F463510

General Info

Members Datasets Scaffolds Average Seq Length
558 330 1116 536

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2902792274|2902797421
Length 568
Sequence AVSDQNQIKVEYVEAGDAIPHSALSAIPGNAPAVTDDVNSERLLDARSESQNWLTYYGAYDGQRYSLLDQINSGNVKSLSPAWIFQAGSAGHIAGSSTYAFEACPLIVDGVMFVTGWDGWFWALDAVSGELLWRYKHAVPFDVSLCCGNVNRGCAVANGKVYFVTPNAQLLALDATNGRLVWQKTIGDVRAGESASLAPLVVKNTLITGSAGGEFGVRGHIDNWDLETGEHLWRTYTVPKPGEPGSETWPADGEAWARGGANHWVTGTYDPELNLYYAGTGNPAPDFDGEVREGDNLYTDSVVALDVDTGEIKWHYQFTPHDLWDYDSTMEMTLFERDGKKLLGHFDKNGYFFVLDRTNGELQHVTPFVDRIDWGVITRDGKVTPRRYPDKEGEPVHFYPGPAGAKEWTHAAYSPKTDMFYVPVADVGATATRRRREFKEGMPYWGAAVEVDIDDMAGSVSAFDSYGDEKWRWRIDYPMAASVLATAGDLVFAGTPTGEFVALDARTGEKLWEFQCGSGHHSSPSTYAVDGKQYVVVPVGWGGWLEGIIPAMLGQGHGSALIAFALPS

