276
163 3300005340 Ga0070689_100394356 Ga0070689_1003943562 276
164 3300005343 Ga0070687_100003277 Ga0070687_1000032772 276
165 3300005344 Ga0070661_100007761 Ga0070661_10000776110 276
166 3300005344 Ga0070661_100233393 Ga0070661_1002333931 276
167 3300005344 Ga0070661_100469664 Ga0070661_1004696641 276
168 3300005347 Ga0070668_100002946 Ga0070668_1000029468 276
169 3300005353 Ga0070669_100064434 Ga0070669_1000644342 276
170 3300005353 Ga0070669_100107577 Ga0070669_1001075772 276
171 3300005354 Ga0070675_100008803 Ga0070675_1000088034 276
172 3300005354 Ga0070675_100079934 Ga0070675_1000799343 276
173 3300005354 Ga0070675_100112092 Ga0070675_1001120922 276
174 3300005354 Ga0070675_100207205 Ga0070675_1002072052 276
175 3300005355 Ga0070671_100000534 Ga0070671_10000053416 276
176 3300005355 Ga0070671_100001751 Ga0070671_10000175111 276
177 3300005355 Ga0070671_100004653 Ga0070671_1000046538 276
178 3300005355 Ga0070671_100009290 Ga0070671_1000092904 276
179 3300005355 Ga0070671_100175961 Ga0070671_1001759611 276
180 3300005356 Ga0070674_100004521 Ga0070674_1000045218 276
181 3300005364 Ga0070673_100003867 Ga0070673_1000038675 276
182 3300005364 Ga0070673_100011490 Ga0070673_1000114902 276
183 3300005364 Ga0070673_100323417 Ga0070673_1003234172 276
184 3300005365 Ga0070688_100101391 Ga0070688_1001013912 276
185 3300005366 Ga0070659_100448678 Ga0070659_1004486781 276
186 3300005367 Ga0070667_100272255 Ga0070667_1002722552 276
187 3300005367 Ga0070667_100489373 Ga0070667_1004893731 276
188 3300005445 Ga0070708_100097203 Ga0070708_1000972033 276
189 3300005445 Ga0070708_100297401 Ga0070708_1002974012 276
190 3300005445 Ga0070708_100485915 Ga0070708_1004859151 276
191 3300005456 Ga0070678_100000398 Ga0070678_10000039813 276
192 3300005456 Ga0070678_100009895 Ga0070678_1000098954 276
193 3300005456 Ga0070678_100062895 Ga0070678_1000628952 276
194 3300005456 Ga0070678_100141001 Ga0070678_1001410012 276
195 3300005457 Ga0070662_100008969 Ga0070662_1000089693 276
196 3300005457 Ga0070662_100046524 Ga0070662_1000465242 276
197 3300005457 Ga0070662_100510467 Ga0070662_1005104671 276
198 3300005459 Ga0068867_100004355 Ga0068867_1000043558 276
199 3300005459 Ga0068867_100017384 Ga0068867_1000173842 276
200 3300005459 Ga0068867_100130031 Ga0068867_1001300312 276
201 3300005459 Ga0068867_100176986 Ga0068867_1001769861 276
202 3300005467 Ga0070706_100007532 Ga0070706_1000075324 276
203 3300005468 Ga0070707_100358842 Ga0070707_1003588422 276
204 3300005518 Ga0070699_100478102 Ga0070699_1004781022 276
205 3300005539 Ga0068853_100016921 Ga0068853_1000169212 276
206 3300005539 Ga0068853_100024284 Ga0068853_1000242842 276
207 3300005543 Ga0070672_100003734 Ga0070672_1000037343 276
208 3300005543 Ga0070672_100004240 Ga0070672_1000042401 276
209 3300005543 Ga0070672_100054960 Ga0070672_1000549602 276
210 3300005543 Ga0070672_100409990 Ga0070672_1004099902 276
211 3300005548 Ga0070665_100004618 Ga0070665_1000046188 276
212 3300005564 Ga0070664_100382730 Ga0070664_1003827302 276
213 3300005577 Ga0068857_100028905 Ga0068857_1000289054 276
214 3300005577 Ga0068857_100058719 Ga0068857_1000587193 276
215 3300005578 Ga0068854_100072859 Ga0068854_1000728592 276
