F463513

General Info

Members Datasets Scaffolds Average Seq Length
558 327 524 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928115317|2928120655
Length 249
Sequence PAFADAQAGGLDGTAAAAVSAGAAAPSAMQAGRRGFLGRAAGLASWAGLAAPLWLPSTAHAGAQIEEPLADAVRTALSSAILNNAPPVPEFDDFAGRLHYLRWLGTMGDRLRRKVSDWQTRKELLQTIWYESRRAGLDVSLVLGLIQVESNFRKHAVSSAGARGYMQVMPFWVRTIGNGDPSVLFHMQTNLRFGCVILRHYLDRERGDLFMALGRYNGSRGRAPYPDAVFANQRNWTFDPRHTPGGAGE

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2643221570 Acidovorax sp. Root568 Isolate Unclassified
4 2643221596 Acidovorax sp. Root70 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221660 Methylibium sp. Root1272 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2643221717 Acidovorax sp. Root267 Isolate Unclassified
14 2738543012 Acidovorax sp. CF301 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2816332133 Acidovorax radicis 2721A Isolate Unclassified
17 2831864461 Roseateles noduli HZ7 Isolate Nodule
18 2842677519 Variovorax sp. R-72495 Isolate Unclassified
19 2842733646 Variovorax sp. R-72446 Isolate Unclassified
20 2842747753 Variovorax sp. R-72060 Isolate Unclassified
21 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
22 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
23 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
24 2904456579 Variovorax sp. 2002 Isolate Unclassified
25 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
26 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
27 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
28 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
29 2929520902 Variovorax beijingensis 502 Isolate Unclassified
30 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
31 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
32 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
33 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
34 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
104 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
198 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
205 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
206 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
207 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
213 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
219 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
236 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
241 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
242 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
243 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
252 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
253 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
254 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
255 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
256 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
257 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
258 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
259 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
260 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
261 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
262 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
310 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
319 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.73
Metatranscriptomes 0.18
Isolates 6.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.13
Nodule 0.72
Rhizoplane 3.41
Rhizosphere 73.84
Stem 0
Stem Tuber 0
Unclassified 5.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10004995 3300003187 Bacteria 6914
2 Ga0055537_1000717 3300003773 Bacteria 17146
3 Ga0055536_1009252 3300003781 Bacteria 4102
4 Ga0055536_1009441 3300003781 Bacteria 4034
5 Ga0055534_1000337 3300003784 Bacteria 30592
6 Ga0055534_1000467 3300003784 Bacteria 22933
7 Ga0055528_1013900 3300003790 Bacteria 3019
8 Ga0055530_10010358 3300003791 Bacteria 3455
9 Ga0055540_1003024 3300003792 Bacteria 8408
10 Ga0055540_1007603 3300003792 Bacteria 4052
11 Ga0055540_1007907 3300003792 Bacteria 3917
12 Ga0055540_1013616 3300003792 Bacteria 2474
13 Ga0055540_1033248 3300003792 Bacteria 1170
14 Ga0055531_10000158 3300003794 Bacteria 77918
15 Ga0055531_10002327 3300003794 Bacteria 12826
16 Ga0065165_1000016 3300005262 Bacteria 286248
17 Ga0065714_10068656 3300005288 Bacteria 4601
18 Ga0070658_10220862 3300005327 Bacteria 1602
19 Ga0070658_10295138 3300005327 Bacteria 1382
20 Ga0070658_10666850 3300005327 Bacteria 902
21 Ga0070676_10045299 3300005328 Bacteria 2562
22 Ga0070676_10364448 3300005328 Bacteria 997
23 Ga0070683_100015313 3300005329 Bacteria 6732
24 Ga0070683_100052505 3300005329 Bacteria 3777
25 Ga0070670_100076880 3300005331 Bacteria 2868
26 Ga0070670_100755125 3300005331 Bacteria 877
27 Ga0070677_10039131 3300005333 Bacteria 1859
28 Ga0070677_10090520 3300005333 Bacteria 1329
29 Ga0070680_100088305 3300005336 Bacteria 2564
30 Ga0070680_100585855 3300005336 Bacteria 957
31 Ga0070660_100046918 3300005339 Bacteria 3313
32 Ga0070660_100114649 3300005339 Bacteria 2147
33 Ga0070660_100411911 3300005339 Bacteria 1118
34 Ga0070687_100072232 3300005343 Bacteria 1857
35 Ga0070687_100145863 3300005343 Bacteria 1384
36 Ga0070661_100136306 3300005344 Bacteria 1847
37 Ga0070661_100178941 3300005344 Bacteria 1613
38 Ga0070668_100314142 3300005347 Bacteria 1317
39 Ga0070668_101030418 3300005347 Bacteria 740
40 Ga0070669_100023404 3300005353 Bacteria 4423
41 Ga0070669_100328562 3300005353 Bacteria 1236
42 Ga0070669_100456928 3300005353 Bacteria 1053
43 Ga0070669_100466803 3300005353 Bacteria 1042
44 Ga0070675_100268604 3300005354 Bacteria 1496
45 Ga0070671_100035484 3300005355 Bacteria 4131
46 Ga0070671_100327108 3300005355 Bacteria 1306
47 Ga0070674_100017730 3300005356 Bacteria 4486
48 Ga0070674_100061426 3300005356 Bacteria 2622
49 Ga0070673_100857928 3300005364 Bacteria 840
50 Ga0070688_100313428 3300005365 Bacteria 1138
51 Ga0070659_100063655 3300005366 Bacteria 2918
52 Ga0070659_100412390 3300005366 Bacteria 1141
53 Ga0070659_100729185 3300005366 Bacteria 858
54 Ga0070667_100341786 3300005367 Bacteria 1354
55 Ga0070667_100422440 3300005367 Bacteria 1215
56 Ga0070714_100085568 3300005435 Bacteria 2754
57 Ga0070700_100059926 3300005441 Bacteria 2397
58 Ga0070663_100332819 3300005455 Bacteria 1224
59 Ga0070678_100199916 3300005456 Bacteria 1649
60 Ga0070678_100267810 3300005456 Bacteria 1439
61 Ga0070662_100025648 3300005457 Bacteria 4073
62 Ga0070662_100179219 3300005457 Bacteria 1669
63 Ga0070662_100256824 3300005457 Bacteria 1407
64 Ga0070662_100358203 3300005457 Bacteria 1196
65 Ga0070662_100701039 3300005457 Bacteria 856
66 Ga0070681_10017140 3300005458 Bacteria 7243
67 Ga0070679_100000726 3300005530 Bacteria 28453
68 Ga0070679_100022540 3300005530 Bacteria 6156
69 Ga0070684_100033577 3300005535 Bacteria 4383
70 Ga0068853_100025786 3300005539 Bacteria 4934
71 Ga0070672_100070719 3300005543 Bacteria 2774
72 Ga0070672_100626244 3300005543 Bacteria 938
73 Ga0070693_100247333 3300005547 Bacteria 1180
74 Ga0070665_100295173 3300005548 Bacteria 1623
75 Ga0068855_100080354 3300005563 Bacteria 3780
76 Ga0070664_100034087 3300005564 Bacteria 4270
77 Ga0070664_100040469 3300005564 Bacteria 3929
78 Ga0070664_100158377 3300005564 Bacteria 2002
79 Ga0068857_100059410 3300005577 Bacteria 3396
80 Ga0068857_100082770 3300005577 Bacteria 2867
81 Ga0068857_100170250 3300005577 Bacteria 1979
82 Ga0068857_100971589 3300005577 Bacteria 817
83 Ga0068856_100107506 3300005614 Bacteria 2785
84 Ga0068856_100164256 3300005614 Bacteria 2231
85 Ga0068852_100008793 3300005616 Bacteria 7472
86 Ga0068852_100055318 3300005616 Bacteria 3424
87 Ga0068852_100146421 3300005616 Bacteria 2191
88 Ga0068852_100201128 3300005616 Bacteria 1885
89 Ga0068852_100346910 3300005616 Bacteria 1448
90 Ga0068852_100525745 3300005616 Bacteria 1181
91 Ga0068852_100879402 3300005616 Bacteria 912
92 Ga0068859_100328060 3300005617 Bacteria 1624