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013043 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300013044 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
217 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
286 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
287 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
288 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
319 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
320 2582580736 Prauserella sp. Am3 Isolate Unclassified
321 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
322 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
323 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
324 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
325 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
326 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
327 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
328 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
329 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
330 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.6
Metatranscriptomes 19.53
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 7.53
Rhizosphere 85.66
Stem 0
Stem Tuber 0.36
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001167 3300000549 Bacteria 3965
2 JGI24739J22299_10022113 3300001989 Bacteria 2258
3 JGI24744J21845_10001243 3300002077 Bacteria 5014
4 JGI24034J26672_10002160 3300002239 Bacteria 2679
5 JGI24751J29686_10001477 3300002459 Bacteria 4904
6 Ga0006778J45830_1012866 3300003162 Bacteria 2351
7 Ga0006778J45830_1055289 3300003162 Bacteria 1745
8 JGI25406J46586_10001748 3300003203 Bacteria 10218
9 JGI25406J46586_10007760 3300003203 Bacteria 4882
10 JGI25406J46586_10010223 3300003203 Bacteria 4171
11 JGI25406J46586_10010999 3300003203 Bacteria 3983
12 Ga0006777J48905_1003837 3300003308 Bacteria 2456
13 JGI25407J50210_10005517 3300003373 Bacteria 3114
14 Ga0007417J51691_1012618 3300003544 Bacteria 2275
15 Ga0007429J51699_1010982 3300003579 Bacteria 2230
16 Ga0007429J51699_1013679 3300003579 Bacteria 2464
17 Ga0007429J51699_1044263 3300003579 Bacteria 1898
18 Ga0032354_1004748 3300003693 Bacteria 2312
19 Ga0032354_1024594 3300003693 Bacteria 2452
20 Ga0058859_10029793 3300004798 Bacteria 2283
21 Ga0058859_10055871 3300004798 Bacteria 2307
22 Ga0058863_10063212 3300004799 Bacteria 2599
23 Ga0058861_10072086 3300004800 Bacteria 2356
24 Ga0058861_11981103 3300004800 Bacteria 2616
25 Ga0058861_12054378 3300004800 Bacteria 2469
26 Ga0058860_10034803 3300004801 Bacteria 2584
27 Ga0058860_12195742 3300004801 Bacteria 2567
28 Ga0058862_10101564 3300004803 Bacteria 2467
29 Ga0058862_10178675 3300004803 Bacteria 2329
30 Ga0058862_10189429 3300004803 Bacteria 2565
31 Ga0058862_12875432 3300004803 Bacteria 2564
32 Ga0070676_10031485 3300005328 Bacteria 3031
33 Ga0070683_100020931 3300005329 Bacteria 5832
34 Ga0070683_100021735 3300005329 Bacteria 5729
35 Ga0070683_100049208 3300005329 Bacteria 3898
36 Ga0070683_100137434 3300005329 Bacteria 2315
37 Ga0070683_100172626 3300005329 Bacteria 2052
38 Ga0070690_100026382 3300005330 Bacteria 3584
39 Ga0070670_100081887 3300005331 Bacteria 2773
40 Ga0068869_100011687 3300005334 Bacteria 5769
41 Ga0068869_100014916 3300005334 Bacteria 5196
42 Ga0068869_100026539 3300005334 Bacteria 4033
43 Ga0070666_10042539 3300005335 Bacteria 3040
44 Ga0070680_100014098 3300005336 Bacteria 6241
45 Ga0070680_100095406 3300005336 Bacteria 2466
46 Ga0070680_100134533 3300005336 Bacteria 2070
47 Ga0070682_100005362 3300005337 Bacteria 7136
48 Ga0070682_100032790 3300005337 Bacteria 3152
49 Ga0068868_100015918 3300005338 Bacteria 5572
50 Ga0068868_100118947 3300005338 Bacteria 2154
51 Ga0070691_10006728 3300005341 Bacteria 5263
52 Ga0070687_100022479 3300005343 Bacteria 2982
53 Ga0070661_100016998 3300005344 Bacteria 5152
54 Ga0070692_10055424 3300005345 Bacteria 2073
55 Ga0070668_100010915 3300005347 Bacteria 6759
56 Ga0070671_100000379 3300005355 Bacteria 30613
57 Ga0070671_100050030 3300005355 Bacteria 3477
58 Ga0070671_100096313 3300005355 Bacteria 2481
59 Ga0070659_100010777 3300005366 Bacteria 6741
60 Ga0070659_100020219 3300005366 Bacteria 5054
61 Ga0070659_100035081 3300005366 Bacteria 3904
62 Ga0070709_10066356 3300005434 Bacteria 2314
63 Ga0070714_100024901 3300005435 Bacteria 4934
64 Ga0070714_100025435 3300005435 Bacteria 4886
65 Ga0070714_100157766 3300005435 Bacteria 2050
66 Ga0070713_100004203 3300005436 Bacteria 9611
67 Ga0070710_10033141 3300005437 Bacteria 2803
68 Ga0070710_10056166 3300005437 Bacteria 2227
69 Ga0070701_10019738 3300005438 Bacteria 3188
70 Ga0070711_100057795 3300005439 Bacteria 2687
71 Ga0070700_100008982 3300005441 Bacteria 5471
72 Ga0070700_100024644 3300005441 Bacteria 3535
73 Ga0070700_100026858 3300005441 Bacteria 3406
74 Ga0070694_100077454 3300005444 Bacteria 2304
75 Ga0070663_100133644 3300005455 Bacteria 1887
76 Ga0070678_100008058 3300005456 Bacteria 6286
77 Ga0070681_10080756 3300005458 Bacteria 3207
78 Ga0068867_100130062 3300005459 Bacteria 1955
79 Ga0070685_10014514 3300005466 Bacteria 4175
80 Ga0070685_10025538 3300005466 Bacteria 3252
81 Ga0070679_100028649 3300005530 Bacteria 5492
82 Ga0070684_100086734 3300005535 Bacteria 2778
83 Ga0068853_100040252 3300005539 Bacteria 3987
84 Ga0068853_100089506 3300005539 Bacteria 2703
85 Ga0070693_100014346 3300005547 Bacteria 4058
86 Ga0070693_100038801 3300005547 Bacteria 2665
87 Ga0070665_100004766 3300005548 Bacteria 14124
88 Ga0068855_100200238 3300005563 Bacteria 2248
89 Ga0070664_100011829 3300005564 Bacteria 7084
90 Ga0070664_100106009 3300005564 Bacteria 2448
91 Ga0068856_100023654 3300005614 Bacteria 5974
92 Ga0068856_100052891 3300005614 Bacteria 4005
93 Ga0068856_100059277 3300005614 Bacteria 3781
94 Ga0068856_100072075 3300005614 Bacteria 3420
95 Ga0070702_100003832 3300005615 Bacteria 6804
96 Ga0068852_100017909 3300005616 Bacteria 5569
97 Ga0068852_100018166 3300005616 Bacteria 5536
98 Ga0068852_100033198 3300005616 Bacteria 4283
99 Ga0068852_100069538 3300005616 Bacteria 3086
100 Ga0068852_100070518 3300005616 Bacteria 3066
101 Ga0068859_100057502 3300005617 Bacteria 3917
102 Ga0068864_100003545 3300005618 Bacteria 12905
103 Ga0068864_100026757 3300005618 Bacteria 4865
104 Ga0068861_100012298 3300005719 Bacteria 5970
105 Ga0068870_10000189 3300005840 Bacteria 21936
106 Ga0068863_100050054 3300005841 Bacteria 3962
107 Ga0068858_100099714 3300005842 Bacteria 2708
108 Ga0068860_100060923 3300005843 Bacteria 3586
109 Ga0081455_10001027 3300005937 Bacteria 35198
110 Ga0081455_10001544 3300005937 Bacteria 28365
111 Ga0081455_10005985 3300005937 Bacteria 13194
112 Ga0081455_10028470 3300005937 Bacteria 5105
113 Ga0081538_10000397 3300005981 Bacteria 49637
114 Ga0081538_10001212 3300005981 Bacteria 27078