216 3300005578 Ga0068854_100073459 Ga0068854_1000734592 276
217 3300005578 Ga0068854_100241109 Ga0068854_1002411091 276
218 3300005616 Ga0068852_100002662 Ga0068852_10000266211 276
219 3300005616 Ga0068852_100039777 Ga0068852_1000397772 276
220 3300005616 Ga0068852_100234058 Ga0068852_1002340582 276
221 3300005616 Ga0068852_100301682 Ga0068852_1003016822 276
222 3300005616 Ga0068852_100490102 Ga0068852_1004901022 276
223 3300005617 Ga0068859_100087895 Ga0068859_1000878952 276
224 3300005617 Ga0068859_100359453 Ga0068859_1003594532 276
225 3300005618 Ga0068864_100009957 Ga0068864_1000099574 276
226 3300005618 Ga0068864_100048639 Ga0068864_1000486392 276
227 3300005618 Ga0068864_100083208 Ga0068864_1000832083 276
228 3300005718 Ga0068866_10033634 Ga0068866_100336342 276
229 3300005719 Ga0068861_100048529 Ga0068861_1000485292 276
230 3300005719 Ga0068861_100204657 Ga0068861_1002046571 276
231 3300005834 Ga0068851_10095804 Ga0068851_100958042 276
232 3300005834 Ga0068851_10130710 Ga0068851_101307102 276
233 3300005834 Ga0068851_10130713 Ga0068851_101307132 276
234 3300005834 Ga0068851_10137060 Ga0068851_101370602 276
235 3300005840 Ga0068870_10022067 Ga0068870_100220672 276
236 3300005841 Ga0068863_100001931 Ga0068863_10000193110 276
237 3300005841 Ga0068863_100012511 Ga0068863_1000125114 276
238 3300005841 Ga0068863_100067113 Ga0068863_1000671133 276
239 3300005841 Ga0068863_100084529 Ga0068863_1000845292 276
240 3300005841 Ga0068863_100210912 Ga0068863_1002109121 276
241 3300005841 Ga0068863_100233499 Ga0068863_1002334992 276
242 3300005842 Ga0068858_100013092 Ga0068858_1000130924 276
243 3300005842 Ga0068858_100074254 Ga0068858_1000742542 276
244 3300005843 Ga0068860_100011527 Ga0068860_1000115272 276
245 3300005843 Ga0068860_100013623 Ga0068860_1000136234 276
246 3300005843 Ga0068860_100024666 Ga0068860_1000246662 276
247 3300005843 Ga0068860_100258039 Ga0068860_1002580392 276
248 3300005844 Ga0068862_100048424 Ga0068862_1000484243 276
249 3300005844 Ga0068862_100287658 Ga0068862_1002876582 276
250 3300006177 Ga0075362_10009683 Ga0075362_100096835 276
251 3300006177 Ga0075362_10013812 Ga0075362_100138123 276
252 3300006178 Ga0075367_10006462 Ga0075367_100064622 276
253 3300006178 Ga0075367_10094150 Ga0075367_100941502 276
254 3300006195 Ga0075366_10084447 Ga0075366_100844471 276
255 3300006195 Ga0075366_10098253 Ga0075366_100982532 276
256 3300006195 Ga0075366_10119299 Ga0075366_101192991 276
257 3300006237 Ga0097621_100023757 Ga0097621_1000237572 276
258 3300006237 Ga0097621_100384221 Ga0097621_1003842212 276
259 3300006237 Ga0097621_100545876 Ga0097621_1005458762 276
260 3300006237 Ga0097621_100667916 Ga0097621_1006679161 276
261 3300006353 Ga0075370_10005574 Ga0075370_100055743 276
262 3300006353 Ga0075370_10005601 Ga0075370_100056015 276
263 3300006358 Ga0068871_100020371 Ga0068871_1000203714 276
264 3300006358 Ga0068871_100141939 Ga0068871_1001419392 276
265 3300006358 Ga0068871_100578135 Ga0068871_1005781351 276
266 3300006846 Ga0075430_100053192 Ga0075430_1000531922 276
267 3300006880 Ga0075429_100000252 Ga0075429_1000002525 276
268 3300006880 Ga0075429_100001373 Ga0075429_1000013732 276
269 3300006881 Ga0068865_100100586 Ga0068865_1001005862 276