93 Ga0068859_100450942 3300005617 Bacteria 1382
94 Ga0068864_100018085 3300005618 Bacteria 5883
95 Ga0068864_100142530 3300005618 Bacteria 2163
96 Ga0068861_100098115 3300005719 Bacteria 2325
97 Ga0068861_100405089 3300005719 Bacteria 1211
98 Ga0068851_10008923 3300005834 Bacteria 4649
99 Ga0068851_10084595 3300005834 Bacteria 1661
100 Ga0068851_10087195 3300005834 Bacteria 1639
101 Ga0068870_10239936 3300005840 Bacteria 1119
102 Ga0068863_100199500 3300005841 Bacteria 1924
103 Ga0068863_100425884 3300005841 Bacteria 1300
104 Ga0068858_100010452 3300005842 Bacteria 8793
105 Ga0068858_100044054 3300005842 Bacteria 4137
106 Ga0068860_100188461 3300005843 Bacteria 1995
107 Ga0068860_100280748 3300005843 Bacteria 1627
108 Ga0068862_100057075 3300005844 Bacteria 3347
109 Ga0068862_100071690 3300005844 Bacteria 2991
110 Ga0075365_10011592 3300006038 Bacteria 5192
111 Ga0075365_10041123 3300006038 Bacteria 3018
112 Ga0075365_10412335 3300006038 Bacteria 953
113 Ga0075363_100051066 3300006048 Bacteria 2204
114 Ga0075363_100121138 3300006048 Bacteria 1461
115 Ga0075364_10014749 3300006051 Bacteria 4834
116 Ga0075364_10042871 3300006051 Bacteria 2940
117 Ga0075432_10022467 3300006058 Bacteria 2157
118 Ga0075362_10021518 3300006177 Bacteria 2707
119 Ga0075369_10028056 3300006186 Bacteria 2357
120 Ga0075366_10032903 3300006195 Bacteria 3053
121 Ga0075366_10129633 3300006195 Bacteria 1522
122 Ga0075366_10150640 3300006195 Bacteria 1408
123 Ga0075366_10212797 3300006195 Bacteria 1177
124 Ga0097621_100394116 3300006237 Bacteria 1239
125 Ga0075370_10044865 3300006353 Bacteria 2499
126 Ga0075370_10053139 3300006353 Bacteria 2299
127 Ga0075370_10086126 3300006353 Bacteria 1809
128 Ga0075370_10087024 3300006353 Bacteria 1800
129 Ga0075370_10261394 3300006353 Bacteria 1027
130 Ga0075370_10347755 3300006353 Bacteria 885
131 Ga0075430_100059404 3300006846 Bacteria 3215
132 Ga0075434_100968364 3300006871 Bacteria 865
133 Ga0075429_100003110 3300006880 Bacteria 14099
134 Ga0068865_100111887 3300006881 Bacteria 2015
135 Ga0097620_100328051 3300006931 Bacteria 1624
136 Ga0079104_1021809 3300006946 Bacteria 1737
137 Ga0099826_10001050 3300006948 Bacteria 15606
138 Ga0105244_10003265 3300009036 Bacteria 11688
139 Ga0105240_10019777 3300009093 Bacteria 8992
140 Ga0111539_11557540 3300009094 Bacteria 766
141 Ga0105245_10082031 3300009098 Bacteria 2949
142 Ga0105243_10002036 3300009148 Bacteria 17143
143 Ga0105243_10002550 3300009148 Bacteria 15218
144 Ga0105243_10070369 3300009148 Bacteria 2825
145 Ga0105243_10464865 3300009148 Bacteria 1190
146 Ga0105242_10006501 3300009176 Bacteria 9001
147 Ga0105242_10143402 3300009176 Bacteria 2075
148 Ga0105248_10816080 3300009177 Bacteria 1053
149 Ga0105237_10516920 3300009545 Bacteria 1200
150 Ga0105237_10590509 3300009545 Bacteria 1118
151 Ga0105238_10033306 3300009551 Bacteria 5244
152 Ga0105238_10162250 3300009551 Bacteria 2211
153 Ga0105238_10215121 3300009551 Bacteria 1898
154 Ga0105249_10652870 3300009553 Bacteria 1110
155 Ga0105239_10307199 3300010375 Bacteria 1787
156 Ga0105246_10061099 3300011119 Bacteria 2620
157 Ga0157347_1001964 3300012502 Bacteria 1701
158 Ga0157373_10084481 3300013100 Bacteria 2238
159 Ga0157373_10237622 3300013100 Bacteria 1288
160 Ga0157371_10371754 3300013102 Bacteria 1043
161 Ga0157370_10012858 3300013104 Bacteria 8653
162 Ga0157370_10171048 3300013104 Bacteria 2019
163 Ga0157370_10666113 3300013104 Bacteria 951
164 Ga0157369_10070068 3300013105 Bacteria 3767
165 Ga0157369_10860438 3300013105 Bacteria 930
166 Ga0157369_11160639 3300013105 Bacteria 789
167 Ga0157374_10021167 3300013296 Bacteria 5782
168 Ga0157374_10968191 3300013296 Bacteria 870
169 Ga0157378_10774562 3300013297 Bacteria 984
170 Ga0163162_10119727 3300013306 Bacteria 2736
171 Ga0163162_10121698 3300013306 Bacteria 2714
172 Ga0163162_10137672 3300013306 Bacteria 2553
173 Ga0163162_10470525 3300013306 Bacteria 1388
174 Ga0163162_11315787 3300013306 Bacteria 821
175 Ga0157372_10019258 3300013307 Bacteria 7349
176 Ga0157380_10215857 3300014326 Bacteria 1713
177 Ga0157380_10216410 3300014326 Bacteria 1711
178 Ga0157380_10245360 3300014326 Bacteria 1617
179 Ga0157380_10635240 3300014326 Bacteria 1062
180 Ga0182008_10005957 3300014497 Bacteria 6874
181 Ga0182008_10015193 3300014497 Bacteria 4021
182 Ga0182008_10016419 3300014497 Bacteria 3846
183 Ga0182008_10018374 3300014497 Bacteria 3621
184 Ga0157379_10017000 3300014968 Bacteria 6402
185 Ga0157376_10007703 3300014969 Bacteria 7713
186 Ga0182006_1008452 3300015261 Bacteria 4663
187 Ga0182006_1024985 3300015261 Bacteria 2459
188 Ga0182007_10000951 3300015262 Bacteria 15906
189 Ga0182007_10017245 3300015262 Bacteria 2642
190 Ga0183362_10003 3300015683 Bacteria 977584
191 Ga0163161_10001265 3300017792 Bacteria 18886
192 Ga0163161_10002188 3300017792 Bacteria 14097
193 Ga0163161_10176475 3300017792 Bacteria 1636
194 Ga0163161_10229800 3300017792 Bacteria 1439
195 Ga0163161_10426384 3300017792 Bacteria 1068
196 Ga0206353_10275376 3300020082 Bacteria 921
197 Ga0209129_1006468 3300025258 Bacteria 3775
198 Ga0209565_1000067 3300025263 Bacteria 171247
199 Ga0209673_1000097 3300025273 Bacteria 193482
200 Ga0209673_1020951 3300025273 Bacteria 2299
201 Ga0209673_1024367 3300025273 Bacteria 2035
202 Ga0209130_1001362 3300025284 Bacteria 16486
203 Ga0209675_1000038 3300025291 Bacteria 250481
204 Ga0209675_1001272 3300025291 Bacteria 15081
205 Ga0209676_1000739 3300025292 Bacteria 44487
206 Ga0209676_1000836 3300025292 Bacteria 39908
207 Ga0209676_1004722 3300025292 Bacteria 7462
208 Ga0209676_1066833 3300025292 Bacteria 870
209 Ga0209025_1000174 3300025294 Bacteria 158915
210 Ga0209025_1001066 3300025294 Bacteria 39849
211 Ga0209025_1009762 3300025294 Bacteria 6626
212 Ga0209025_1060908 3300025294 Bacteria 1413
213 Ga0209564_1000008 3300025295 Bacteria 953227
214 Ga0209050_1002666 3300025298 Bacteria 14582
215 Ga0209256_1057117 3300025299 Bacteria 921
216 Ga0209051_1000315 3300025303 Bacteria 73579
217 Ga0209051_1001398 3300025303 Bacteria 20776
218 Ga0209051_1001450 3300025303 Bacteria 20110
219 Ga0209051_1002634 3300025303 Bacteria 12590
220 Ga0209051_1022154 3300025303 Bacteria 2681
221 Ga0209257_1000057 3300025304 Bacteria 396985
222 Ga0209257_1000309 3300025304 Bacteria 104166
223 Ga0209257_1009377 3300025304 Bacteria 5264
224 Ga0209257_1025038 3300025304 Bacteria 2049
225 Ga0207656_10023991 3300025321 Bacteria 2462
226 Ga0207656_10028210 3300025321 Bacteria 2302
227 Ga0207655_1000639 3300025728 Bacteria 41880
228 Ga0207682_10034500 3300025893 Bacteria 2040
229 Ga0207682_10081594 3300025893 Bacteria 1387
230 Ga0207688_10016652 3300025901 Bacteria 3991
231 Ga0207680_10123676 3300025903 Bacteria 1695
232 Ga0207647_10068109 3300025904 Bacteria 2155
233 Ga0207645_10018626 3300025907 Bacteria 4561
234 Ga0207645_10189055 3300025907 Bacteria 1353
235 Ga0207643_10081607 3300025908 Bacteria 1874
236 Ga0207705_10083211 3300025909 Bacteria 2334
237 Ga0207654_10122354 3300025911 Bacteria 1636
238 Ga0207654_10374673 3300025911 Bacteria 985
239 Ga0207707_10034449 3300025912 Bacteria 4430
240 Ga0207671_10331677 3300025914 Bacteria 1205
241 Ga0207662_10024710 3300025918 Bacteria 3458
242 Ga0207657_10030449 3300025919 Bacteria 4898
243 Ga0207657_10113559 3300025919 Bacteria 2235
244 Ga0207657_10315806 3300025919 Bacteria 1236
245 Ga0207649_10054285 3300025920 Bacteria 2493
246 Ga0207649_10073139 3300025920 Bacteria 2195
247 Ga0207649_10104963 3300025920 Bacteria 1877
248 Ga0207652_10002099 3300025921 Bacteria 17115
249 Ga0207652_10249008 3300025921 Bacteria 1602
250 Ga0207681_10184792 3300025923 Bacteria 1590
251 Ga0207681_10209807 3300025923 Bacteria 1500
252 Ga0207681_10440008 3300025923 Bacteria 1059
253 Ga0207694_10027863 3300025924 Bacteria 4304
254 Ga0207650_10093635 3300025925 Bacteria 2300
255 Ga0207659_10068875 3300025926 Bacteria 2575
256 Ga0207659_10496651 3300025926 Bacteria 1032