115 Ga0081538_10003684 3300005981 Bacteria 14386
116 Ga0081538_10009951 3300005981 Bacteria 7854
117 Ga0081538_10027072 3300005981 Bacteria 3986
118 Ga0081540_1000312 3300005983 Bacteria 50256
119 Ga0081540_1029928 3300005983 Bacteria 3024
120 Ga0081539_10000834 3300005985 Bacteria 59270
121 Ga0081539_10001116 3300005985 Bacteria 48712
122 Ga0081539_10001410 3300005985 Bacteria 41377
123 Ga0081539_10004305 3300005985 Bacteria 15916
124 Ga0081539_10033090 3300005985 Bacteria 3154
125 Ga0081539_10035014 3300005985 Bacteria 3025
126 Ga0070717_10021853 3300006028 Bacteria 5048
127 Ga0075432_10005785 3300006058 Bacteria 4205
128 Ga0070715_10037590 3300006163 Bacteria 2004
129 Ga0070712_100039424 3300006175 Bacteria 3233
130 Ga0070712_100047517 3300006175 Bacteria 2971
131 Ga0097621_100070992 3300006237 Bacteria 2877
132 Ga0097621_100098840 3300006237 Bacteria 2452
133 Ga0068871_100005745 3300006358 Bacteria 8712
134 Ga0075430_100005761 3300006846 Bacteria 10452
135 Ga0075431_100004111 3300006847 Bacteria 14211
136 Ga0075431_100024615 3300006847 Bacteria 6171
137 Ga0075433_10010431 3300006852 Bacteria 7456
138 Ga0075434_100003608 3300006871 Bacteria 13816
139 Ga0097620_100057503 3300006931 Bacteria 3917
140 Ga0111539_10036479 3300009094 Bacteria 5944
141 Ga0111539_10091964 3300009094 Bacteria 3565
142 Ga0105245_10004392 3300009098 Bacteria 12476
143 Ga0105245_10028968 3300009098 Bacteria 4889
144 Ga0105247_10015678 3300009101 Bacteria 4537
145 Ga0114129_10116706 3300009147 Bacteria 3678
146 Ga0105241_10021155 3300009174 Bacteria 4809
147 Ga0105242_10022936 3300009176 Bacteria 4916
148 Ga0105248_10033923 3300009177 Bacteria 5704
149 Ga0105248_10115538 3300009177 Bacteria 3027
150 Ga0105237_10139520 3300009545 Bacteria 2418
151 Ga0105238_10040007 3300009551 Bacteria 4752
152 Ga0105238_10104610 3300009551 Bacteria 2812
153 Ga0105249_10007578 3300009553 Bacteria 9471
154 Ga0105239_10028396 3300010375 Bacteria 6154
155 Ga0105246_10030849 3300011119 Bacteria 3544
156 Ga0105246_10087818 3300011119 Bacteria 2233
157 Ga0154018_116725 3300013043 Bacteria 2301
158 Ga0154019_116697 3300013044 Bacteria 1918
159 Ga0154019_117904 3300013044 Bacteria 2528
160 Ga0154010_114046 3300013062 Bacteria 1893
161 Ga0157371_10036482 3300013102 Bacteria 3520
162 Ga0157369_10190807 3300013105 Bacteria 2153
163 Ga0157374_10005682 3300013296 Bacteria 10516
164 Ga0157374_10025412 3300013296 Bacteria 5318
165 Ga0157378_10086512 3300013297 Bacteria 2841
166 Ga0157372_10115801 3300013307 Bacteria 3073
167 Ga0157375_10085882 3300013308 Bacteria 3197
168 Ga0157375_10121317 3300013308 Bacteria 2724
169 Ga0157377_10001262 3300014745 Bacteria 10819
170 Ga0157379_10112967 3300014968 Bacteria 2441
171 Ga0197907_10712108 3300020069 Bacteria 2212
172 Ga0197907_11193090 3300020069 Bacteria 3739
173 Ga0197907_11347956 3300020069 Bacteria 2459
174 Ga0206356_10717600 3300020070 Bacteria 1939
175 Ga0206356_10760723 3300020070 Bacteria 1916
176 Ga0206356_11166442 3300020070 Bacteria 2326
177 Ga0206356_11623651 3300020070 Bacteria 2499
178 Ga0206356_11656272 3300020070 Bacteria 2725
179 Ga0206349_1063486 3300020075 Bacteria 2391
180 Ga0206349_1130736 3300020075 Bacteria 2267
181 Ga0206349_1481511 3300020075 Bacteria 2508
182 Ga0206355_1033109 3300020076 Bacteria 2567
183 Ga0206355_1101757 3300020076 Bacteria 3598
184 Ga0206355_1167982 3300020076 Bacteria 2210
185 Ga0206355_1243473 3300020076 Bacteria 3064
186 Ga0206355_1360583 3300020076 Bacteria 2639
187 Ga0206351_10042734 3300020077 Bacteria 2478
188 Ga0206351_10266398 3300020077 Bacteria 2601
189 Ga0206352_10155988 3300020078 Bacteria 2666
190 Ga0206352_10330544 3300020078 Bacteria 2620
191 Ga0206352_10545168 3300020078 Bacteria 2461
192 Ga0206350_10164620 3300020080 Bacteria 2566
193 Ga0206350_10484114 3300020080 Bacteria 2509
194 Ga0206350_11095238 3300020080 Bacteria 2889
195 Ga0206354_10133038 3300020081 Bacteria 2409
196 Ga0206354_10194144 3300020081 Bacteria 2483
197 Ga0206354_10596313 3300020081 Bacteria 4149
198 Ga0206354_11373415 3300020081 Bacteria 3345
199 Ga0206353_10532549 3300020082 Bacteria 2599
200 Ga0206353_11086046 3300020082 Bacteria 2266
201 Ga0206353_11235669 3300020082 Bacteria 1848
202 Ga0154015_1196169 3300020610 Bacteria 3155
203 Ga0154015_1271345 3300020610 Bacteria 3014
204 Ga0154015_1419653 3300020610 Bacteria 2647
205 Ga0213876_10073983 3300021384 Bacteria 1799
206 Ga0213875_10000225 3300021388 Bacteria 57756
207 Ga0213875_10000286 3300021388 Bacteria 49191
208 Ga0213875_10001346 3300021388 Bacteria 16188
209 Ga0213875_10008561 3300021388 Bacteria 5231
210 Ga0224712_10004330 3300022467 Bacteria 3815
211 Ga0224712_10005119 3300022467 Bacteria 3616
212 Ga0224712_10009256 3300022467 Bacteria 2959
213 Ga0207653_10008227 3300025885 Bacteria 3252
214 Ga0207682_10007999 3300025893 Bacteria 4199
215 Ga0207642_10059039 3300025899 Bacteria 1772
216 Ga0207688_10000417 3300025901 Bacteria 20012
217 Ga0207688_10017685 3300025901 Bacteria 3878
218 Ga0207647_10006330 3300025904 Bacteria 8612
219 Ga0207647_10062302 3300025904 Bacteria 2273
220 Ga0207699_10063834 3300025906 Bacteria 2226
221 Ga0207645_10010229 3300025907 Bacteria 6448
222 Ga0207645_10064633 3300025907 Bacteria 2338
223 Ga0207643_10000261 3300025908 Bacteria 36615
224 Ga0207654_10017256 3300025911 Bacteria 3770
225 Ga0207693_10002432 3300025915 Bacteria 16169
226 Ga0207693_10010540 3300025915 Bacteria 7501
227 Ga0207693_10038821 3300025915 Bacteria 3749
228 Ga0207663_10055281 3300025916 Bacteria 2490
229 Ga0207660_10001785 3300025917 Bacteria 14387
230 Ga0207662_10005289 3300025918 Bacteria 6860
231 Ga0207657_10018487 3300025919 Bacteria 6648
232 Ga0207649_10007284 3300025920 Bacteria 6016
233 Ga0207652_10019986 3300025921 Bacteria 5513
234 Ga0207681_10020581 3300025923 Bacteria 4184
235 Ga0207650_10000761 3300025925 Bacteria 24753
236 Ga0207650_10026777 3300025925 Bacteria 4118
237 Ga0207659_10034216 3300025926 Bacteria 3502
238 Ga0207659_10045432 3300025926 Bacteria 3097
239 Ga0207687_10003002 3300025927 Bacteria 11444
240 Ga0207687_10013358 3300025927 Bacteria 5362
241 Ga0207687_10014902 3300025927 Bacteria 5092
242 Ga0207687_10016192 3300025927 Bacteria 4895
243 Ga0207700_10011239 3300025928 Bacteria 5699
244 Ga0207664_10023254 3300025929 Bacteria 4640
245 Ga0207664_10024695 3300025929 Bacteria 4519
246 Ga0207644_10009429 3300025931 Bacteria 6409
247 Ga0207644_10024247 3300025931 Bacteria 4163
248 Ga0207706_10056098 3300025933 Bacteria 3474
249 Ga0207706_10061605 3300025933 Bacteria 3304
250 Ga0207706_10068445 3300025933 Bacteria 3124
251 Ga0207709_10006789 3300025935 Bacteria 6403
252 Ga0207669_10002929 3300025937 Bacteria 7332
253 Ga0207665_10002140 3300025939 Bacteria 13357
254 Ga0207691_10018372 3300025940 Bacteria 6624