270 3300006931 Ga0097620_100087897 Ga0097620_1000878972 276
271 3300006931 Ga0097620_100359424 Ga0097620_1003594242 276
272 3300006948 Ga0099826_10006947 Ga0099826_100069477 276
273 3300009098 Ga0105245_10013791 Ga0105245_100137915 276
274 3300009098 Ga0105245_10223609 Ga0105245_102236092 276
275 3300009148 Ga0105243_10724162 Ga0105243_107241621 276
276 3300009176 Ga0105242_10096666 Ga0105242_100966662 276
277 3300009177 Ga0105248_10041700 Ga0105248_100417004 276
278 3300009177 Ga0105248_10093377 Ga0105248_100933772 276
279 3300009177 Ga0105248_10191457 Ga0105248_101914572 276
280 3300009177 Ga0105248_10364616 Ga0105248_103646162 276
281 3300009545 Ga0105237_10021948 Ga0105237_100219482 276
282 3300009545 Ga0105237_10072295 Ga0105237_100722952 276
283 3300009553 Ga0105249_10287445 Ga0105249_102874452 276
284 3300010375 Ga0105239_10139175 Ga0105239_101391752 276
285 3300013102 Ga0157371_10384322 Ga0157371_103843222 276
286 3300013297 Ga0157378_10031192 Ga0157378_100311924 276
287 3300013297 Ga0157378_10636974 Ga0157378_106369742 276
288 3300013306 Ga0163162_10003041 Ga0163162_1000304113 276
289 3300013306 Ga0163162_10026576 Ga0163162_100265764 276
290 3300013306 Ga0163162_10347520 Ga0163162_103475201 276
291 3300013306 Ga0163162_10428509 Ga0163162_104285092 276
292 3300013306 Ga0163162_10496963 Ga0163162_104969631 276
293 3300013306 Ga0163162_10500344 Ga0163162_105003442 276
294 3300013308 Ga0157375_10071975 Ga0157375_100719752 276
295 3300013308 Ga0157375_10639313 Ga0157375_106393132 276
296 3300013308 Ga0157375_10709841 Ga0157375_107098412 276
297 3300014326 Ga0157380_10122653 Ga0157380_101226532 276
298 3300014497 Ga0182008_10000821 Ga0182008_100008219 276
299 3300014745 Ga0157377_10144756 Ga0157377_101447562 276
300 3300014968 Ga0157379_10228061 Ga0157379_102280612 276
301 3300014968 Ga0157379_10448294 Ga0157379_104482942 276
302 3300014969 Ga0157376_10065565 Ga0157376_100655652 276
303 3300015262 Ga0182007_10001410 Ga0182007_100014108 276
304 3300015262 Ga0182007_10006552 Ga0182007_100065522 276
305 3300015683 Ga0183362_10001 Ga0183362_10001188 276
306 3300017792 Ga0163161_10000455 Ga0163161_1000045516 276
307 3300017792 Ga0163161_10059094 Ga0163161_100590942 276
308 3300017792 Ga0163161_10064797 Ga0163161_100647972 276
309 3300017792 Ga0163161_10244860 Ga0163161_102448602 276
310 3300025245 Ga0207425_1000710 Ga0207425_100071010 276
311 3300025258 Ga0209129_1000175 Ga0209129_10001759 276
312 3300025294 Ga0209025_1002169 Ga0209025_100216918 276
313 3300025295 Ga0209564_1000136 Ga0209564_1000136158 276
314 3300025297 Ga0209758_1002351 Ga0209758_100235110 276
315 3300025299 Ga0209256_1011882 Ga0209256_10118823 276
316 3300025321 Ga0207656_10073068 Ga0207656_100730682 276
317 3300025321 Ga0207656_10078945 Ga0207656_100789451 276
318 3300025321 Ga0207656_10094744 Ga0207656_100947442 276
319 3300025893 Ga0207682_10002457 Ga0207682_100024572 276
320 3300025893 Ga0207682_10006893 Ga0207682_100068933 276
321 3300025899 Ga0207642_10014171 Ga0207642_100141712 276
322 3300025901 Ga0207688_10057426 Ga0207688_100574262 276
323 3300025903 Ga0207680_10001975 Ga0207680_100019758 276
324 3300025903 Ga0207680_10021042 Ga0207680_100210422 276
325 3300025907 Ga0207645_10000826 Ga0207645_100008269 276