257 Ga0207687_10021336 3300025927 Bacteria 4302
258 Ga0207687_10220649 3300025927 Bacteria 1493
259 Ga0207644_10004993 3300025931 Bacteria 8661
260 Ga0207644_10018686 3300025931 Bacteria 4692
261 Ga0207644_10691264 3300025931 Bacteria 850
262 Ga0207690_10028634 3300025932 Bacteria 3532
263 Ga0207690_10075515 3300025932 Bacteria 2337
264 Ga0207706_10010891 3300025933 Bacteria 8297
265 Ga0207706_10130319 3300025933 Bacteria 2212
266 Ga0207706_10424168 3300025933 Bacteria 1152
267 Ga0207686_10024756 3300025934 Bacteria 3483
268 Ga0207686_10070032 3300025934 Bacteria 2252
269 Ga0207709_10000874 3300025935 Bacteria 22951
270 Ga0207709_10008146 3300025935 Bacteria 5804
271 Ga0207709_10025717 3300025935 Bacteria 3372
272 Ga0207709_10386807 3300025935 Bacteria 1066
273 Ga0207709_10754528 3300025935 Bacteria 782
274 Ga0207669_10241899 3300025937 Bacteria 1338
275 Ga0207704_10235186 3300025938 Bacteria 1365
276 Ga0207691_10058892 3300025940 Bacteria 3493
277 Ga0207691_10064225 3300025940 Bacteria 3326
278 Ga0207691_10433306 3300025940 Bacteria 1120
279 Ga0207711_10107944 3300025941 Bacteria 2472
280 Ga0207711_10168997 3300025941 Bacteria 1983
281 Ga0207689_10000709 3300025942 Bacteria 31888
282 Ga0207689_10128863 3300025942 Bacteria 2082
283 Ga0207661_10027821 3300025944 Bacteria 4323
284 Ga0207661_10068893 3300025944 Bacteria 2883
285 Ga0207661_10142246 3300025944 Bacteria 2065
286 Ga0207679_10035875 3300025945 Bacteria 3512
287 Ga0207679_10054754 3300025945 Bacteria 2938
288 Ga0207679_10218149 3300025945 Bacteria 1604
289 Ga0207679_10240965 3300025945 Bacteria 1532
290 Ga0207667_10200640 3300025949 Bacteria 2046
291 Ga0207667_10506147 3300025949 Bacteria 1225
292 Ga0207651_10112264 3300025960 Bacteria 2048
293 Ga0207668_10469239 3300025972 Bacteria 1077
294 Ga0207640_10903589 3300025981 Bacteria 771
295 Ga0207658_10146007 3300025986 Bacteria 1921
296 Ga0207658_10536704 3300025986 Bacteria 1045
297 Ga0207677_10015319 3300026023 Bacteria 4505
298 Ga0207703_10021855 3300026035 Bacteria 5009
299 Ga0207639_10074964 3300026041 Bacteria 2659
300 Ga0207639_10383191 3300026041 Bacteria 1263
301 Ga0207678_10079421 3300026067 Bacteria 2809
302 Ga0207678_10246562 3300026067 Bacteria 1530
303 Ga0207678_10323630 3300026067 Bacteria 1327
304 Ga0207678_10547272 3300026067 Bacteria 1012
305 Ga0207708_10014415 3300026075 Bacteria 5917
306 Ga0207641_10020367 3300026088 Bacteria 5447
307 Ga0207641_10195960 3300026088 Bacteria 1859
308 Ga0207648_10021655 3300026089 Bacteria 5775
309 Ga0207648_10185837 3300026089 Bacteria 1841
310 Ga0207676_10013160 3300026095 Bacteria 5940
311 Ga0207674_10093207 3300026116 Bacteria 3001
312 Ga0207674_10209902 3300026116 Bacteria 1896
313 Ga0207674_10241261 3300026116 Bacteria 1754
314 Ga0207674_10292049 3300026116 Bacteria 1579
315 Ga0207675_100000563 3300026118 Bacteria 36307
316 Ga0207675_100576099 3300026118 Bacteria 1127
317 Ga0207683_10207014 3300026121 Bacteria 1784
318 Ga0207683_10262884 3300026121 Bacteria 1576
319 Ga0207683_10663207 3300026121 Bacteria 966
320 Ga0207683_10690801 3300026121 Bacteria 946
321 Ga0207683_10710371 3300026121 Bacteria 932
322 Ga0207698_10050799 3300026142 Bacteria 3166
323 Ga0207698_10072618 3300026142 Bacteria 2736
324 Ga0207698_10123812 3300026142 Bacteria 2194
325 Ga0207698_10134303 3300026142 Bacteria 2120
326 Ga0207698_10655461 3300026142 Bacteria 1040
327 Ga0207698_11223172 3300026142 Bacteria 765
328 Ga0209282_1000250 3300027666 Bacteria 26928
329 Ga0209971_1002246 3300027682 Bacteria 4677
330 Ga0207428_10242322 3300027907 Bacteria 1347
331 Ga0268266_10029093 3300028379 Bacteria 4696
332 Ga0268266_10590298 3300028379 Bacteria 1067
333 Ga0268265_10932112 3300028380 Bacteria 854
334 Ga0268264_10058123 3300028381 Bacteria 3237
335 Ga0307515_10000472 3300028794 Bacteria 96172
336 Ga0307515_10081570 3300028794 Bacteria 4199
337 Ga0307515_10276532 3300028794 Bacteria 1392
338 Ga0316177_1007507 3300030731 Bacteria 1500
339 Ga0316176_1121395 3300030732 Bacteria 2988
340 Ga0314311_1027844 3300030733 Bacteria 4749
341 Ga0316183_1009331 3300030742 Bacteria 1459
342 Ga0316183_1109757 3300030742 Bacteria 4328
343 Ga0316181_1068905 3300030744 Bacteria 1301
344 Ga0316181_1251452 3300030744 Bacteria 2103
345 Ga0316182_1126101 3300030745 Bacteria 3893
346 Ga0316182_1154859 3300030745 Bacteria 2211
347 Ga0265330_10000046 3300031235 Bacteria 108853
348 Ga0265332_10000028 3300031238 Bacteria 184029
349 Ga0265320_10059335 3300031240 Bacteria 1830
350 Ga0265325_10002346 3300031241 Bacteria 12816
351 Ga0265340_10009685 3300031247 Bacteria 5164
352 Ga0265327_10001654 3300031251 Bacteria 26845
353 Ga0307408_100000288 3300031548 Bacteria 49765
354 Ga0307408_100068273 3300031548 Bacteria 2617
355 Ga0307408_100192952 3300031548 Bacteria 1642
356 Ga0307408_100613403 3300031548 Bacteria 968
357 Ga0307408_100673008 3300031548 Bacteria 927
358 Ga0307514_10038626 3300031649 Bacteria 3774
359 Ga0265314_10000054 3300031711 Bacteria 184029
360 Ga0307405_10035253 3300031731 Bacteria 2986
361 Ga0307405_10072055 3300031731 Bacteria 2225
362 Ga0307405_10222198 3300031731 Bacteria 1386
363 Ga0307413_10104999 3300031824 Bacteria 1877
364 Ga0307406_10001524 3300031901 Bacteria 12798
365 Ga0307406_10003957 3300031901 Bacteria 8050
366 Ga0307406_10077582 3300031901 Bacteria 2198
367 Ga0307412_10017947 3300031911 Bacteria 4245
368 Ga0307412_10094180 3300031911 Bacteria 2103
369 Ga0307412_10125412 3300031911 Bacteria 1856
370 Ga0307412_10153678 3300031911 Bacteria 1701
371 Ga0307412_10164062 3300031911 Bacteria 1654
372 Ga0307412_10172712 3300031911 Bacteria 1617
373 Ga0307412_10734841 3300031911 Bacteria 850
374 Ga0307409_100004985 3300031995 Bacteria 7559
375 Ga0307409_100502633 3300031995 Bacteria 1181
376 Ga0307416_100001338 3300032002 Bacteria 13277
377 Ga0307416_100030507 3300032002 Bacteria 4046
378 Ga0307416_100201437 3300032002 Bacteria 1889
379 Ga0307416_100464665 3300032002 Bacteria 1321
380 Ga0307414_10058692 3300032004 Bacteria 2712
381 Ga0307414_10677836 3300032004 Bacteria 931
382 Ga0307411_10013355 3300032005 Bacteria 4529
383 Ga0307411_10152219 3300032005 Bacteria 1720
384 Ga0307415_100001083 3300032126 Bacteria 12652
385 Ga0373945_0041206 3300035116 Bacteria 1669
386 Ga0373954_0026268 3300035118 Bacteria 2669
387 Ga0373960_0052383 3300035121 Bacteria 1215
388 Ga0373931_0029474 3300035691 Bacteria 2818
389 Ga0373937_0543717 3300036401 Bacteria 1103
390 Ga0395905_0672583 3300037471 Bacteria 937
391 Ga0395901_0261044 3300038443 Bacteria 1803
392 Ga0395901_0354278 3300038443 Bacteria 1514
393 Ga0439436_0000328 3300041404 Bacteria 11648
394 Ga0439439_0006784 3300041406 Bacteria 2656
395 Ga0439439_0064745 3300041406 Bacteria 974
396 Ga0439461_0022306 3300041410 Bacteria 1267
397 Ga0439466_0003860 3300041411 Bacteria 5780
398 Ga0439465_0000335 3300041413 Bacteria 13395
399 Ga0439465_0171491 3300041413 Bacteria 782
400 Ga0451791_0872189 3300041451 Bacteria 822
401 Ga0439431_0008709 3300041997 Bacteria 2284
402 Ga0439431_0045688 3300041997 Bacteria 1125
403 Ga0439433_0001040 3300041999 Bacteria 5623
404 Ga0439441_025247 3300042001 Bacteria 1121
405 Ga0439442_004178 3300042002 Bacteria 2861
406 Ga0439445_0007897 3300042004 Bacteria 2479
407 Ga0439432_001277 3300042006 Bacteria 9513
408 Ga0439432_094748 3300042006 Bacteria 896
409 Ga0439449_0001202 3300042007 Bacteria 10165
410 Ga0439449_0003003 3300042007 Bacteria 6582
411 Ga0439449_0007077 3300042007 Bacteria 4272
412 Ga0439449_0119735 3300042007 Bacteria 977
413 Ga0439449_0120662 3300042007 Bacteria 973
414 Ga0439452_003061 3300042010 Bacteria 5940
415 Ga0439455_0056119 3300042012 Bacteria 1037
416 Ga0439462_0019510 3300042015 Bacteria 1765
417 Ga0450914_017008 3300042118 Bacteria 776
418 Ga0450920_041978 3300042122 Bacteria 912
419 Ga0450923_014956 3300042125 Bacteria 1445
420 Ga0450890_021150 3300042127 Bacteria 884
421 Ga0450894_032908 3300042131 Bacteria 728
