F463510
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 330 | 1116 | 536 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2902792274|2902797421 |
| Length | 568 |
| Sequence | AVSDQNQIKVEYVEAGDAIPHSALSAIPGNAPAVTDDVNSERLLDARSESQNWLTYYGAYDGQRYSLLDQINSGNVKSLSPAWIFQAGSAGHIAGSSTYAFEACPLIVDGVMFVTGWDGWFWALDAVSGELLWRYKHAVPFDVSLCCGNVNRGCAVANGKVYFVTPNAQLLALDATNGRLVWQKTIGDVRAGESASLAPLVVKNTLITGSAGGEFGVRGHIDNWDLETGEHLWRTYTVPKPGEPGSETWPADGEAWARGGANHWVTGTYDPELNLYYAGTGNPAPDFDGEVREGDNLYTDSVVALDVDTGEIKWHYQFTPHDLWDYDSTMEMTLFERDGKKLLGHFDKNGYFFVLDRTNGELQHVTPFVDRIDWGVITRDGKVTPRRYPDKEGEPVHFYPGPAGAKEWTHAAYSPKTDMFYVPVADVGATATRRRREFKEGMPYWGAAVEVDIDDMAGSVSAFDSYGDEKWRWRIDYPMAASVLATAGDLVFAGTPTGEFVALDARTGEKLWEFQCGSGHHSSPSTYAVDGKQYVVVPVGWGGWLEGIIPAMLGQGHGSALIAFALPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013043 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300013044 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 93 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 285 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 288 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 289 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 318 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 319 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 320 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 321 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 322 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 323 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 324 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 325 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 326 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 327 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 328 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 329 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 330 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.6 |
| Metatranscriptomes | 19.53 |
| Isolates | 2.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.9 |
| Nodule | 0 |
| Rhizoplane | 7.53 |
| Rhizosphere | 85.66 |
| Stem | 0 |
| Stem Tuber | 0.36 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001167 | 3300000549 | Bacteria | 3965 |
| 2 | JGI24739J22299_10022113 | 3300001989 | Bacteria | 2258 |
| 3 | JGI24744J21845_10001243 | 3300002077 | Bacteria | 5014 |
| 4 | JGI24034J26672_10002160 | 3300002239 | Bacteria | 2679 |
| 5 | JGI24751J29686_10001477 | 3300002459 | Bacteria | 4904 |
| 6 | Ga0006778J45830_1012866 | 3300003162 | Bacteria | 2351 |
| 7 | Ga0006778J45830_1055289 | 3300003162 | Bacteria | 1745 |
| 8 | JGI25406J46586_10001748 | 3300003203 | Bacteria | 10218 |
| 9 | JGI25406J46586_10007760 | 3300003203 | Bacteria | 4882 |
| 10 | JGI25406J46586_10010223 | 3300003203 | Bacteria | 4171 |
| 11 | JGI25406J46586_10010999 | 3300003203 | Bacteria | 3983 |
| 12 | Ga0006777J48905_1003837 | 3300003308 | Bacteria | 2456 |
| 13 | JGI25407J50210_10005517 | 3300003373 | Bacteria | 3114 |
| 14 | Ga0007417J51691_1012618 | 3300003544 | Bacteria | 2275 |
| 15 | Ga0007429J51699_1010982 | 3300003579 | Bacteria | 2230 |
| 16 | Ga0007429J51699_1013679 | 3300003579 | Bacteria | 2464 |
| 17 | Ga0007429J51699_1044263 | 3300003579 | Bacteria | 1898 |