326 3300025907 Ga0207645_10005745 Ga0207645_100057454 276
327 3300025907 Ga0207645_10015239 Ga0207645_100152395 276
328 3300025907 Ga0207645_10027960 Ga0207645_100279602 276
329 3300025908 Ga0207643_10003681 Ga0207643_100036815 276
330 3300025908 Ga0207643_10035911 Ga0207643_100359112 276
331 3300025910 Ga0207684_10005490 Ga0207684_100054905 276
332 3300025914 Ga0207671_10035824 Ga0207671_100358242 276
333 3300025920 Ga0207649_10017203 Ga0207649_100172036 276
334 3300025923 Ga0207681_10110758 Ga0207681_101107582 276
335 3300025923 Ga0207681_10128608 Ga0207681_101286082 276
336 3300025923 Ga0207681_10379900 Ga0207681_103799001 276
337 3300025924 Ga0207694_10277186 Ga0207694_102771861 276
338 3300025925 Ga0207650_10060178 Ga0207650_100601782 276
339 3300025925 Ga0207650_10063987 Ga0207650_100639873 276
340 3300025926 Ga0207659_10001543 Ga0207659_100015437 276
341 3300025926 Ga0207659_10005705 Ga0207659_100057054 276
342 3300025926 Ga0207659_10022475 Ga0207659_100224754 276
343 3300025927 Ga0207687_10359340 Ga0207687_103593401 276
344 3300025928 Ga0207700_10000778 Ga0207700_100007789 276
345 3300025931 Ga0207644_10016181 Ga0207644_100161812 276
346 3300025931 Ga0207644_10019721 Ga0207644_100197211 276
347 3300025931 Ga0207644_10026660 Ga0207644_100266604 276
348 3300025931 Ga0207644_10278898 Ga0207644_102788982 276
349 3300025931 Ga0207644_10311044 Ga0207644_103110442 276
350 3300025933 Ga0207706_10003957 Ga0207706_1000395711 276
351 3300025933 Ga0207706_10012395 Ga0207706_100123954 276
352 3300025933 Ga0207706_10350869 Ga0207706_103508692 276
353 3300025933 Ga0207706_10405561 Ga0207706_104055611 276
354 3300025934 Ga0207686_10019645 Ga0207686_100196452 276
355 3300025934 Ga0207686_10134261 Ga0207686_101342611 276
356 3300025935 Ga0207709_10027761 Ga0207709_100277612 276
357 3300025937 Ga0207669_10000571 Ga0207669_100005719 276
358 3300025937 Ga0207669_10070304 Ga0207669_100703042 276
359 3300025938 Ga0207704_10017603 Ga0207704_100176033 276
360 3300025938 Ga0207704_10186501 Ga0207704_101865011 276
361 3300025940 Ga0207691_10003141 Ga0207691_100031414 276
362 3300025940 Ga0207691_10004497 Ga0207691_100044972 276
363 3300025940 Ga0207691_10056580 Ga0207691_100565802 276
364 3300025940 Ga0207691_10124646 Ga0207691_101246462 276
365 3300025940 Ga0207691_10145528 Ga0207691_101455282 276
366 3300025940 Ga0207691_10154746 Ga0207691_101547462 276
367 3300025940 Ga0207691_10445463 Ga0207691_104454631 276
368 3300025941 Ga0207711_10024344 Ga0207711_100243443 276
369 3300025941 Ga0207711_10044869 Ga0207711_100448692 276
370 3300025941 Ga0207711_10049221 Ga0207711_100492212 276
371 3300025941 Ga0207711_10055944 Ga0207711_100559442 276
372 3300025941 Ga0207711_10162989 Ga0207711_101629891 276
373 3300025942 Ga0207689_10002401 Ga0207689_1000240111 276
374 3300025942 Ga0207689_10021604 Ga0207689_100216042 276
375 3300025942 Ga0207689_10024922 Ga0207689_100249222 276
376 3300025960 Ga0207651_10001433 Ga0207651_100014332 276
377 3300025960 Ga0207651_10006294 Ga0207651_100062944 276
378 3300025960 Ga0207651_10014813 Ga0207651_100148132 276
379 3300025960 Ga0207651_10032669 Ga0207651_100326692 276
380 3300025960 Ga0207651_10667700 Ga0207651_106677001 276