255 Ga0207691_10036270 3300025940 Bacteria 4568
256 Ga0207711_10062713 3300025941 Bacteria 3207
257 Ga0207711_10065025 3300025941 Bacteria 3152
258 Ga0207689_10005920 3300025942 Bacteria 10830
259 Ga0207689_10061345 3300025942 Bacteria 3092
260 Ga0207689_10074010 3300025942 Bacteria 2799
261 Ga0207661_10009581 3300025944 Bacteria 6953
262 Ga0207661_10034644 3300025944 Bacteria 3929
263 Ga0207661_10070118 3300025944 Bacteria 2861
264 Ga0207661_10100067 3300025944 Bacteria 2432
265 Ga0207679_10008502 3300025945 Bacteria 6541
266 Ga0207667_10072112 3300025949 Bacteria 3590
267 Ga0207651_10045619 3300025960 Bacteria 2941
268 Ga0207677_10005733 3300026023 Bacteria 6753
269 Ga0207703_10032908 3300026035 Bacteria 4107
270 Ga0207703_10098113 3300026035 Bacteria 2477
271 Ga0207703_10153872 3300026035 Bacteria 2008
272 Ga0207639_10025198 3300026041 Bacteria 4312
273 Ga0207678_10005211 3300026067 Bacteria 11651
274 Ga0207678_10012130 3300026067 Bacteria 7568
275 Ga0207678_10016374 3300026067 Bacteria 6509
276 Ga0207708_10000271 3300026075 Bacteria 40456
277 Ga0207702_10000505 3300026078 Bacteria 44014
278 Ga0207641_10169198 3300026088 Bacteria 1993
279 Ga0207676_10000495 3300026095 Bacteria 33137
280 Ga0207676_10031983 3300026095 Bacteria 3960
281 Ga0207674_10029427 3300026116 Bacteria 5782
282 Ga0207674_10111348 3300026116 Bacteria 2712
283 Ga0207675_100005705 3300026118 Bacteria 11914
284 Ga0207675_100024837 3300026118 Bacteria 5576
285 Ga0207683_10000524 3300026121 Bacteria 35526
286 Ga0207683_10049277 3300026121 Bacteria 3687
287 Ga0207698_10005868 3300026142 Bacteria 7630
288 Ga0207698_10030758 3300026142 Bacteria 3866
289 Ga0207428_10007798 3300027907 Bacteria 9745
290 Ga0207428_10067896 3300027907 Bacteria 2806
291 Ga0268266_10005503 3300028379 Bacteria 11794
292 Ga0268264_10061884 3300028381 Bacteria 3141
293 Ga0265766_1000237 3300030863 Bacteria 2220
294 Ga0265340_10015454 3300031247 Bacteria 3965
295 Ga0307408_100035361 3300031548 Bacteria 3505
296 Ga0307413_10092059 3300031824 Bacteria 1977
297 Ga0307518_10003635 3300031838 Bacteria 11093
298 Ga0307410_10055499 3300031852 Bacteria 2689
299 Ga0307406_10022258 3300031901 Bacteria 3758
300 Ga0307407_10032306 3300031903 Bacteria 2844
301 Ga0307409_100021941 3300031995 Bacteria 4391
302 Ga0307409_100097207 3300031995 Bacteria 2432
303 Ga0307409_100123061 3300031995 Bacteria 2201
304 Ga0307416_100002309 3300032002 Bacteria 10896
305 Ga0307416_100070184 3300032002 Bacteria 2903
306 Ga0307414_10073627 3300032004 Bacteria 2472
307 Ga0307415_100012647 3300032126 Bacteria 4888
308 Ga0307415_100064422 3300032126 Bacteria 2550
309 Ga0373926_0002072 3300035083 Bacteria 6311
310 Ga0373944_0000887 3300035089 Bacteria 7371
311 Ga0373951_0010322 3300035091 Bacteria 2096
312 Ga0373939_0006695 3300035114 Bacteria 2782
313 Ga0373957_0037957 3300035120 Bacteria 1802
314 Ga0373943_0003924 3300035170 Bacteria 6771
315 Ga0373946_0000452 3300035171 Bacteria 13505
316 Ga0373942_0006004 3300035207 Bacteria 2805
317 Ga0373924_0019734 3300035410 Bacteria 2614
318 Ga0373935_0058898 3300035692 Bacteria 2454
319 Ga0373933_0019617 3300035724 Bacteria 3822
320 Ga0373937_0010782 3300036401 Bacteria 8000
321 Ga0373937_0020349 3300036401 Bacteria 5950
322 Ga0373925_0006377 3300037068 Bacteria 8683
323 Ga0395899_0007323 3300037312 Bacteria 8535
324 Ga0395900_0159643 3300037418 Bacteria 2300
325 Ga0395898_0029492 3300037466 Bacteria 5495
326 Ga0436364_0420889 3300037853 Bacteria 36146
327 Ga0436364_0455306 3300037853 Bacteria 18481
328 Ga0436364_0872840 3300037853 Bacteria 2107
329 Ga0436364_1299740 3300037853 Bacteria 98238
330 Ga0436364_1496151 3300037853 Bacteria 11311
331 Ga0395901_0019307 3300038443 Bacteria 6968
332 Ga0436365_0584563 3300039437 Bacteria 13176
333 Ga0436365_0855511 3300039437 Bacteria 21676
334 Ga0436365_1015637 3300039437 Bacteria 4663
335 Ga0436365_1324271 3300039437 Bacteria 6495
336 Ga0436363_0839818 3300039450 Bacteria 3744
337 Ga0466972_0004294 3300044658 Bacteria 7121
338 Ga0466965_0021763 3300044683 Bacteria 3089
339 Ga0466965_0065546 3300044683 Bacteria 1820
340 Ga0466966_0001327 3300044684 Bacteria 15860
341 Ga0466963_0000174 3300044694 Bacteria 26596
342 Ga0466963_0002996 3300044694 Bacteria 9554
343 Ga0466963_0004285 3300044694 Bacteria 8279
344 Ga0466963_0017094 3300044694 Bacteria 4518
345 Ga0466963_0032908 3300044694 Bacteria 3361
346 Ga0466971_0000718 3300044719 Bacteria 13252
347 Ga0466971_0001963 3300044719 Bacteria 8710
348 Ga0466970_0004247 3300044765 Bacteria 7051
349 Ga0466957_0010409 3300044842 Bacteria 5338
350 Ga0466957_0072910 3300044842 Bacteria 2127
351 Ga0466960_0001561 3300044901 Bacteria 8381
352 Ga0466960_0036665 3300044901 Bacteria 2297
353 Ga0466959_0000228 3300045049 Bacteria 35389
354 Ga0466959_0023344 3300045049 Bacteria 4577
355 Ga0466958_0002105 3300045836 Bacteria 9870
356 Ga0466958_0003604 3300045836 Bacteria 8070
357 Ga0466958_0049626 3300045836 Bacteria 2539
358 Ga0466958_0052634 3300045836 Bacteria 2468
359 Ga0466967_0001896 3300045976 Bacteria 12634
360 Ga0466967_0010613 3300045976 Bacteria 6922
361 Ga0466967_0010669 3300045976 Bacteria 6907
362 Ga0466967_0023007 3300045976 Bacteria 5099
363 Ga0466967_0031551 3300045976 Bacteria 4462
364 Ga0466967_0034313 3300045976 Bacteria 4305
365 Ga0466967_0038170 3300045976 Bacteria 4117
366 Ga0495592_0063193 3300046454 Bacteria 2716
367 Ga0495641_0006750 3300046461 Bacteria 7365
368 Ga0495651_0006381 3300046462 Bacteria 9026
369 Ga0495651_0022134 3300046462 Bacteria 4942
370 Ga0495653_0013198 3300046463 Bacteria 6735
371 Ga0495653_0014374 3300046463 Bacteria 6459
372 Ga0495605_0001961 3300046474 Bacteria 13049
373 Ga0495662_0038420 3300046476 Bacteria 2313
374 Ga0495664_0000449 3300046477 Bacteria 20198
375 Ga0495585_0005511 3300046492 Bacteria 7968
376 Ga0495596_0031283 3300046500 Bacteria 2127
377 Ga0495583_0006012 3300046506 Bacteria 8041
378 Ga0495606_0020536 3300046507 Bacteria 4866
379 Ga0495608_0010061 3300046511 Bacteria 6598
380 Ga0495608_0051651 3300046511 Bacteria 2724
381 Ga0495608_0107164 3300046511 Bacteria 1798
382 Ga0495618_0018692 3300046514 Bacteria 4257
383 Ga0495620_0001163 3300046515 Bacteria 16111
384 Ga0495628_0029883 3300046516 Bacteria 4416
385 Ga0495628_0114202 3300046516 Bacteria 2075
386 Ga0495631_0012273 3300046518 Bacteria 4192
387 Ga0495652_0016029 3300046529 Bacteria 6706
388 Ga0495652_0047649 3300046529 Bacteria 3675
389 Ga0495652_0131002 3300046529 Bacteria 1985
390 Ga0495640_0012022 3300046533 Bacteria 6634
391 Ga0495587_0010914 3300046536 Bacteria 5765
392 Ga0495645_0016408 3300046543 Bacteria 5287
393 Ga0495667_0004492 3300046559 Bacteria 9410
394 Ga0495667_0013305 3300046559 Bacteria 5570
395 Ga0495668_0003363 3300046616 Bacteria 12057
396 Ga0495625_0010890 3300046660 Bacteria 7471