422 Ga0450898_047598 3300042134 Bacteria 823
423 Ga0450906_007073 3300042145 Bacteria 2230
424 Ga0439446_0001983 3300042156 Bacteria 4836
425 Ga0450908_006998 3300042184 Bacteria 2135
426 Ga0439434_0008547 3300042435 Bacteria 3004
427 Ga0439444_0050493 3300042437 Bacteria 844
428 Ga0439464_0008492 3300042439 Bacteria 2691
429 Ga0450918_000496 3300042531 Bacteria 8444
430 Ga0451577_0003205 3300042876 Bacteria 18390
431 Ga0451577_0017089 3300042876 Bacteria 6708
432 Ga0451577_0316444 3300042876 Bacteria 1415
433 Ga0453683_0071467 3300044673 Bacteria 2171
434 Ga0466965_0181884 3300044683 Bacteria 1109
435 Ga0453684_0029360 3300044712 Bacteria 7809
436 Ga0466957_0203821 3300044842 Bacteria 1300
437 Ga0451576_0002262 3300045051 Bacteria 29416
438 Ga0451576_0088554 3300045051 Bacteria 3220
439 Ga0451576_0798666 3300045051 Bacteria 991
440 Ga0495639_0025613 3300046475 Bacteria 2602
441 Ga0495620_0031508 3300046515 Bacteria 2429
442 Ga0495637_0006661 3300046520 Bacteria 5783
443 Ga0495643_0099675 3300046522 Bacteria 1490
444 Ga0495642_0009294 3300046528 Bacteria 3764
445 Ga0495642_0113558 3300046528 Bacteria 1159
446 Ga0495654_0089739 3300046530 Bacteria 1428
447 Ga0495621_0005819 3300046539 Bacteria 3565
448 Ga0495597_0001315 3300046542 Bacteria 18215
449 Ga0495645_0212582 3300046543 Bacteria 1305
450 Ga0495645_0273911 3300046543 Bacteria 1113
451 Ga0495656_0000090 3300046615 Bacteria 39387
452 Ga0495656_0081875 3300046615 Bacteria 1458
453 Ga0495656_0085837 3300046615 Bacteria 1430
454 Ga0495625_0001055 3300046660 Bacteria 36138
455 Ga0495625_0035184 3300046660 Bacteria 3693
456 Ga0495661_0073122 3300046665 Bacteria 1998
457 Ga0495588_0096722 3300046674 Bacteria 1549
458 Ga0495588_0188790 3300046674 Bacteria 1088
459 Ga0495657_0124515 3300046675 Bacteria 1621
460 Ga0495658_0294831 3300046683 Bacteria 1025
461 Ga0495670_0047471 3300046691 Bacteria 2147
462 Ga0495685_020122 3300047447 Bacteria 2293
463 Ga0495684_0649241 3300047471 Bacteria 706
464 Ga0495602_0585636 3300048088 Bacteria 769
465 Ga0495615_0067048 3300048090 Bacteria 960
466 Ga0496101_0001103 3300048904 Bacteria 16042
467 Ga0496101_0013232 3300048904 Bacteria 5525
468 Ga0496102_0318861 3300048905 Bacteria 1464
469 Ga0496103_0020196 3300048906 Bacteria 4000
470 Ga0496104_0043122 3300048907 Bacteria 4237
471 Ga0496105_0010700 3300048908 Bacteria 7220
472 Ga0496106_0461595 3300048909 Bacteria 1020
473 Ga0496107_0382172 3300048910 Bacteria 1047
474 Ga0496108_0092049 3300048911 Bacteria 2578
475 Ga0496108_0466647 3300048911 Bacteria 1103
476 Ga0496108_0733019 3300048911 Bacteria 856
477 Ga0496109_0091319 3300048912 Bacteria 2816
478 Ga0496109_0513470 3300048912 Bacteria 1131
479 Ga0496110_0041576 3300048913 Bacteria 4012
480 Ga0496110_0059350 3300048913 Bacteria 3372
481 Ga0496110_0070050 3300048913 Bacteria 3106
482 Ga0496110_0595205 3300048913 Bacteria 1003
483 Ga0496114_0099856 3300048917 Bacteria 2476
484 Ga0496116_0042660 3300048919 Bacteria 3098
485 Ga0496117_0109794 3300048920 Bacteria 1721
486 Ga0496121_0111006 3300048924 Bacteria 2092
487 Ga0496123_0000274 3300048926 Bacteria 101783
488 Ga0496123_0206778 3300048926 Bacteria 1001
489 Ga0496124_0394049 3300048927 Bacteria 963
490 Ga0496125_0030178 3300048928 Bacteria 4854
491 Ga0501031_0003842 3300049568 Bacteria 9658
492 Ga0501047_0043447 3300049581 Bacteria 4342
493 Ga0501252_001787 3300049682 Bacteria 2049
494 nmdc:mga03683_19810_c1 3300050489 Bacteria 2573
495 nmdc:mga03n38_102360_c1 3300050490 Bacteria 1383
496 nmdc:mga03n38_1785_c1 3300050490 Bacteria 6376
497 nmdc:mga03n38_40351_c1 3300050490 Bacteria 2028
498 nmdc:mga0yw44_114821_c1 3300050492 Bacteria 1729
499 nmdc:mga0yw44_27946_c1 3300050492 Bacteria 3239
500 nmdc:mga0k408_11950_c1 3300050493 Bacteria 4737
501 nmdc:mga0k408_121210_c1 3300050493 Bacteria 1549
502 nmdc:mga0k408_6410_c1 3300050493 Bacteria 6277
503 nmdc:mga07m45_118871_c1 3300050496 Bacteria 1526
504 nmdc:mga07m45_14610_c1 3300050496 Bacteria 4187
505 nmdc:mga07m45_22132_c1 3300050496 Bacteria 3469
506 nmdc:mga07m45_30534_c1 3300050496 Bacteria 2985
507 nmdc:mga07m45_9703_c2 3300050496 Bacteria 2811
508 nmdc:mga09592_17097_c1 3300050508 Bacteria 5938
509 nmdc:mga0qj67_68189_c1 3300050509 Bacteria 2835
510 nmdc:mga08y16_795594_c1 3300050511 Bacteria 939
511 nmdc:mga0sz30_12441_c1 3300050516 Bacteria 3312
512 nmdc:mga0sz30_76285_c1 3300050516 Bacteria 1447
513 Ga0500610_0032848 3300053079 Bacteria 2644
514 Ga0495619_0310713 3300053085 Bacteria 1092
515 Ga0500651_0037654 3300053093 Bacteria 3048
516 Ga0500593_000440 3300053117 Bacteria 16359
517 Ga0500593_002479 3300053117 Bacteria 6777
518 Ga0500559_0005631 3300053136 Bacteria 5739
519 Ga0500622_0003254 3300053156 Bacteria 11016
520 Ga0500622_0304739 3300053156 Bacteria 677
521 Ga0500627_0032829 3300053158 Bacteria 2190
522 Ga0500634_0051855 3300053161 Bacteria 2206
523 Ga0500634_0054635 3300053161 Bacteria 2139
524 Ga0500645_002508 3300053730 Bacteria 8120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10212797 Ga0075366_102127972 197
2 3300014326 Ga0157380_10635240 Ga0157380_106352402 197
3 3300028794 Ga0307515_10081570 Ga0307515_100815702 198
4 3300031911 Ga0307412_10094180 Ga0307412_100941802 200
5 3300042876 Ga0451577_0003205 Ga0451577_0003205_2068_2676 200
6 3300005262 Ga0065165_1000016 Ga0065165_1000016256 201
7 3300031548 Ga0307408_100068273 Ga0307408_1000682732 201
8 3300031911 Ga0307412_10153678 Ga0307412_101536782 201
9 3300032002 Ga0307416_100464665 Ga0307416_1004646652 201
10 3300041451 Ga0451791_0872189 Ga0451791_0872189_30_653 201
11 iso_pu_bacteria 2643221660 2644340887 201
12 iso_pu_bacteria 2881101125 2881103132 201
13 3300031548 Ga0307408_100613403 Ga0307408_1006134031 202
14 3300041413 Ga0439465_0171491 Ga0439465_0171491_103_720 202
15 iso_pu_bacteria 2831864461 2831864659 202
16 3300042006 Ga0439432_094748 Ga0439432_094748_72_710 203
17 3300042007 Ga0439449_0007077 Ga0439449_0007077_3005_3643 203
18 3300042015 Ga0439462_0019510 Ga0439462_0019510_689_1327 203
19 3300042131 Ga0450894_032908 Ga0450894_032908_10_648 203
20 3300044842 Ga0466957_0203821 Ga0466957_0203821_71_751 203
21 3300014326 Ga0157380_10216410 Ga0157380_102164102 204
22 3300025273 Ga0209673_1024367 Ga0209673_10243672 204
23 3300025295 Ga0209564_1000008 Ga0209564_1000008290 204
24 3300028794 Ga0307515_10276532 Ga0307515_102765322 204
25 3300041406 Ga0439439_0064745 Ga0439439_0064745_89_727 204
26 3300042007 Ga0439449_0120662 Ga0439449_0120662_241_879 204
27 3300053156 Ga0500622_0003254 Ga0500622_0003254_4010_4651 204
28 3300005331 Ga0070670_100755125 Ga0070670_1007551251 205
29 3300005339 Ga0070660_100046918 Ga0070660_1000469184 205
30 3300005543 Ga0070672_100070719 Ga0070672_1000707194 205
31 3300005564 Ga0070664_100158377 Ga0070664_1001583772 205
32 3300006846 Ga0075430_100059404 Ga0075430_1000594044 205
33 3300006880 Ga0075429_100003110 Ga0075429_10000311012 205
34 3300009148 Ga0105243_10002036 Ga0105243_1000203618 205
35 3300025907 Ga0207645_10189055 Ga0207645_101890552 205
36 3300025919 Ga0207657_10113559 Ga0207657_101135592 205
37 3300025920 Ga0207649_10054285 Ga0207649_100542852 205
38 3300025932 Ga0207690_10028634 Ga0207690_100286342 205
39 3300025933 Ga0207706_10424168 Ga0207706_104241682 205
40 3300025940 Ga0207691_10064225 Ga0207691_100642252 205
41 3300026121 Ga0207683_10690801 Ga0207683_106908012 205
42 3300042134 Ga0450898_047598 Ga0450898_047598_29_679 205
43 3300042876 Ga0451577_0017089 Ga0451577_0017089_406_1035 205
44 3300044673 Ga0453683_0071467 Ga0453683_0071467_95_724 205
45 3300044712 Ga0453684_0029360 Ga0453684_0029360_6366_6995 205
46 3300045051 Ga0451576_0002262 Ga0451576_0002262_4795_5424 205
47 3300045051 Ga0451576_0798666 Ga0451576_0798666_31_681 205
48 3300046539 Ga0495621_0005819 Ga0495621_0005819_1144_1782 205
49 3300049682 Ga0501252_001787 Ga0501252_001787_547_1194 205
50 3300050508 nmdc:mga09592_17097_c1 nmdc:mga09592_17097_c1_2164_2796 205