381 3300025961 Ga0207712_10043545 Ga0207712_100435452 276
382 3300025972 Ga0207668_10056325 Ga0207668_100563252 276
383 3300025972 Ga0207668_10124052 Ga0207668_101240522 276
384 3300025981 Ga0207640_10017275 Ga0207640_100172751 276
385 3300025981 Ga0207640_10048699 Ga0207640_100486992 276
386 3300025986 Ga0207658_10014296 Ga0207658_100142965 276
387 3300025986 Ga0207658_10057630 Ga0207658_100576302 276
388 3300025986 Ga0207658_10058550 Ga0207658_100585502 276
389 3300025986 Ga0207658_10083324 Ga0207658_100833242 276
390 3300025986 Ga0207658_10346605 Ga0207658_103466051 276
391 3300026023 Ga0207677_10005265 Ga0207677_100052653 276
392 3300026023 Ga0207677_10102412 Ga0207677_101024122 276
393 3300026023 Ga0207677_10152915 Ga0207677_101529152 276
394 3300026023 Ga0207677_10239203 Ga0207677_102392032 276
395 3300026035 Ga0207703_10003506 Ga0207703_100035069 276
396 3300026035 Ga0207703_10041497 Ga0207703_100414972 276
397 3300026041 Ga0207639_10045975 Ga0207639_100459753 276
398 3300026041 Ga0207639_10130971 Ga0207639_101309712 276
399 3300026067 Ga0207678_10043836 Ga0207678_100438364 276
400 3300026067 Ga0207678_10059048 Ga0207678_100590483 276
401 3300026067 Ga0207678_10110370 Ga0207678_101103702 276
402 3300026067 Ga0207678_10166101 Ga0207678_101661012 276
403 3300026088 Ga0207641_10006666 Ga0207641_100066665 276
404 3300026088 Ga0207641_10027261 Ga0207641_100272612 276
405 3300026088 Ga0207641_10055436 Ga0207641_100554362 276
406 3300026088 Ga0207641_10093075 Ga0207641_100930752 276
407 3300026088 Ga0207641_10093365 Ga0207641_100933652 276
408 3300026088 Ga0207641_10147091 Ga0207641_101470912 276
409 3300026088 Ga0207641_10237618 Ga0207641_102376182 276
410 3300026089 Ga0207648_10016057 Ga0207648_100160576 276
411 3300026089 Ga0207648_10028845 Ga0207648_100288452 276
412 3300026089 Ga0207648_10370673 Ga0207648_103706732 276
413 3300026095 Ga0207676_10007619 Ga0207676_100076194 276
414 3300026095 Ga0207676_10093925 Ga0207676_100939252 276
415 3300026095 Ga0207676_10100612 Ga0207676_101006122 276
416 3300026095 Ga0207676_10125177 Ga0207676_101251772 276
417 3300026095 Ga0207676_10615710 Ga0207676_106157101 276
418 3300026116 Ga0207674_10024347 Ga0207674_100243474 276
419 3300026118 Ga0207675_100015712 Ga0207675_1000157122 276
420 3300026118 Ga0207675_100046909 Ga0207675_1000469092 276
421 3300026121 Ga0207683_10000463 Ga0207683_100004631 276
422 3300026121 Ga0207683_10019843 Ga0207683_100198434 276
423 3300026121 Ga0207683_10040790 Ga0207683_100407902 276
424 3300026121 Ga0207683_10089894 Ga0207683_100898942 276
425 3300026121 Ga0207683_10120320 Ga0207683_101203202 276
426 3300026121 Ga0207683_10523927 Ga0207683_105239272 276
427 3300026142 Ga0207698_10009889 Ga0207698_100098895 276
428 3300026142 Ga0207698_10020872 Ga0207698_100208722 276
429 3300026142 Ga0207698_10079337 Ga0207698_100793373 276
430 3300026142 Ga0207698_10354818 Ga0207698_103548182 276
431 3300027666 Ga0209282_1063854 Ga0209282_10638542 276
432 3300028379 Ga0268266_10011978 Ga0268266_100119786 276
433 3300028379 Ga0268266_10188566 Ga0268266_101885662 276
434 3300028380 Ga0268265_10124179 Ga0268265_101241792 276
435 3300028380 Ga0268265_10165258 Ga0268265_101652582 276