397 Ga0495635_0012561 3300046663 Bacteria 5935
398 Ga0495661_0071139 3300046665 Bacteria 2034
399 Ga0495657_0014724 3300046675 Bacteria 5740
400 Ga0495657_0020239 3300046675 Bacteria 4786
401 Ga0495646_0009174 3300046680 Bacteria 6277
402 Ga0495624_0010135 3300046690 Bacteria 6498
403 Ga0495589_0021790 3300046794 Bacteria 3274
404 Ga0495600_0018098 3300046809 Bacteria 4486
405 Ga0495660_0036139 3300046810 Bacteria 2756
406 Ga0495581_0015836 3300047315 Bacteria 4380
407 Ga0495604_0038244 3300047317 Bacteria 3775
408 Ga0495674_0016265 3300047319 Bacteria 6941
409 Ga0495674_0059184 3300047319 Bacteria 3346
410 Ga0495672_0002584 3300047320 Bacteria 16441
411 Ga0495676_0005502 3300047321 Bacteria 11617
412 Ga0495680_0005032 3300047322 Bacteria 12498
413 Ga0495680_0011913 3300047322 Bacteria 7673
414 Ga0495683_0000181 3300047323 Bacteria 61963
415 Ga0495683_0012380 3300047323 Bacteria 4478
416 Ga0495687_006145 3300047443 Bacteria 7442
417 Ga0495675_0004532 3300047444 Bacteria 8424
418 Ga0495685_003387 3300047447 Bacteria 5088
419 Ga0495673_0001734 3300047469 Bacteria 16659
420 Ga0495684_0002060 3300047471 Bacteria 16163
421 Ga0495684_0029866 3300047471 Bacteria 4184
422 Ga0495686_0018214 3300047472 Bacteria 4717
423 Ga0495602_0012209 3300048088 Bacteria 8845
424 Ga0496100_0023541 3300048903 Bacteria 3743
425 Ga0496101_0003564 3300048904 Bacteria 9713
426 Ga0496101_0064645 3300048904 Bacteria 2665
427 Ga0496102_0005604 3300048905 Bacteria 10658
428 Ga0496102_0050295 3300048905 Bacteria 3794
429 Ga0496104_0005397 3300048907 Bacteria 11184
430 Ga0496104_0015960 3300048907 Bacteria 6817
431 Ga0496104_0021478 3300048907 Bacteria 5926
432 Ga0496104_0034290 3300048907 Bacteria 4731
433 Ga0496104_0084833 3300048907 Bacteria 3023
434 Ga0496105_0012520 3300048908 Bacteria 6716
435 Ga0496105_0025577 3300048908 Bacteria 4807
436 Ga0496105_0026922 3300048908 Bacteria 4693
437 Ga0496105_0038128 3300048908 Bacteria 3959
438 Ga0496105_0158976 3300048908 Bacteria 1855
439 Ga0496106_0004952 3300048909 Bacteria 9853
440 Ga0496106_0013769 3300048909 Bacteria 5975
441 Ga0496106_0017885 3300048909 Bacteria 5242
442 Ga0496106_0037761 3300048909 Bacteria 3613
443 Ga0496107_0024845 3300048910 Bacteria 4240
444 Ga0496107_0035699 3300048910 Bacteria 3564
445 Ga0496108_0000534 3300048911 Bacteria 29627
446 Ga0496108_0011234 3300048911 Bacteria 7274
447 Ga0496108_0037136 3300048911 Bacteria 4056
448 Ga0496109_0006294 3300048912 Bacteria 9991
449 Ga0496109_0014054 3300048912 Bacteria 6959
450 Ga0496109_0029610 3300048912 Bacteria 4904
451 Ga0496109_0151612 3300048912 Bacteria 2170
452 Ga0496110_0017012 3300048913 Bacteria 6078
453 Ga0496110_0030458 3300048913 Bacteria 4652
454 Ga0496110_0038185 3300048913 Bacteria 4176
455 Ga0496110_0193732 3300048913 Bacteria 1845
456 Ga0496111_0007559 3300048914 Bacteria 7130
457 Ga0496111_0028865 3300048914 Bacteria 3934
458 Ga0496112_0009048 3300048915 Bacteria 8944
459 Ga0496112_0010375 3300048915 Bacteria 8447
460 Ga0496112_0022269 3300048915 Bacteria 6037
461 Ga0496112_0029517 3300048915 Bacteria 5303
462 Ga0496113_0002393 3300048916 Bacteria 10896
463 Ga0496113_0022005 3300048916 Bacteria 4503
464 Ga0496115_0024602 3300048918 Bacteria 4683
465 Ga0496115_0115271 3300048918 Bacteria 2209
466 Ga0496126_0003818 3300048929 Bacteria 18667
467 Ga0501315_003873 3300049531 Bacteria 1528
468 Ga0501032_0107829 3300049569 Bacteria 1844
469 Ga0501039_0199238 3300049575 Bacteria 1574
470 Ga0501042_0116202 3300049578 Bacteria 1926
471 Ga0501043_0001195 3300049579 Bacteria 22851
472 Ga0501076_0022536 3300049592 Bacteria 4841
473 Ga0501077_0034319 3300049593 Bacteria 3229
474 Ga0501077_0090950 3300049593 Bacteria 1934
475 Ga0501044_0001610 3300049823 Bacteria 26428
476 Ga0501044_0005840 3300049823 Bacteria 13631
477 nmdc:mga0qj67_54128_c1 3300050509 Bacteria 3178
478 nmdc:mga06r32_70618_c1 3300050510 Bacteria 3378
479 nmdc:mga06r32_8703_c1 3300050510 Bacteria 9148
480 nmdc:mga08y16_1370_c1 3300050511 Bacteria 24348
481 nmdc:mga08y16_266009_c1 3300050511 Bacteria 1770
482 nmdc:mga08y16_65846_c1 3300050511 Bacteria 3782
483 nmdc:mga0n895_5860_c1 3300050512 Bacteria 10329
484 nmdc:mga0rr50_5506_c1 3300050513 Bacteria 7562
485 nmdc:mga08x19_2383_c1 3300050514 Bacteria 11394
486 nmdc:mga0a205_8358_c1 3300050515 Bacteria 9415
487 Ga0500635_0002587 3300053080 Bacteria 4504
488 Ga0495619_0006735 3300053085 Bacteria 7269
489 Ga0500643_009919 3300053087 Bacteria 3593
490 Ga0500559_0007497 3300053136 Bacteria 4826
491 Ga0500616_0000251 3300053153 Bacteria 83237
492 Ga0500616_0000966 3300053153 Bacteria 31132
493 Ga0590074_002338 3300059423 Bacteria 3110
494 Ga0590077_005194 3300059426 Bacteria 2665
495 Ga0587066_000964 3300059490 Bacteria 2698
496 Ga0587066_001556 3300059490 Bacteria 2334
497 Ga0587070_001628 3300059491 Bacteria 2370
498 Ga0587073_0000752 3300059492 Bacteria 3280
499 Ga0587073_0000888 3300059492 Bacteria 3154
500 Ga0587073_0001936 3300059492 Bacteria 2559
501 Ga0587077_001804 3300059493 Bacteria 2396
502 Ga0587077_002517 3300059493 Bacteria 2185
503 Ga0587080_001591 3300059503 Bacteria 2498
504 Ga0587080_001731 3300059503 Bacteria 2435
505 Ga0587082_000480 3300059504 Bacteria 3351
506 Ga0587082_000526 3300059504 Bacteria 3276
507 Ga0587082_000997 3300059504 Bacteria 2732
508 Ga0587083_0001051 3300059505 Bacteria 2910
509 Ga0587085_000674 3300059506 Bacteria 2729
510 Ga0587085_000838 3300059506 Bacteria 2554
511 Ga0587086_000737 3300059507 Bacteria 2577
512 Ga0587088_001066 3300059508 Bacteria 2698
513 Ga0587089_001017 3300059509 Bacteria 2455
514 Ga0587090_002703 3300059510 Bacteria 1979
515 Ga0587094_001038 3300059513 Bacteria 2479
516 Ga0587099_000467 3300059622 Bacteria 2331
517 Ga0587099_000803 3300059622 Bacteria 1994
518 Ga0587101_000438 3300059623 Bacteria 2932
519 Ga0587115_000838 3300059626 Bacteria 2530
520 Ga0587128_000501 3300059630 Bacteria 2940
521 Ga0587062_001486 3300059639 Bacteria 2043
522 Ga0587068_001461 3300059641 Bacteria 2662
523 Ga0587068_002395 3300059641 Bacteria 2274
524 Ga0587069_000360 3300059642 Bacteria 3288
525 Ga0587069_000791 3300059642 Bacteria 2627
526 Ga0587075_000776 3300059644 Bacteria 2798
527 Ga0587075_000893 3300059644 Bacteria 2670
528 Ga0587078_001086 3300059646 Bacteria 2316
529 Ga0587100_000219 3300059648 Bacteria 2439
530 Ga0587102_000396 3300059649 Bacteria 2411
531 Ga0587071_001409 3300060344 Bacteria 2992
532 Ga0587071_001935 3300060344 Bacteria 2706
533 Ga0587071_002031 3300060344 Bacteria 2670
534 Ga0587071_002161 3300060344 Bacteria 2620
535 Ga0587071_002870 3300060344 Bacteria 2402
536 Ga0587071_003032 3300060344 Bacteria 2362
537 Ga0587111_0003195 3300060346 Bacteria 2297
538 Ga0587111_0003835 3300060346 Bacteria 2182
539 Ga0587111_0004083 3300060346 Bacteria 2140
540 Ga0501082_0017637 3300060353 Bacteria 6149