51 3300050509 nmdc:mga0qj67_68189_c1 nmdc:mga0qj67_68189_c1_942_1574 205
52 3300053093 Ga0500651_0037654 Ga0500651_0037654_1958_2584 205
53 3300046615 Ga0495656_0085837 Ga0495656_0085837_277_936 206
54 3300049581 Ga0501047_0043447 Ga0501047_0043447_421_1056 206
55 iso_pu_bacteria 2885192300 2885196939 206
56 3300030732 Ga0316176_1121395 Ga0316176_11213952 207
57 3300037471 Ga0395905_0672583 Ga0395905_0672583_34_693 207
58 3300038443 Ga0395901_0354278 Ga0395901_0354278_664_1323 207
59 3300046528 Ga0495642_0009294 Ga0495642_0009294_164_820 207
60 3300046615 Ga0495656_0081875 Ga0495656_0081875_52_708 207
61 3300047447 Ga0495685_020122 Ga0495685_020122_1511_2167 207
62 3300048090 Ga0495615_0067048 Ga0495615_0067048_195_851 207
63 iso_pu_bacteria 2643221609 2644062200 207
64 iso_pu_bacteria 2643221611 2644071388 207
65 iso_pu_bacteria 2738543012 2739245811 207
66 iso_pu_bacteria 2738543013 2739248273 207
67 iso_pu_bacteria 2816332133 2816470505 207
68 3300005327 Ga0070658_10220862 Ga0070658_102208622 208
69 3300005327 Ga0070658_10295138 Ga0070658_102951381 208
70 3300005327 Ga0070658_10666850 Ga0070658_106668502 208
71 3300005328 Ga0070676_10045299 Ga0070676_100452993 208
72 3300005328 Ga0070676_10364448 Ga0070676_103644482 208
73 3300005329 Ga0070683_100015313 Ga0070683_1000153137 208
74 3300005329 Ga0070683_100052505 Ga0070683_1000525052 208
75 3300005331 Ga0070670_100076880 Ga0070670_1000768802 208
76 3300005333 Ga0070677_10039131 Ga0070677_100391312 208
77 3300005333 Ga0070677_10090520 Ga0070677_100905202 208
78 3300005336 Ga0070680_100088305 Ga0070680_1000883054 208
79 3300005339 Ga0070660_100411911 Ga0070660_1004119112 208
80 3300005343 Ga0070687_100072232 Ga0070687_1000722322 208
81 3300005343 Ga0070687_100145863 Ga0070687_1001458632 208
82 3300005344 Ga0070661_100136306 Ga0070661_1001363062 208
83 3300005347 Ga0070668_100314142 Ga0070668_1003141422 208
84 3300005347 Ga0070668_101030418 Ga0070668_1010304181 208
85 3300005353 Ga0070669_100328562 Ga0070669_1003285622 208
86 3300005353 Ga0070669_100456928 Ga0070669_1004569282 208
87 3300005353 Ga0070669_100466803 Ga0070669_1004668032 208
88 3300005354 Ga0070675_100268604 Ga0070675_1002686042 208
89 3300005355 Ga0070671_100035484 Ga0070671_1000354846 208
90 3300005355 Ga0070671_100327108 Ga0070671_1003271082 208
91 3300005356 Ga0070674_100017730 Ga0070674_1000177301 208
92 3300005356 Ga0070674_100061426 Ga0070674_1000614265 208
93 3300005364 Ga0070673_100857928 Ga0070673_1008579282 208
94 3300005365 Ga0070688_100313428 Ga0070688_1003134281 208
95 3300005366 Ga0070659_100063655 Ga0070659_1000636552 208
96 3300005366 Ga0070659_100412390 Ga0070659_1004123902 208
97 3300005366 Ga0070659_100729185 Ga0070659_1007291851 208
98 3300005367 Ga0070667_100341786 Ga0070667_1003417862 208
99 3300005367 Ga0070667_100422440 Ga0070667_1004224402 208
100 3300005441 Ga0070700_100059926 Ga0070700_1000599262 208
101 3300005455 Ga0070663_100332819 Ga0070663_1003328191 208
102 3300005456 Ga0070678_100267810 Ga0070678_1002678102 208
103 3300005457 Ga0070662_100179219 Ga0070662_1001792192 208
104 3300005457 Ga0070662_100256824 Ga0070662_1002568242 208
105 3300005457 Ga0070662_100358203 Ga0070662_1003582032 208
106 3300005457 Ga0070662_100701039 Ga0070662_1007010391 208
107 3300005458 Ga0070681_10017140 Ga0070681_100171406 208
108 3300005530 Ga0070679_100000726 Ga0070679_1000007262 208
109 3300005535 Ga0070684_100033577 Ga0070684_1000335775 208
110 3300005539 Ga0068853_100025786 Ga0068853_1000257862 208
111 3300005547 Ga0070693_100247333 Ga0070693_1002473332 208
112 3300005548 Ga0070665_100295173 Ga0070665_1002951732 208
113 3300005564 Ga0070664_100040469 Ga0070664_1000404696 208
114 3300005577 Ga0068857_100059410 Ga0068857_1000594102 208
115 3300005577 Ga0068857_100170250 Ga0068857_1001702504 208
116 3300005577 Ga0068857_100971589 Ga0068857_1009715892 208
117 3300005614 Ga0068856_100107506 Ga0068856_1001075064 208
118 3300005614 Ga0068856_100164256 Ga0068856_1001642564 208
119 3300005616 Ga0068852_100008793 Ga0068852_1000087932 208
120 3300005616 Ga0068852_100055318 Ga0068852_1000553182 208
121 3300005616 Ga0068852_100146421 Ga0068852_1001464212 208
122 3300005616 Ga0068852_100201128 Ga0068852_1002011283 208
123 3300005616 Ga0068852_100346910 Ga0068852_1003469102 208
124 3300005616 Ga0068852_100525745 Ga0068852_1005257452 208
125 3300005616 Ga0068852_100879402 Ga0068852_1008794022 208
126 3300005617 Ga0068859_100328060 Ga0068859_1003280602 208
127 3300005617 Ga0068859_100450942 Ga0068859_1004509423 208
128 3300005618 Ga0068864_100142530 Ga0068864_1001425302 208
129 3300005719 Ga0068861_100098115 Ga0068861_1000981151 208
130 3300005719 Ga0068861_100405089 Ga0068861_1004050892 208
131 3300005834 Ga0068851_10008923 Ga0068851_100089236 208
132 3300005834 Ga0068851_10084595 Ga0068851_100845952 208
133 3300005834 Ga0068851_10087195 Ga0068851_100871952 208
134 3300005840 Ga0068870_10239936 Ga0068870_102399362 208
135 3300005841 Ga0068863_100199500 Ga0068863_1001995002 208
136 3300005841 Ga0068863_100425884 Ga0068863_1004258842 208
137 3300005842 Ga0068858_100010452 Ga0068858_1000104522 208
138 3300005842 Ga0068858_100044054 Ga0068858_1000440542 208
139 3300005843 Ga0068860_100188461 Ga0068860_1001884612 208
140 3300005843 Ga0068860_100280748 Ga0068860_1002807482 208
141 3300005844 Ga0068862_100071690 Ga0068862_1000716902 208
142 3300006237 Ga0097621_100394116 Ga0097621_1003941162 208
143 3300006871 Ga0075434_100968364 Ga0075434_1009683642 208
144 3300006881 Ga0068865_100111887 Ga0068865_1001118872 208
145 3300006931 Ga0097620_100328051 Ga0097620_1003280512 208
146 3300009094 Ga0111539_11557540 Ga0111539_115575401 208
147 3300009148 Ga0105243_10070369 Ga0105243_100703692 208
148 3300009176 Ga0105242_10143402 Ga0105242_101434022 208
149 3300009545 Ga0105237_10516920 Ga0105237_105169202 208
150 3300009551 Ga0105238_10033306 Ga0105238_100333066 208
151 3300009551 Ga0105238_10162250 Ga0105238_101622504 208
152 3300009553 Ga0105249_10652870 Ga0105249_106528702 208
153 3300010375 Ga0105239_10307199 Ga0105239_103071991 208
154 3300013102 Ga0157371_10371754 Ga0157371_103717542 208
155 3300013104 Ga0157370_10171048 Ga0157370_101710483 208
156 3300013104 Ga0157370_10666113 Ga0157370_106661132 208
157 3300013105 Ga0157369_10070068 Ga0157369_100700681 208
158 3300013105 Ga0157369_10860438 Ga0157369_108604382 208
159 3300013296 Ga0157374_10021167 Ga0157374_100211672 208
160 3300013296 Ga0157374_10968191 Ga0157374_109681911 208
161 3300013297 Ga0157378_10774562 Ga0157378_107745622 208
162 3300013306 Ga0163162_10121698 Ga0163162_101216982 208
163 3300013306 Ga0163162_10137672 Ga0163162_101376722 208
164 3300013306 Ga0163162_10470525 Ga0163162_104705252 208
165 3300013306 Ga0163162_11315787 Ga0163162_113157871 208
166 3300013307 Ga0157372_10019258 Ga0157372_100192589 208
167 3300014326 Ga0157380_10215857 Ga0157380_102158572 208
168 3300014326 Ga0157380_10245360 Ga0157380_102453603 208
169 3300014968 Ga0157379_10017000 Ga0157379_100170007 208
170 3300017792 Ga0163161_10426384 Ga0163161_104263842 208
171 3300020082 Ga0206353_10275376 Ga0206353_102753761 208
172 3300025321 Ga0207656_10023991 Ga0207656_100239912 208
173 3300025321 Ga0207656_10028210 Ga0207656_100282102 208
174 3300025893 Ga0207682_10034500 Ga0207682_100345002 208
175 3300025893 Ga0207682_10081594 Ga0207682_100815942 208
176 3300025901 Ga0207688_10016652 Ga0207688_100166525 208
177 3300025903 Ga0207680_10123676 Ga0207680_101236762 208
178 3300025907 Ga0207645_10018626 Ga0207645_100186263 208
179 3300025908 Ga0207643_10081607 Ga0207643_100816072 208
180 3300025909 Ga0207705_10083211 Ga0207705_100832112 208
181 3300025911 Ga0207654_10374673 Ga0207654_103746732 208
182 3300025912 Ga0207707_10034449 Ga0207707_100344494 208
183 3300025914 Ga0207671_10331677 Ga0207671_103316772 208
184 3300025918 Ga0207662_10024710 Ga0207662_100247102 208
185 3300025919 Ga0207657_10315806 Ga0207657_103158062 208