436 3300028380 Ga0268265_10204212 Ga0268265_102042122 276
437 3300028380 Ga0268265_10535364 Ga0268265_105353641 276
438 3300028381 Ga0268264_10347615 Ga0268264_103476152 276
439 3300028381 Ga0268264_10497527 Ga0268264_104975272 276
440 3300029957 Ga0265324_10058861 Ga0265324_100588611 276
441 3300031456 Ga0307513_10039048 Ga0307513_100390483 276
442 3300031548 Ga0307408_100003655 Ga0307408_1000036551 276
443 3300031548 Ga0307408_100196958 Ga0307408_1001969582 276
444 3300031730 Ga0307516_10076654 Ga0307516_100766541 276
445 3300031911 Ga0307412_10105903 Ga0307412_101059032 276
446 3300032002 Ga0307416_100112690 Ga0307416_1001126903 276
447 3300035692 Ga0373935_0248656 Ga0373935_0248656_13_873 276
448 3300036401 Ga0373937_0176620 Ga0373937_0176620_206_1066 276
449 3300037068 Ga0373925_0157029 Ga0373925_0157029_520_1380 276
450 3300037471 Ga0395905_0045696 Ga0395905_0045696_1330_2190 276
451 3300041404 Ga0439436_0000092 Ga0439436_0000092_2901_3788 276
452 3300041404 Ga0439436_0000765 Ga0439436_0000765_2593_3453 276
453 3300041404 Ga0439436_0002159 Ga0439436_0002159_1573_2433 276
454 3300041404 Ga0439436_0041210 Ga0439436_0041210_270_1130 276
455 3300041406 Ga0439439_0000021 Ga0439439_0000021_5500_6387 276
456 3300041407 Ga0439447_002462 Ga0439447_002462_2068_2955 276
457 3300041411 Ga0439466_0004033 Ga0439466_0004033_1803_2690 276
458 3300041411 Ga0439466_0046235 Ga0439466_0046235_148_1008 276
459 3300041411 Ga0439466_0048803 Ga0439466_0048803_516_1376 276
460 3300041413 Ga0439465_0011337 Ga0439465_0011337_60_920 276
461 3300041413 Ga0439465_0037369 Ga0439465_0037369_526_1386 276
462 3300041512 Ga0451853_1576222 Ga0451853_1576222_124_984 276
463 3300041997 Ga0439431_0011132 Ga0439431_0011132_308_1195 276
464 3300041997 Ga0439431_0057859 Ga0439431_0057859_10_870 276
465 3300041999 Ga0439433_0000171 Ga0439433_0000171_297_1157 276
466 3300042002 Ga0439442_001937 Ga0439442_001937_2101_2961 276
467 3300042002 Ga0439442_005458 Ga0439442_005458_1529_2416 276
468 3300042004 Ga0439445_0003359 Ga0439445_0003359_2144_3004 276
469 3300042004 Ga0439445_0030789 Ga0439445_0030789_416_1276 276
470 3300042006 Ga0439432_000936 Ga0439432_000936_6907_7794 276
471 3300042007 Ga0439449_0000003 Ga0439449_0000003_49850_50737 276
472 3300042007 Ga0439449_0002393 Ga0439449_0002393_5540_6400 276
473 3300042007 Ga0439449_0004373 Ga0439449_0004373_3325_4185 276
474 3300042010 Ga0439452_001024 Ga0439452_001024_5454_6314 276
475 3300042010 Ga0439452_001607 Ga0439452_001607_4827_5714 276
476 3300042010 Ga0439452_020073 Ga0439452_020073_755_1615 276
477 3300042014 Ga0439457_008629 Ga0439457_008629_770_1630 276
478 3300042015 Ga0439462_0000090 Ga0439462_0000090_84_971 276
479 3300042015 Ga0439462_0002699 Ga0439462_0002699_2681_3541 276
480 3300042121 Ga0450919_000220 Ga0450919_000220_5214_6074 276
481 3300042127 Ga0450890_006694 Ga0450890_006694_598_1458 276
482 3300042128 Ga0450897_001318 Ga0450897_001318_650_1510 276
483 3300042128 Ga0450897_001755 Ga0450897_001755_192_1052 276
484 3300042134 Ga0450898_000619 Ga0450898_000619_2489_3376 276
485 3300042145 Ga0450906_007321 Ga0450906_007321_1079_1939 276
486 3300042145 Ga0450906_011701 Ga0450906_011701_489_1349 276