541 Ga0466962_0000428 3300061719 Bacteria 18202
542 Ga0530510_0011189 3300061734 Bacteria 6295
543 2902797421 2902792274 Bacteria 7270173
544 2558912714 2558860112 Bacteria 9931328
545 2583153444 2582580736 Bacteria 5325865
546 2734967969 2734482000 Bacteria 5525167
547 2816503778 2816332139 Bacteria 9138787
548 2862514749 2862507626 Bacteria 9425308
549 2866552302 2866552031 Bacteria 5824618
550 2866554661 2866552031 Bacteria 5824618
551 2870787003 2870782633 Bacteria 9624083
552 2899371364 2899370129 Bacteria 6781179
553 2899375962 2899370129 Bacteria 6781179
554 2912727291 2912723979 Bacteria 8557534
555 2917741932 2917736166 Bacteria 9690793
556 2919038145 2919034639 Bacteria 4763403
557 8054477549 8054472261 Bacteria 7464355
558 8054479085 8054472261 Bacteria 7464355
559 LJQas_1001167
560 JGI24739J22299_10022113
561 JGI24744J21845_10001243
562 JGI24034J26672_10002160
563 JGI24751J29686_10001477
564 Ga0006778J45830_1012866
565 Ga0006778J45830_1055289
566 JGI25406J46586_10001748
567 JGI25406J46586_10007760
568 JGI25406J46586_10010223
569 JGI25406J46586_10010999
570 Ga0006777J48905_1003837
571 JGI25407J50210_10005517
572 Ga0007417J51691_1012618
573 Ga0007429J51699_1010982
574 Ga0007429J51699_1013679
575 Ga0007429J51699_1044263
576 Ga0032354_1004748
577 Ga0032354_1024594
578 Ga0058859_10029793
579 Ga0058859_10055871
580 Ga0058863_10063212
581 Ga0058861_10072086
582 Ga0058861_11981103
583 Ga0058861_12054378
584 Ga0058860_10034803
585 Ga0058860_12195742
586 Ga0058862_10101564
587 Ga0058862_10178675
588 Ga0058862_10189429
589 Ga0058862_12875432
590 Ga0070676_10031485
591 Ga0070683_100020931
592 Ga0070683_100021735
593 Ga0070683_100049208
594 Ga0070683_100137434
595 Ga0070683_100172626
596 Ga0070690_100026382
597 Ga0070670_100081887
598 Ga0068869_100011687
599 Ga0068869_100014916
600 Ga0068869_100026539
601 Ga0070666_10042539
602 Ga0070680_100014098
603 Ga0070680_100095406
604 Ga0070680_100134533
605 Ga0070682_100005362
606 Ga0070682_100032790
607 Ga0068868_100015918
608 Ga0068868_100118947
609 Ga0070691_10006728
610 Ga0070687_100022479
611 Ga0070661_100016998
612 Ga0070692_10055424
613 Ga0070668_100010915
614 Ga0070671_100000379
615 Ga0070671_100050030
616 Ga0070671_100096313
617 Ga0070659_100010777
618 Ga0070659_100020219
619 Ga0070659_100035081
620 Ga0070709_10066356
621 Ga0070714_100024901
622 Ga0070714_100025435
623 Ga0070714_100157766
624 Ga0070713_100004203
625 Ga0070710_10033141
626 Ga0070710_10056166
627 Ga0070701_10019738
628 Ga0070711_100057795
629 Ga0070700_100008982
630 Ga0070700_100024644
631 Ga0070700_100026858
632 Ga0070694_100077454
633 Ga0070663_100133644
634 Ga0070678_100008058
635 Ga0070681_10080756
636 Ga0068867_100130062
637 Ga0070685_10014514
638 Ga0070685_10025538
639 Ga0070679_100028649
640 Ga0070684_100086734
641 Ga0068853_100040252
642 Ga0068853_100089506
643 Ga0070693_100014346
644 Ga0070693_100038801
645 Ga0070665_100004766
646 Ga0068855_100200238
647 Ga0070664_100011829
648 Ga0070664_100106009
649 Ga0068856_100023654
650 Ga0068856_100052891
651 Ga0068856_100059277
652 Ga0068856_100072075
653 Ga0070702_100003832
654 Ga0068852_100017909
655 Ga0068852_100018166
656 Ga0068852_100033198
657 Ga0068852_100069538
658 Ga0068852_100070518
659 Ga0068859_100057502
660 Ga0068864_100003545
661 Ga0068864_100026757
662 Ga0068861_100012298
663 Ga0068870_10000189
664 Ga0068863_100050054
665 Ga0068858_100099714
666 Ga0068860_100060923
667 Ga0081455_10001027
668 Ga0081455_10001544
669 Ga0081455_10005985
670 Ga0081455_10028470
671 Ga0081538_10000397
672 Ga0081538_10001212
673 Ga0081538_10003684
674 Ga0081538_10009951
675 Ga0081538_10027072
676 Ga0081540_1000312
677 Ga0081540_1029928
678 Ga0081539_10000834
679 Ga0081539_10001116
680 Ga0081539_10001410
681 Ga0081539_10004305
682 Ga0081539_10033090
683 Ga0081539_10035014
684 Ga0070717_10021853
685 Ga0075432_10005785
686 Ga0070715_10037590
687 Ga0070712_100039424
688 Ga0070712_100047517
689 Ga0097621_100070992
690 Ga0097621_100098840
691 Ga0068871_100005745
692 Ga0075430_100005761
693 Ga0075431_100004111
694 Ga0075431_100024615
695 Ga0075433_10010431
696 Ga0075434_100003608
697 Ga0097620_100057503
698 Ga0111539_10036479
699 Ga0111539_10091964
700 Ga0105245_10004392
701 Ga0105245_10028968
702 Ga0105247_10015678
703 Ga0114129_10116706
704 Ga0105241_10021155
705 Ga0105242_10022936
706 Ga0105248_10033923
707 Ga0105248_10115538
708 Ga0105237_10139520
709 Ga0105238_10040007
710 Ga0105238_10104610
711 Ga0105249_10007578
712 Ga0105239_10028396
713 Ga0105246_10030849
714 Ga0105246_10087818
715 Ga0154018_116725
716 Ga0154019_116697
717 Ga0154019_117904
718 Ga0154010_114046
719 Ga0157371_10036482
720 Ga0157369_10190807
721 Ga0157374_10005682
722 Ga0157374_10025412
723 Ga0157378_10086512
724 Ga0157372_10115801
725 Ga0157375_10085882
726 Ga0157375_10121317
727 Ga0157377_10001262
728 Ga0157379_10112967
729 Ga0197907_10712108
730 Ga0197907_11193090
731 Ga0197907_11347956
732 Ga0206356_10717600
733 Ga0206356_10760723
734 Ga0206356_11166442
735 Ga0206356_11623651
736 Ga0206356_11656272
737 Ga0206349_1063486
738 Ga0206349_1130736
739 Ga0206349_1481511
740 Ga0206355_1033109
741 Ga0206355_1101757
742 Ga0206355_1167982
743 Ga0206355_1243473
744 Ga0206355_1360583
745 Ga0206351_10042734
746 Ga0206351_10266398
747 Ga0206352_10155988
748 Ga0206352_10330544
749 Ga0206352_10545168
750 Ga0206350_10164620
751 Ga0206350_10484114
752 Ga0206350_11095238
753 Ga0206354_10133038
754 Ga0206354_10194144
755 Ga0206354_10596313
756 Ga0206354_11373415
757 Ga0206353_10532549
758 Ga0206353_11086046
759 Ga0206353_11235669
760 Ga0154015_1196169
761 Ga0154015_1271345
762 Ga0154015_1419653
763 Ga0213876_10073983
764 Ga0213875_10000225
765 Ga0213875_10000286
766 Ga0213875_10001346
767 Ga0213875_10008561
768 Ga0224712_10004330
769 Ga0224712_10005119
770 Ga0224712_10009256
771 Ga0207653_10008227
772 Ga0207682_10007999
773 Ga0207642_10059039
774 Ga0207688_10000417
775 Ga0207688_10017685
776 Ga0207647_10006330
777 Ga0207647_10062302
778 Ga0207699_10063834
779 Ga0207645_10010229
780 Ga0207645_10064633
781 Ga0207643_10000261
782 Ga0207654_10017256
783 Ga0207693_10002432
784 Ga0207693_10010540
785 Ga0207693_10038821
786 Ga0207663_10055281
787 Ga0207660_10001785
788 Ga0207662_10005289
789 Ga0207657_10018487
790 Ga0207649_10007284
791 Ga0207652_10019986
792 Ga0207681_10020581
793 Ga0207650_10000761
794 Ga0207650_10026777
795 Ga0207659_10034216
796 Ga0207659_10045432
797 Ga0207687_10003002
798 Ga0207687_10013358
799 Ga0207687_10014902
800 Ga0207687_10016192
801 Ga0207700_10011239
802 Ga0207664_10023254
803 Ga0207664_10024695
804 Ga0207644_10009429
805 Ga0207644_10024247
806 Ga0207706_10056098
807 Ga0207706_10061605
808 Ga0207706_10068445
809 Ga0207709_10006789
810 Ga0207669_10002929
811 Ga0207665_10002140
812 Ga0207691_10018372