186 3300025920 Ga0207649_10104963 Ga0207649_101049632 208
187 3300025921 Ga0207652_10002099 Ga0207652_1000209913 208
188 3300025923 Ga0207681_10209807 Ga0207681_102098071 208
189 3300025923 Ga0207681_10440008 Ga0207681_104400082 208
190 3300025924 Ga0207694_10027863 Ga0207694_100278633 208
191 3300025925 Ga0207650_10093635 Ga0207650_100936352 208
192 3300025926 Ga0207659_10068875 Ga0207659_100688754 208
193 3300025926 Ga0207659_10496651 Ga0207659_104966512 208
194 3300025927 Ga0207687_10220649 Ga0207687_102206492 208
195 3300025931 Ga0207644_10004993 Ga0207644_100049937 208
196 3300025931 Ga0207644_10018686 Ga0207644_100186862 208
197 3300025931 Ga0207644_10691264 Ga0207644_106912641 208
198 3300025933 Ga0207706_10010891 Ga0207706_100108912 208
199 3300025933 Ga0207706_10130319 Ga0207706_101303192 208
200 3300025934 Ga0207686_10024756 Ga0207686_100247562 208
201 3300025935 Ga0207709_10386807 Ga0207709_103868072 208
202 3300025938 Ga0207704_10235186 Ga0207704_102351862 208
203 3300025940 Ga0207691_10433306 Ga0207691_104333061 208
204 3300025941 Ga0207711_10107944 Ga0207711_101079442 208
205 3300025941 Ga0207711_10168997 Ga0207711_101689972 208
206 3300025942 Ga0207689_10000709 Ga0207689_1000070918 208
207 3300025944 Ga0207661_10027821 Ga0207661_100278215 208
208 3300025944 Ga0207661_10068893 Ga0207661_100688933 208
209 3300025944 Ga0207661_10142246 Ga0207661_101422464 208
210 3300025945 Ga0207679_10035875 Ga0207679_100358752 208
211 3300025945 Ga0207679_10054754 Ga0207679_100547541 208
212 3300025945 Ga0207679_10240965 Ga0207679_102409652 208
213 3300025949 Ga0207667_10506147 Ga0207667_105061472 208
214 3300025960 Ga0207651_10112264 Ga0207651_101122644 208
215 3300025972 Ga0207668_10469239 Ga0207668_104692391 208
216 3300025981 Ga0207640_10903589 Ga0207640_109035891 208
217 3300025986 Ga0207658_10146007 Ga0207658_101460072 208
218 3300026035 Ga0207703_10021855 Ga0207703_100218553 208
219 3300026041 Ga0207639_10074964 Ga0207639_100749642 208
220 3300026041 Ga0207639_10383191 Ga0207639_103831912 208
221 3300026067 Ga0207678_10079421 Ga0207678_100794212 208
222 3300026067 Ga0207678_10323630 Ga0207678_103236302 208
223 3300026067 Ga0207678_10547272 Ga0207678_105472722 208
224 3300026075 Ga0207708_10014415 Ga0207708_100144155 208
225 3300026088 Ga0207641_10020367 Ga0207641_100203672 208
226 3300026088 Ga0207641_10195960 Ga0207641_101959602 208
227 3300026089 Ga0207648_10021655 Ga0207648_100216556 208
228 3300026089 Ga0207648_10185837 Ga0207648_101858372 208
229 3300026116 Ga0207674_10209902 Ga0207674_102099022 208
230 3300026116 Ga0207674_10241261 Ga0207674_102412611 208
231 3300026116 Ga0207674_10292049 Ga0207674_102920492 208
232 3300026118 Ga0207675_100000563 Ga0207675_10000056320 208
233 3300026118 Ga0207675_100576099 Ga0207675_1005760992 208
234 3300026121 Ga0207683_10262884 Ga0207683_102628842 208
235 3300026121 Ga0207683_10663207 Ga0207683_106632072 208
236 3300026142 Ga0207698_10050799 Ga0207698_100507992 208
237 3300026142 Ga0207698_10123812 Ga0207698_101238122 208
238 3300026142 Ga0207698_10134303 Ga0207698_101343032 208
239 3300026142 Ga0207698_10655461 Ga0207698_106554611 208
240 3300026142 Ga0207698_11223172 Ga0207698_112231721 208
241 3300028379 Ga0268266_10590298 Ga0268266_105902982 208
242 3300028380 Ga0268265_10932112 Ga0268265_109321122 208
243 3300028381 Ga0268264_10058123 Ga0268264_100581233 208
244 3300031901 Ga0307406_10077582 Ga0307406_100775824 208
245 3300031911 Ga0307412_10017947 Ga0307412_100179474 208
246 3300031995 Ga0307409_100004985 Ga0307409_1000049852 208
247 3300032002 Ga0307416_100001338 Ga0307416_10000133811 208
248 3300032126 Ga0307415_100001083 Ga0307415_1000010835 208
249 3300035116 Ga0373945_0041206 Ga0373945_0041206_31_675 208
250 3300035118 Ga0373954_0026268 Ga0373954_0026268_1121_1765 208
251 3300035121 Ga0373960_0052383 Ga0373960_0052383_319_978 208
252 3300035691 Ga0373931_0029474 Ga0373931_0029474_822_1481 208
253 3300036401 Ga0373937_0543717 Ga0373937_0543717_241_885 208
254 3300042001 Ga0439441_025247 Ga0439441_025247_50_694 208
255 3300042012 Ga0439455_0056119 Ga0439455_0056119_173_817 208
256 3300042118 Ga0450914_017008 Ga0450914_017008_75_719 208
257 3300042437 Ga0439444_0050493 Ga0439444_0050493_74_718 208
258 3300042439 Ga0439464_0008492 Ga0439464_0008492_300_944 208
259 3300042876 Ga0451577_0316444 Ga0451577_0316444_638_1270 208
260 3300045051 Ga0451576_0088554 Ga0451576_0088554_2521_3180 208
261 3300046542 Ga0495597_0001315 Ga0495597_0001315_15724_16395 208
262 3300046543 Ga0495645_0212582 Ga0495645_0212582_51_710 208
263 3300046683 Ga0495658_0294831 Ga0495658_0294831_181_825 208
264 3300047471 Ga0495684_0649241 Ga0495684_0649241_28_672 208
265 3300048904 Ga0496101_0013232 Ga0496101_0013232_439_1098 208
266 3300048907 Ga0496104_0043122 Ga0496104_0043122_2272_2931 208
267 3300048911 Ga0496108_0466647 Ga0496108_0466647_188_832 208
268 3300048911 Ga0496108_0733019 Ga0496108_0733019_79_738 208
269 3300048912 Ga0496109_0513470 Ga0496109_0513470_184_828 208
270 3300048913 Ga0496110_0070050 Ga0496110_0070050_382_1041 208
271 3300050511 nmdc:mga08y16_795594_c1 nmdc:mga08y16_795594_c1_105_749 208
272 3300053117 Ga0500593_000440 Ga0500593_000440_5300_5950 208
273 3300053156 Ga0500622_0304739 Ga0500622_0304739_16_642 208
274 3300053161 Ga0500634_0054635 Ga0500634_0054635_1311_1961 208
275 3300053730 Ga0500645_002508 Ga0500645_002508_5965_6624 209
276 3300003784 Ga0055534_1000467 Ga0055534_10004677 210
277 3300003792 Ga0055540_1033248 Ga0055540_10332481 210
278 3300003794 Ga0055531_10000158 Ga0055531_1000015875 210
279 3300005456 Ga0070678_100199916 Ga0070678_1001999162 210
280 3300005618 Ga0068864_100018085 Ga0068864_1000180854 210
281 3300006195 Ga0075366_10032903 Ga0075366_100329033 210
282 3300006353 Ga0075370_10086126 Ga0075370_100861262 210
283 3300006353 Ga0075370_10261394 Ga0075370_102613942 210
284 3300025284 Ga0209130_1001362 Ga0209130_100136214 210
285 3300025291 Ga0209675_1001272 Ga0209675_10012725 210
286 3300025292 Ga0209676_1004722 Ga0209676_10047228 210
287 3300025294 Ga0209025_1060908 Ga0209025_10609082 210
288 3300025303 Ga0209051_1000315 Ga0209051_100031519 210
289 3300025303 Ga0209051_1022154 Ga0209051_10221542 210
290 3300025304 Ga0209257_1000309 Ga0209257_100030931 210
291 3300025304 Ga0209257_1025038 Ga0209257_10250382 210
292 3300025937 Ga0207669_10241899 Ga0207669_102418992 210
293 3300026095 Ga0207676_10013160 Ga0207676_100131604 210
294 3300026121 Ga0207683_10710371 Ga0207683_107103712 210
295 3300027682 Ga0209971_1002246 Ga0209971_10022462 210
296 3300028379 Ga0268266_10029093 Ga0268266_100290935 210
297 3300028794 Ga0307515_10000472 Ga0307515_1000047295 210
298 3300041404 Ga0439436_0000328 Ga0439436_0000328_6082_6726 210
299 3300041406 Ga0439439_0006784 Ga0439439_0006784_1949_2593 210
300 3300041410 Ga0439461_0022306 Ga0439461_0022306_502_1146 210
301 3300041411 Ga0439466_0003860 Ga0439466_0003860_361_1005 210
302 3300041413 Ga0439465_0000335 Ga0439465_0000335_1507_2151 210
303 3300041997 Ga0439431_0008709 Ga0439431_0008709_162_806 210
304 3300041999 Ga0439433_0001040 Ga0439433_0001040_420_1064 210
305 3300042004 Ga0439445_0007897 Ga0439445_0007897_1525_2169 210
306 3300042006 Ga0439432_001277 Ga0439432_001277_5122_5766 210
307 3300042007 Ga0439449_0001202 Ga0439449_0001202_4492_5136 210
308 3300042007 Ga0439449_0003003 Ga0439449_0003003_1574_2218 210
309 3300042010 Ga0439452_003061 Ga0439452_003061_3679_4323 210
310 3300042156 Ga0439446_0001983 Ga0439446_0001983_416_1060 210
311 3300042435 Ga0439434_0008547 Ga0439434_0008547_583_1227 210
312 3300044683 Ga0466965_0181884 Ga0466965_0181884_151_789 210
313 3300050490 nmdc:mga03n38_1785_c1 nmdc:mga03n38_1785_c1_1263_1898 210
314 3300050493 nmdc:mga0k408_6410_c1 nmdc:mga0k408_6410_c1_5043_5678 210
315 3300050496 nmdc:mga07m45_118871_c1 nmdc:mga07m45_118871_c1_565_1200 210
316 3300050496 nmdc:mga07m45_14610_c1 nmdc:mga07m45_14610_c1_914_1549 210