487 3300042156 Ga0439446_0009526 Ga0439446_0009526_917_1804 276
488 3300042156 Ga0439446_0018809 Ga0439446_0018809_441_1301 276
489 3300042184 Ga0450908_009765 Ga0450908_009765_294_1154 276
490 3300042435 Ga0439434_0000809 Ga0439434_0000809_2145_3032 276
491 3300042435 Ga0439434_0001183 Ga0439434_0001183_996_1856 276
492 3300042435 Ga0439434_0009002 Ga0439434_0009002_2009_2869 276
493 3300042435 Ga0439434_0015535 Ga0439434_0015535_1250_2110 276
494 3300042435 Ga0439434_0020902 Ga0439434_0020902_500_1360 276
495 3300042439 Ga0439464_0014721 Ga0439464_0014721_878_1738 276
496 3300042531 Ga0450918_000061 Ga0450918_000061_4595_5455 276
497 3300042531 Ga0450918_000214 Ga0450918_000214_1988_2848 276
498 3300046462 Ga0495651_0086582 Ga0495651_0086582_891_1778 276
499 3300046471 Ga0495650_0005465 Ga0495650_0005465_5386_6249 276
500 3300046472 Ga0495580_0016185 Ga0495580_0016185_838_1698 276
501 3300046475 Ga0495639_0094652 Ga0495639_0094652_495_1355 276
502 3300046499 Ga0495594_0025711 Ga0495594_0025711_263_1123 276
503 3300046526 Ga0495666_0037981 Ga0495666_0037981_634_1494 276
504 3300046528 Ga0495642_0157473 Ga0495642_0157473_48_908 276
505 3300046531 Ga0495665_0006189 Ga0495665_0006189_5372_6232 276
506 3300046543 Ga0495645_0148836 Ga0495645_0148836_100_960 276
507 3300046615 Ga0495656_0006776 Ga0495656_0006776_2624_3484 276
508 3300046615 Ga0495656_0031968 Ga0495656_0031968_28_888 276
509 3300046674 Ga0495588_0037506 Ga0495588_0037506_473_1333 276
510 3300046680 Ga0495646_0135380 Ga0495646_0135380_147_1007 276
511 3300046683 Ga0495658_0191077 Ga0495658_0191077_42_902 276
512 3300046690 Ga0495624_0023189 Ga0495624_0023189_93_953 276
513 3300046809 Ga0495600_0247320 Ga0495600_0247320_246_1106 276
514 3300047317 Ga0495604_0028126 Ga0495604_0028126_567_1427 276
515 3300047318 Ga0495636_0000270 Ga0495636_0000270_6973_7833 276
516 3300047447 Ga0495685_089973 Ga0495685_089973_105_965 276
517 3300047470 Ga0495681_0085685 Ga0495681_0085685_52_912 276
518 3300047471 Ga0495684_0143418 Ga0495684_0143418_23_883 276
519 3300048904 Ga0496101_0275266 Ga0496101_0275266_41_901 276
520 3300048905 Ga0496102_0000852 Ga0496102_0000852_8027_8887 276
521 3300048907 Ga0496104_0029371 Ga0496104_0029371_2824_3684 276
522 3300048907 Ga0496104_0101152 Ga0496104_0101152_939_1799 276
523 3300048908 Ga0496105_0018628 Ga0496105_0018628_4696_5556 276
524 3300048910 Ga0496107_0322247 Ga0496107_0322247_45_905 276
525 3300048911 Ga0496108_0099726 Ga0496108_0099726_119_979 276
526 3300048911 Ga0496108_0205535 Ga0496108_0205535_646_1506 276
527 3300048911 Ga0496108_0386989 Ga0496108_0386989_241_1101 276
528 3300048911 Ga0496108_0437499 Ga0496108_0437499_155_1108 276
529 3300048911 Ga0496108_0496341 Ga0496108_0496341_124_984 276
530 3300048912 Ga0496109_0052712 Ga0496109_0052712_400_1260 276
531 3300048912 Ga0496109_0061321 Ga0496109_0061321_476_1336 276
532 3300048912 Ga0496109_0247320 Ga0496109_0247320_485_1345 276
533 3300048912 Ga0496109_0418496 Ga0496109_0418496_256_1116 276
534 3300048913 Ga0496110_0007171 Ga0496110_0007171_5843_6703 276
535 3300048913 Ga0496110_0173544 Ga0496110_0173544_498_1358 276
536 3300048913 Ga0496110_0422115 Ga0496110_0422115_94_954 276
537 3300048913 Ga0496110_0542452 Ga0496110_0542452_128_988 276