813 Ga0207691_10036270
814 Ga0207711_10062713
815 Ga0207711_10065025
816 Ga0207689_10005920
817 Ga0207689_10061345
818 Ga0207689_10074010
819 Ga0207661_10009581
820 Ga0207661_10034644
821 Ga0207661_10070118
822 Ga0207661_10100067
823 Ga0207679_10008502
824 Ga0207667_10072112
825 Ga0207651_10045619
826 Ga0207677_10005733
827 Ga0207703_10032908
828 Ga0207703_10098113
829 Ga0207703_10153872
830 Ga0207639_10025198
831 Ga0207678_10005211
832 Ga0207678_10012130
833 Ga0207678_10016374
834 Ga0207708_10000271
835 Ga0207702_10000505
836 Ga0207641_10169198
837 Ga0207676_10000495
838 Ga0207676_10031983
839 Ga0207674_10029427
840 Ga0207674_10111348
841 Ga0207675_100005705
842 Ga0207675_100024837
843 Ga0207683_10000524
844 Ga0207683_10049277
845 Ga0207698_10005868
846 Ga0207698_10030758
847 Ga0207428_10007798
848 Ga0207428_10067896
849 Ga0268266_10005503
850 Ga0268264_10061884
851 Ga0265766_1000237
852 Ga0265340_10015454
853 Ga0307408_100035361
854 Ga0307413_10092059
855 Ga0307518_10003635
856 Ga0307410_10055499
857 Ga0307406_10022258
858 Ga0307407_10032306
859 Ga0307409_100021941
860 Ga0307409_100097207
861 Ga0307409_100123061
862 Ga0307416_100002309
863 Ga0307416_100070184
864 Ga0307414_10073627
865 Ga0307415_100012647
866 Ga0307415_100064422
867 Ga0373926_0002072
868 Ga0373944_0000887
869 Ga0373951_0010322
870 Ga0373939_0006695
871 Ga0373957_0037957
872 Ga0373943_0003924
873 Ga0373946_0000452
874 Ga0373942_0006004
875 Ga0373924_0019734
876 Ga0373935_0058898
877 Ga0373933_0019617
878 Ga0373937_0010782
879 Ga0373937_0020349
880 Ga0373925_0006377
881 Ga0395899_0007323
882 Ga0395900_0159643
883 Ga0395898_0029492
884 Ga0436364_0420889
885 Ga0436364_0455306
886 Ga0436364_0872840
887 Ga0436364_1299740
888 Ga0436364_1496151
889 Ga0395901_0019307
890 Ga0436365_0584563
891 Ga0436365_0855511
892 Ga0436365_1015637
893 Ga0436365_1324271
894 Ga0436363_0839818
895 Ga0466972_0004294
896 Ga0466965_0021763
897 Ga0466965_0065546
898 Ga0466966_0001327
899 Ga0466963_0000174
900 Ga0466963_0002996
901 Ga0466963_0004285
902 Ga0466963_0017094
903 Ga0466963_0032908
904 Ga0466971_0000718
905 Ga0466971_0001963
906 Ga0466970_0004247
907 Ga0466957_0010409
908 Ga0466957_0072910
909 Ga0466960_0001561
910 Ga0466960_0036665
911 Ga0466959_0000228
912 Ga0466959_0023344
913 Ga0466958_0002105
914 Ga0466958_0003604
915 Ga0466958_0049626
916 Ga0466958_0052634
917 Ga0466967_0001896
918 Ga0466967_0010613
919 Ga0466967_0010669
920 Ga0466967_0023007
921 Ga0466967_0031551
922 Ga0466967_0034313
923 Ga0466967_0038170
924 Ga0495592_0063193
925 Ga0495641_0006750
926 Ga0495651_0006381
927 Ga0495651_0022134
928 Ga0495653_0013198
929 Ga0495653_0014374
930 Ga0495605_0001961
931 Ga0495662_0038420
932 Ga0495664_0000449
933 Ga0495585_0005511
934 Ga0495596_0031283
935 Ga0495583_0006012
936 Ga0495606_0020536
937 Ga0495608_0010061
938 Ga0495608_0051651
939 Ga0495608_0107164
940 Ga0495618_0018692
941 Ga0495620_0001163
942 Ga0495628_0029883
943 Ga0495628_0114202
944 Ga0495631_0012273
945 Ga0495652_0016029
946 Ga0495652_0047649
947 Ga0495652_0131002
948 Ga0495640_0012022
949 Ga0495587_0010914
950 Ga0495645_0016408
951 Ga0495667_0004492
952 Ga0495667_0013305
953 Ga0495668_0003363
954 Ga0495625_0010890
955 Ga0495635_0012561
956 Ga0495661_0071139
957 Ga0495657_0014724
958 Ga0495657_0020239
959 Ga0495646_0009174
960 Ga0495624_0010135
961 Ga0495589_0021790
962 Ga0495600_0018098
963 Ga0495660_0036139
964 Ga0495581_0015836
965 Ga0495604_0038244
966 Ga0495674_0016265
967 Ga0495674_0059184
968 Ga0495672_0002584
969 Ga0495676_0005502
970 Ga0495680_0005032
971 Ga0495680_0011913
972 Ga0495683_0000181
973 Ga0495683_0012380
974 Ga0495687_006145
975 Ga0495675_0004532
976 Ga0495685_003387
977 Ga0495673_0001734
978 Ga0495684_0002060
979 Ga0495684_0029866
980 Ga0495686_0018214
981 Ga0495602_0012209
982 Ga0496100_0023541
983 Ga0496101_0003564
984 Ga0496101_0064645
985 Ga0496102_0005604
986 Ga0496102_0050295
987 Ga0496104_0005397
988 Ga0496104_0015960
989 Ga0496104_0021478
990 Ga0496104_0034290
991 Ga0496104_0084833
992 Ga0496105_0012520
993 Ga0496105_0025577
994 Ga0496105_0026922
995 Ga0496105_0038128
996 Ga0496105_0158976
997 Ga0496106_0004952
998 Ga0496106_0013769
999 Ga0496106_0017885
1000 Ga0496106_0037761
1001 Ga0496107_0024845
1002 Ga0496107_0035699
1003 Ga0496108_0000534
1004 Ga0496108_0011234
1005 Ga0496108_0037136
1006 Ga0496109_0006294
1007 Ga0496109_0014054
1008 Ga0496109_0029610
1009 Ga0496109_0151612
1010 Ga0496110_0017012
1011 Ga0496110_0030458
1012 Ga0496110_0038185
1013 Ga0496110_0193732
1014 Ga0496111_0007559
1015 Ga0496111_0028865
1016 Ga0496112_0009048
1017 Ga0496112_0010375
1018 Ga0496112_0022269
1019 Ga0496112_0029517
1020 Ga0496113_0002393
1021 Ga0496113_0022005
1022 Ga0496115_0024602
1023 Ga0496115_0115271
1024 Ga0496126_0003818
1025 Ga0501315_003873
1026 Ga0501032_0107829
1027 Ga0501039_0199238
1028 Ga0501042_0116202
1029 Ga0501043_0001195
1030 Ga0501076_0022536
1031 Ga0501077_0034319
1032 Ga0501077_0090950
1033 Ga0501044_0001610
1034 Ga0501044_0005840
1035 nmdc:mga0qj67_54128_c1
1036 nmdc:mga06r32_70618_c1
1037 nmdc:mga06r32_8703_c1
1038 nmdc:mga08y16_1370_c1
1039 nmdc:mga08y16_266009_c1
1040 nmdc:mga08y16_65846_c1
1041 nmdc:mga0n895_5860_c1
1042 nmdc:mga0rr50_5506_c1
1043 nmdc:mga08x19_2383_c1
1044 nmdc:mga0a205_8358_c1
1045 Ga0500635_0002587
1046 Ga0495619_0006735
1047 Ga0500643_009919
1048 Ga0500559_0007497
1049 Ga0500616_0000251
1050 Ga0500616_0000966
1051 Ga0590074_002338
1052 Ga0590077_005194
1053 Ga0587066_000964
1054 Ga0587066_001556
1055 Ga0587070_001628
1056 Ga0587073_0000752
1057 Ga0587073_0000888
1058 Ga0587073_0001936
1059 Ga0587077_001804
1060 Ga0587077_002517
1061 Ga0587080_001591
1062 Ga0587080_001731
1063 Ga0587082_000480
1064 Ga0587082_000526
1065 Ga0587082_000997
1066 Ga0587083_0001051
1067 Ga0587085_000674
1068 Ga0587085_000838
1069 Ga0587086_000737
1070 Ga0587088_001066
1071 Ga0587089_001017
1072 Ga0587090_002703
1073 Ga0587094_001038
1074 Ga0587099_000467
1075 Ga0587099_000803
1076 Ga0587101_000438
1077 Ga0587115_000838
1078 Ga0587128_000501
1079 Ga0587062_001486
1080 Ga0587068_001461
1081 Ga0587068_002395
1082 Ga0587069_000360
1083 Ga0587069_000791
1084 Ga0587075_000776
1085 Ga0587075_000893
1086 Ga0587078_001086
1087 Ga0587100_000219
1088 Ga0587102_000396
1089 Ga0587071_001409
1090 Ga0587071_001935
1091 Ga0587071_002031
1092 Ga0587071_002161
1093 Ga0587071_002870
1094 Ga0587071_003032
1095 Ga0587111_0003195
1096 Ga0587111_0003835
1097 Ga0587111_0004083
1098 Ga0501082_0017637
1099 Ga0466962_0000428
1100 Ga0530510_0011189
1101 2902797421
1102 2558912714
1103 2583153444
1104 2734967969
1105 2816503778
1106 2862514749
1107 2866552302
1108 2866554661
1109 2870787003
1110 2899371364
1111 2899375962
1112 2912727291
1113 2917741932
1114 2919038145
1115 8054477549
1116 8054479085