317 3300031235 Ga0265330_10000046 Ga0265330_100000466 211
318 3300031238 Ga0265332_10000028 Ga0265332_10000028106 211
319 3300031240 Ga0265320_10059335 Ga0265320_100593352 211
320 3300031241 Ga0265325_10002346 Ga0265325_100023465 211
321 3300031247 Ga0265340_10009685 Ga0265340_100096854 211
322 3300031711 Ga0265314_10000054 Ga0265314_10000054106 211
323 3300046475 Ga0495639_0025613 Ga0495639_0025613_449_1087 211
324 3300046522 Ga0495643_0099675 Ga0495643_0099675_838_1473 211
325 3300048913 Ga0496110_0041576 Ga0496110_0041576_1605_2267 211
326 iso_pu_bacteria 2974320154 2974320400 211
327 3300009177 Ga0105248_10816080 Ga0105248_108160801 212
328 3300013306 Ga0163162_10119727 Ga0163162_101197272 212
329 3300014497 Ga0182008_10005957 Ga0182008_100059574 212
330 3300015261 Ga0182006_1024985 Ga0182006_10249852 212
331 3300015262 Ga0182007_10017245 Ga0182007_100172452 212
332 3300017792 Ga0163161_10229800 Ga0163161_102298002 212
333 3300025986 Ga0207658_10536704 Ga0207658_105367042 212
334 3300026121 Ga0207683_10207014 Ga0207683_102070142 212
335 3300046528 Ga0495642_0113558 Ga0495642_0113558_291_932 212
336 3300046543 Ga0495645_0273911 Ga0495645_0273911_163_804 212
337 3300046674 Ga0495588_0096722 Ga0495588_0096722_670_1311 212
338 3300046675 Ga0495657_0124515 Ga0495657_0124515_414_1055 212
339 3300048088 Ga0495602_0585636 Ga0495602_0585636_38_706 212
340 3300048904 Ga0496101_0001103 Ga0496101_0001103_12299_12940 212
341 3300048906 Ga0496103_0020196 Ga0496103_0020196_743_1384 212
342 3300048908 Ga0496105_0010700 Ga0496105_0010700_1887_2528 212
343 3300048909 Ga0496106_0461595 Ga0496106_0461595_307_948 212
344 3300048910 Ga0496107_0382172 Ga0496107_0382172_353_994 212
345 3300048911 Ga0496108_0092049 Ga0496108_0092049_1418_2059 212
346 3300048912 Ga0496109_0091319 Ga0496109_0091319_1921_2562 212
347 3300048913 Ga0496110_0059350 Ga0496110_0059350_704_1345 212
348 3300048913 Ga0496110_0595205 Ga0496110_0595205_258_899 212
349 3300048917 Ga0496114_0099856 Ga0496114_0099856_321_962 212
350 3300049568 Ga0501031_0003842 Ga0501031_0003842_4223_4870 212
351 3300053085 Ga0495619_0310713 Ga0495619_0310713_387_1028 212
352 3300006051 Ga0075364_10014749 Ga0075364_100147492 213
353 3300009098 Ga0105245_10082031 Ga0105245_100820313 213
354 3300014497 Ga0182008_10016419 Ga0182008_100164195 213
355 3300014969 Ga0157376_10007703 Ga0157376_100077032 213
356 3300025927 Ga0207687_10021336 Ga0207687_100213362 213
357 3300025942 Ga0207689_10128863 Ga0207689_101288632 213
358 3300025949 Ga0207667_10200640 Ga0207667_102006402 213
359 3300026023 Ga0207677_10015319 Ga0207677_100153194 213
360 3300048926 Ga0496123_0206778 Ga0496123_0206778_146_805 213
361 iso_pu_bacteria 2547132374 2548499029 213
362 iso_pu_bacteria 2643221717 2644648486 213
363 iso_pu_bacteria 2954767861 2954768902 213
364 3300005336 Ga0070680_100585855 Ga0070680_1005858551 214
365 3300005339 Ga0070660_100114649 Ga0070660_1001146492 214
366 3300005344 Ga0070661_100178941 Ga0070661_1001789412 214
367 3300005435 Ga0070714_100085568 Ga0070714_1000855682 214
368 3300005530 Ga0070679_100022540 Ga0070679_1000225405 214
369 3300005543 Ga0070672_100626244 Ga0070672_1006262442 214
370 3300005563 Ga0068855_100080354 Ga0068855_1000803543 214
371 3300009093 Ga0105240_10019777 Ga0105240_100197774 214
372 3300009551 Ga0105238_10215121 Ga0105238_102151212 214
373 3300015683 Ga0183362_10003 Ga0183362_10003584 214
374 3300017792 Ga0163161_10176475 Ga0163161_101764752 214
375 3300025919 Ga0207657_10030449 Ga0207657_100304495 214
376 3300025921 Ga0207652_10249008 Ga0207652_102490082 214
377 3300025940 Ga0207691_10058892 Ga0207691_100588924 214
378 3300026067 Ga0207678_10246562 Ga0207678_102465622 214
379 3300031548 Ga0307408_100000288 Ga0307408_10000028841 214
380 3300031901 Ga0307406_10001524 Ga0307406_100015242 214
381 3300031911 Ga0307412_10125412 Ga0307412_101254122 214
382 3300038443 Ga0395901_0261044 Ga0395901_0261044_829_1512 214
383 3300046615 Ga0495656_0000090 Ga0495656_0000090_23055_23717 214
384 iso_pu_bacteria 2643221570 2643867766 214
385 iso_pu_bacteria 2643221596 2643991629 214
386 iso_pu_bacteria 2643221628 2644161840 214
387 iso_pu_bacteria 2643221652 2644293375 214
388 iso_pu_bacteria 2643221683 2644467029 214
389 iso_pu_bacteria 2842677519 2842679821 214
390 iso_pu_bacteria 2919462493 2919463919 214
391 iso_pu_bacteria 2929520902 2929522935 214
392 iso_pu_bacteria 2990710928 2990713924 214
393 3300006038 Ga0075365_10011592 Ga0075365_100115926 215
394 3300030742 Ga0316183_1009331 Ga0316183_10093312 215
395 3300030745 Ga0316182_1126101 Ga0316182_11261012 215
396 3300050492 nmdc:mga0yw44_114821_c1 nmdc:mga0yw44_114821_c1_117_791 215
397 3300006195 Ga0075366_10150640 Ga0075366_101506402 216
398 3300009176 Ga0105242_10006501 Ga0105242_100065018 216
399 3300025934 Ga0207686_10070032 Ga0207686_100700322 216
400 3300025935 Ga0207709_10754528 Ga0207709_107545281 216
401 3300030731 Ga0316177_1007507 Ga0316177_10075072 216
402 3300030744 Ga0316181_1251452 Ga0316181_12514521 216
403 3300031251 Ga0265327_10001654 Ga0265327_1000165428 216
404 3300031548 Ga0307408_100192952 Ga0307408_1001929522 216
405 3300031731 Ga0307405_10072055 Ga0307405_100720552 216
406 3300031824 Ga0307413_10104999 Ga0307413_101049992 216
407 3300031901 Ga0307406_10003957 Ga0307406_100039577 216
408 iso_pu_bacteria 2842733646 2842736365 216
409 iso_pu_bacteria 2842747753 2842748873 216
410 iso_pu_bacteria 2904541872 2904545135 216
411 iso_pu_bacteria 2929160207 2929165313 216
412 3300005353 Ga0070669_100023404 Ga0070669_1000234042 217
413 3300013105 Ga0157369_11160639 Ga0157369_111606391 217
414 3300025923 Ga0207681_10184792 Ga0207681_101847922 217
415 3300048926 Ga0496123_0000274 Ga0496123_0000274_8010_8666 217
416 3300003773 Ga0055537_1000717 Ga0055537_10007172 218
417 3300003781 Ga0055536_1009441 Ga0055536_10094415 218
418 3300003784 Ga0055534_1000337 Ga0055534_100033727 218
419 3300003790 Ga0055528_1013900 Ga0055528_10139002 218
420 3300003792 Ga0055540_1007603 Ga0055540_10076032 218
421 3300005288 Ga0065714_10068656 Ga0065714_100686566 218
422 3300006038 Ga0075365_10041123 Ga0075365_100411232 218
423 3300006048 Ga0075363_100051066 Ga0075363_1000510662 218
424 3300006048 Ga0075363_100121138 Ga0075363_1001211382 218
425 3300006051 Ga0075364_10042871 Ga0075364_100428712 218
426 3300006058 Ga0075432_10022467 Ga0075432_100224672 218
427 3300006353 Ga0075370_10053139 Ga0075370_100531392 218
428 3300006353 Ga0075370_10347755 Ga0075370_103477552 218
429 3300006946 Ga0079104_1021809 Ga0079104_10218092 218
430 3300006948 Ga0099826_10001050 Ga0099826_100010503 218
431 3300009148 Ga0105243_10464865 Ga0105243_104648652 218
432 3300011119 Ga0105246_10061099 Ga0105246_100610993 218
433 3300013100 Ga0157373_10084481 Ga0157373_100844812 218
434 3300014497 Ga0182008_10018374 Ga0182008_100183742 218
435 3300017792 Ga0163161_10002188 Ga0163161_100021882 218
436 3300025263 Ga0209565_1000067 Ga0209565_1000067178 218
437 3300025273 Ga0209673_1000097 Ga0209673_100009766 218
438 3300025273 Ga0209673_1020951 Ga0209673_10209512 218
439 3300025291 Ga0209675_1000038 Ga0209675_100003866 218
440 3300025292 Ga0209676_1000836 Ga0209676_100083615 218
441 3300025294 Ga0209025_1009762 Ga0209025_10097627 218
442 3300025299 Ga0209256_1057117 Ga0209256_10571172 218
443 3300025303 Ga0209051_1002634 Ga0209051_100263413 218
444 3300025304 Ga0209257_1009377 Ga0209257_10093774 218
445 3300025935 Ga0207709_10000874 Ga0207709_100008746 218
446 3300027666 Ga0209282_1000250 Ga0209282_10002503 218
447 3300027907 Ga0207428_10242322 Ga0207428_102423222 218
448 3300030733 Ga0314311_1027844 Ga0314311_10278446 218
449 3300030742 Ga0316183_1109757 Ga0316183_11097576 218
450 3300030744 Ga0316181_1068905 Ga0316181_10689051 218
451 3300030745 Ga0316182_1154859 Ga0316182_11548592 218
452 3300031548 Ga0307408_100673008 Ga0307408_1006730081 218
453 3300031911 Ga0307412_10164062 Ga0307412_101640622 218