538 3300048915 Ga0496112_0002412 Ga0496112_0002412_4075_4941 276
539 3300048915 Ga0496112_0009210 Ga0496112_0009210_4920_5780 276
540 3300048915 Ga0496112_0184411 Ga0496112_0184411_232_1092 276
541 3300048915 Ga0496112_0288970 Ga0496112_0288970_122_982 276
542 3300048917 Ga0496114_0366136 Ga0496114_0366136_390_1250 276
543 3300049649 Ga0501198_000027 Ga0501198_000027_3756_4619 276
544 3300049662 Ga0501222_000026 Ga0501222_000026_3635_4498 276
545 3300049822 Ga0501035_0042879 Ga0501035_0042879_1807_2673 276
546 3300050489 nmdc:mga03683_24673_c1 nmdc:mga03683_24673_c1_683_1543 276
547 3300050493 nmdc:mga0k408_132771_c1 nmdc:mga0k408_132771_c1_252_1112 276
548 3300050493 nmdc:mga0k408_178330_c1 nmdc:mga0k408_178330_c1_262_1122 276
549 3300050493 nmdc:mga0k408_24016_c1 nmdc:mga0k408_24016_c1_272_1132 276
550 3300050493 nmdc:mga0k408_986_c1 nmdc:mga0k408_986_c1_11879_12739 276
551 3300050494 nmdc:mga06z11_15689_c1 nmdc:mga06z11_15689_c1_1939_2799 276
552 3300050494 nmdc:mga06z11_89443_c1 nmdc:mga06z11_89443_c1_343_1203 276
553 3300050496 nmdc:mga07m45_10533_c2 nmdc:mga07m45_10533_c2_237_1124 276
554 3300050496 nmdc:mga07m45_14972_c1 nmdc:mga07m45_14972_c1_105_965 276
555 3300050496 nmdc:mga07m45_1838_c1 nmdc:mga07m45_1838_c1_5417_6277 276
556 3300050496 nmdc:mga07m45_5811_c1 nmdc:mga07m45_5811_c1_1396_2256 276
557 3300050508 nmdc:mga09592_1513_c1 nmdc:mga09592_1513_c1_8976_9839 276
558 3300050508 nmdc:mga09592_50340_c1 nmdc:mga09592_50340_c1_904_1764 276
559 3300053084 Ga0495595_0073826 Ga0495595_0073826_99_959 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

86

175

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a12-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator 0.8895 90 148
5eo2-assembly1.cif.gz_D structural and biochemical characterization of the hypothetical protein sav2348 from staphylococcus aureus in complex with coa. 0.8849 90 149
8huc-assembly1.cif.gz_A crystal structure of paich (pec1) 0.8717 11 276
6fdg-assembly1.cif.gz_D novel crystal structure of dhna-coa thioesterase from staphylococcus aureus 0.8663 90 149
8huc-assembly1.cif.gz_C crystal structure of paich (pec1) 0.8647 14 276
ID Description Score Start End Superfamily
af_Q80ZW2_46_168_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9204 90 148 3.10.129.10
af_Q5A0N4_66_202_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9068 90 149 3.10.129.10
af_A0A1D6KJS7_406_533_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8915 90 149 3.10.129.10
af_A0A0N7KJH1_95_233_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8896 90 149 3.10.129.10
af_F4HX80_37_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8849 90 149 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A5C9BT75-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9299 8 276 GO:0019171
AF-A0A1Z8P3P6-F1-model_v4 Acyl-CoA dehydrogenase 0.9289 8 274 GO:0019171
AF-B9Z0Q1-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9233 1 276 GO:0019171
AF-B9Z0Q1-F1-model_v4 FAS1-like dehydratase domain-containing protein 0.9201 1 276 GO:0019171
AF-A0A177RJA6-F1-model_v4 deleted 0.9199 4 276

Feature Viewer

pLDDT pTM Quality
80.04 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map