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

467

507

0.98

PF13570

PQQ_3

PQQ-like domain

129

177

0.94

PF01011

PQQ

PQQ enzyme repeat

159

192

0.93

PF01011

PQQ

PQQ enzyme repeat

298

328

0.92

PF01011

PQQ

PQQ enzyme repeat

489

525

0.9

PF13360

PQQ_2

PQQ-like domain

456

544

0.85

PF13360

PQQ_2

PQQ-like domain

80

316

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zcw-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.8883 31 543
1flg-assembly1.cif.gz_B crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa 0.886 33 544
6zcv-assembly1.cif.gz_A crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 0.8826 31 543
7cdl-assembly2.cif.gz_D holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath) 0.8675 35 542
6oc6-assembly2.cif.gz_B lanthanide-dependent methanol dehydrogenase xoxf from methylobacterium extorquens, in complex with lanthanum and pyrroloquinoline quinone 0.867 35 544
ID Description Score Start End Superfamily
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8963 33 544 2.140.10.10
4tqoD00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8735 35 542 2.140.10.10
6damA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8644 35 544 2.140.10.10
1flgA00 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.8448 33 544 2.140.10.10
1kb0A01 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.842 28 542 2.140.10.10
ID Description Score Start End GO Terms
AF-A0A2V9A5M0-F1-model_v4 Cytochrome c domain-containing protein 0.9483 430 515 GO:0009055
GO:0020037
GO:0046872
AF-A0A7W1LMC4-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family (EC 1.1.2.-) 0.9365 109 544 GO:0005509
GO:0016020
GO:0016614
AF-A0A848SK55-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9305 429 516 GO:0009055
GO:0020037
GO:0046872
AF-A0A7W1JR84-F1-model_v4 PQQ-dependent dehydrogenase, methanol/ethanol family (EC 1.1.2.-) 0.9223 21 543 GO:0005509
GO:0016020
GO:0016614
AF-A0A7C7PDP6-F1-model_v4 deleted 0.9183 433 544

Map