454 3300031911 Ga0307412_10734841 Ga0307412_107348411 218
455 3300031995 Ga0307409_100502633 Ga0307409_1005026332 218
456 3300032004 Ga0307414_10058692 Ga0307414_100586922 218
457 3300032004 Ga0307414_10677836 Ga0307414_106778362 218
458 3300032005 Ga0307411_10013355 Ga0307411_100133553 218
459 3300042007 Ga0439449_0119735 Ga0439449_0119735_143_799 218
460 3300042125 Ga0450923_014956 Ga0450923_014956_439_1095 218
461 3300046660 Ga0495625_0001055 Ga0495625_0001055_33294_33950 218
462 3300050489 nmdc:mga03683_19810_c1 nmdc:mga03683_19810_c1_786_1442 218
463 3300050490 nmdc:mga03n38_102360_c1 nmdc:mga03n38_102360_c1_343_999 218
464 3300050492 nmdc:mga0yw44_27946_c1 nmdc:mga0yw44_27946_c1_260_916 218
465 3300050493 nmdc:mga0k408_11950_c1 nmdc:mga0k408_11950_c1_286_942 218
466 3300050496 nmdc:mga07m45_22132_c1 nmdc:mga07m45_22132_c1_1595_2251 218
467 iso_pu_bacteria 2643221672 2644399282 218
468 3300005457 Ga0070662_100025648 Ga0070662_1000256483 219
469 3300005564 Ga0070664_100034087 Ga0070664_1000340876 219
470 3300005577 Ga0068857_100082770 Ga0068857_1000827702 219
471 3300006353 Ga0075370_10044865 Ga0075370_100448652 219
472 3300009036 Ga0105244_10003265 Ga0105244_100032652 219
473 3300009148 Ga0105243_10002550 Ga0105243_1000255014 219
474 3300009545 Ga0105237_10590509 Ga0105237_105905092 219
475 3300013100 Ga0157373_10237622 Ga0157373_102376222 219
476 3300014497 Ga0182008_10015193 Ga0182008_100151935 219
477 3300015261 Ga0182006_1008452 Ga0182006_10084524 219
478 3300015262 Ga0182007_10000951 Ga0182007_100009517 219
479 3300025728 Ga0207655_1000639 Ga0207655_100063925 219
480 3300025904 Ga0207647_10068109 Ga0207647_100681091 219
481 3300025911 Ga0207654_10122354 Ga0207654_101223542 219
482 3300025920 Ga0207649_10073139 Ga0207649_100731392 219
483 3300025932 Ga0207690_10075515 Ga0207690_100755152 219
484 3300025935 Ga0207709_10008146 Ga0207709_100081464 219
485 3300025945 Ga0207679_10218149 Ga0207679_102181492 219
486 3300026116 Ga0207674_10093207 Ga0207674_100932072 219
487 3300026142 Ga0207698_10072618 Ga0207698_100726182 219
488 3300048905 Ga0496102_0318861 Ga0496102_0318861_297_974 219
489 3300048919 Ga0496116_0042660 Ga0496116_0042660_1960_2637 219
490 3300048920 Ga0496117_0109794 Ga0496117_0109794_970_1632 219
491 3300048924 Ga0496121_0111006 Ga0496121_0111006_1148_1825 219
492 3300048927 Ga0496124_0394049 Ga0496124_0394049_191_868 219
493 3300048928 Ga0496125_0030178 Ga0496125_0030178_3338_4015 219
494 3300050496 nmdc:mga07m45_9703_c2 nmdc:mga07m45_9703_c2_1951_2628 219
495 3300053136 Ga0500559_0005631 Ga0500559_0005631_1136_1798 219
496 iso_pu_bacteria 2928115317 2928120655 219
497 3300025294 Ga0209025_1001066 Ga0209025_100106620 220
498 iso_pu_bacteria 2513020051 2513229175 220
499 iso_pu_bacteria 2643221658 2644325563 220
500 iso_pu_bacteria 2904449895 2904452449 220
501 iso_pu_bacteria 2904456579 2904460952 220
502 iso_pu_bacteria 2945945610 2945946055 220
503 3300046515 Ga0495620_0031508 Ga0495620_0031508_1245_1979 221
504 3300046520 Ga0495637_0006661 Ga0495637_0006661_3240_3974 221
505 3300046530 Ga0495654_0089739 Ga0495654_0089739_302_1036 221
506 3300046660 Ga0495625_0035184 Ga0495625_0035184_161_895 221
507 3300046665 Ga0495661_0073122 Ga0495661_0073122_704_1438 221
508 3300046691 Ga0495670_0047471 Ga0495670_0047471_132_866 221
509 3300053079 Ga0500610_0032848 Ga0500610_0032848_1371_2105 221
510 3300053117 Ga0500593_002479 Ga0500593_002479_2687_3421 221
511 3300053158 Ga0500627_0032829 Ga0500627_0032829_1289_2023 221
512 3300053161 Ga0500634_0051855 Ga0500634_0051855_555_1289 221
513 3300003781 Ga0055536_1009252 Ga0055536_10092522 222
514 3300003791 Ga0055530_10010358 Ga0055530_100103584 222
515 3300003792 Ga0055540_1003024 Ga0055540_10030242 222
516 3300003792 Ga0055540_1007907 Ga0055540_10079072 222
517 3300003792 Ga0055540_1013616 Ga0055540_10136162 222
518 3300003794 Ga0055531_10002327 Ga0055531_1000232713 222
519 3300006038 Ga0075365_10412335 Ga0075365_104123351 222
520 3300006177 Ga0075362_10021518 Ga0075362_100215182 222
521 3300006186 Ga0075369_10028056 Ga0075369_100280562 222
522 3300025292 Ga0209676_1000739 Ga0209676_100073931 222
523 3300025292 Ga0209676_1066833 Ga0209676_10668332 222
524 3300025298 Ga0209050_1002666 Ga0209050_10026662 222
525 3300025303 Ga0209051_1001398 Ga0209051_10013982 222
526 3300025303 Ga0209051_1001450 Ga0209051_100145023 222
527 3300025304 Ga0209257_1000057 Ga0209257_1000057229 222
528 3300031731 Ga0307405_10035253 Ga0307405_100352532 222
529 3300031731 Ga0307405_10222198 Ga0307405_102221981 222
530 3300032002 Ga0307416_100201437 Ga0307416_1002014372 222
531 3300032005 Ga0307411_10152219 Ga0307411_101522192 222
532 3300050490 nmdc:mga03n38_40351_c1 nmdc:mga03n38_40351_c1_311_979 222
533 3300050516 nmdc:mga0sz30_12441_c1 nmdc:mga0sz30_12441_c1_470_1138 222
534 3300031649 Ga0307514_10038626 Ga0307514_100386263 224
535 3300041997 Ga0439431_0045688 Ga0439431_0045688_336_1010 224
536 3300042002 Ga0439442_004178 Ga0439442_004178_2006_2680 224
537 3300042122 Ga0450920_041978 Ga0450920_041978_193_867 224
538 3300042127 Ga0450890_021150 Ga0450890_021150_148_822 224
539 3300042145 Ga0450906_007073 Ga0450906_007073_1366_2040 224
540 3300042184 Ga0450908_006998 Ga0450908_006998_929_1603 224
541 3300042531 Ga0450918_000496 Ga0450918_000496_802_1476 224
542 3300012502 Ga0157347_1001964 Ga0157347_10019641 230
543 3300017792 Ga0163161_10001265 Ga0163161_100012652 230
544 3300031911 Ga0307412_10172712 Ga0307412_101727122 230
545 3300013104 Ga0157370_10012858 Ga0157370_100128582 231
546 3300032002 Ga0307416_100030507 Ga0307416_1000305072 231
547 iso_pu_bacteria 2945984333 2945987902 234
548 3300005844 Ga0068862_100057075 Ga0068862_1000570752 236
549 3300046674 Ga0495588_0188790 Ga0495588_0188790_183_923 236
550 3300003187 JGI25151J46595_10004995 JGI25151J46595_100049956 238
551 3300006195 Ga0075366_10129633 Ga0075366_101296332 238
552 3300006353 Ga0075370_10087024 Ga0075370_100870242 238
553 3300025258 Ga0209129_1006468 Ga0209129_10064682 238
554 3300025294 Ga0209025_1000174 Ga0209025_1000174122 238
555 3300025935 Ga0207709_10025717 Ga0207709_100257175 238
556 3300050493 nmdc:mga0k408_121210_c1 nmdc:mga0k408_121210_c1_442_1158 238
557 3300050496 nmdc:mga07m45_30534_c1 nmdc:mga07m45_30534_c1_941_1657 238
558 3300050516 nmdc:mga0sz30_76285_c1 nmdc:mga0sz30_76285_c1_482_1198 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01464

SLT

Transglycosylase SLT domain

126

232

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fpn-assembly1.cif.gz_B lytic transglycosylase in action 0.8534 114 219
8gf1-assembly1.cif.gz_A crystal structure of soluble lytic transglycosylase cj0843 of campylobacter jejuni in complex with lv8060 inhibitor 0.8397 125 222
6h5f-assembly1.cif.gz_A ltga disordered helix 0.8027 113 223
5o1j-assembly1.cif.gz_A lytic transglycosylase in action 0.7612 113 219
7eyb-assembly1.cif.gz_J core proteins 0.7581 113 217
ID Description Score Start End Superfamily
1slyA03 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8446 113 222 1.10.530.10
af_P0AEZ7_97_250_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.8148 110 217 1.10.530.10
af_A0A1D6QSC1_388_533_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7646 113 228 1.10.530.10
4cfoB02 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.7342 110 218 1.10.530.10
af_P0C960_18_203_1.10.530.10 Mainly Alpha;Orthogonal Bundle;Lysozyme; 0.6941 109 219 1.10.530.10
ID Description Score Start End GO Terms
AF-A0A7U9A752-F1-model_v4 deleted 0.9568 77 226
AF-A0A519EP93-F1-model_v4 Lytic transglycosylase domain-containing protein 0.9538 54 226
AF-V2IPJ9-F1-model_v4 Lytic transglycosylase 0.9499 70 222
AF-W7WZI7-F1-model_v4 Murein transglycosylase C 0.949 94 225
AF-A0A080M9C7-F1-model_v4 Murein transglycosylase C 0.9417 87 226

Feature Viewer

pLDDT pTM Quality
76.71 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map