| 18 | Ga0032354_1004748 | 3300003693 | Bacteria | 2312 |
| 19 | Ga0032354_1024594 | 3300003693 | Bacteria | 2452 |
| 20 | Ga0058859_10029793 | 3300004798 | Bacteria | 2283 |
| 21 | Ga0058859_10055871 | 3300004798 | Bacteria | 2307 |
| 22 | Ga0058863_10063212 | 3300004799 | Bacteria | 2599 |
| 23 | Ga0058861_10072086 | 3300004800 | Bacteria | 2356 |
| 24 | Ga0058861_11981103 | 3300004800 | Bacteria | 2616 |
| 25 | Ga0058861_12054378 | 3300004800 | Bacteria | 2469 |
| 26 | Ga0058860_10034803 | 3300004801 | Bacteria | 2584 |
| 27 | Ga0058860_12195742 | 3300004801 | Bacteria | 2567 |
| 28 | Ga0058862_10101564 | 3300004803 | Bacteria | 2467 |
| 29 | Ga0058862_10178675 | 3300004803 | Bacteria | 2329 |
| 30 | Ga0058862_10189429 | 3300004803 | Bacteria | 2565 |
| 31 | Ga0058862_12875432 | 3300004803 | Bacteria | 2564 |
| 32 | Ga0070676_10031485 | 3300005328 | Bacteria | 3031 |
| 33 | Ga0070683_100020931 | 3300005329 | Bacteria | 5832 |
| 34 | Ga0070683_100021735 | 3300005329 | Bacteria | 5729 |
| 35 | Ga0070683_100049208 | 3300005329 | Bacteria | 3898 |
| 36 | Ga0070683_100137434 | 3300005329 | Bacteria | 2315 |
| 37 | Ga0070683_100172626 | 3300005329 | Bacteria | 2052 |
| 38 | Ga0070690_100026382 | 3300005330 | Bacteria | 3584 |
| 39 | Ga0070670_100081887 | 3300005331 | Bacteria | 2773 |
| 40 | Ga0068869_100011687 | 3300005334 | Bacteria | 5769 |
| 41 | Ga0068869_100014916 | 3300005334 | Bacteria | 5196 |
| 42 | Ga0068869_100026539 | 3300005334 | Bacteria | 4033 |
| 43 | Ga0070666_10042539 | 3300005335 | Bacteria | 3040 |
| 44 | Ga0070680_100014098 | 3300005336 | Bacteria | 6241 |
| 45 | Ga0070680_100095406 | 3300005336 | Bacteria | 2466 |
| 46 | Ga0070680_100134533 | 3300005336 | Bacteria | 2070 |
| 47 | Ga0070682_100005362 | 3300005337 | Bacteria | 7136 |
| 48 | Ga0070682_100032790 | 3300005337 | Bacteria | 3152 |
| 49 | Ga0068868_100015918 | 3300005338 | Bacteria | 5572 |
| 50 | Ga0068868_100118947 | 3300005338 | Bacteria | 2154 |
| 51 | Ga0070691_10006728 | 3300005341 | Bacteria | 5263 |
| 52 | Ga0070687_100022479 | 3300005343 | Bacteria | 2982 |
| 53 | Ga0070661_100016998 | 3300005344 | Bacteria | 5152 |
| 54 | Ga0070692_10055424 | 3300005345 | Bacteria | 2073 |
| 55 | Ga0070668_100010915 | 3300005347 | Bacteria | 6759 |
| 56 | Ga0070671_100000379 | 3300005355 | Bacteria | 30613 |
| 57 | Ga0070671_100050030 | 3300005355 | Bacteria | 3477 |
| 58 | Ga0070671_100096313 | 3300005355 | Bacteria | 2481 |
| 59 | Ga0070659_100010777 | 3300005366 | Bacteria | 6741 |
| 60 | Ga0070659_100020219 | 3300005366 | Bacteria | 5054 |
| 61 | Ga0070659_100035081 | 3300005366 | Bacteria | 3904 |
| 62 | Ga0070709_10066356 | 3300005434 | Bacteria | 2314 |
| 63 | Ga0070714_100024901 | 3300005435 | Bacteria | 4934 |
| 64 | Ga0070714_100025435 | 3300005435 | Bacteria | 4886 |
| 65 | Ga0070714_100157766 | 3300005435 | Bacteria | 2050 |
| 66 | Ga0070713_100004203 | 3300005436 | Bacteria | 9611 |
| 67 | Ga0070710_10033141 | 3300005437 | Bacteria | 2803 |
| 68 | Ga0070710_10056166 | 3300005437 | Bacteria | 2227 |
| 69 | Ga0070701_10019738 | 3300005438 | Bacteria | 3188 |
| 70 | Ga0070711_100057795 | 3300005439 | Bacteria | 2687 |
| 71 | Ga0070700_100008982 | 3300005441 | Bacteria | 5471 |
| 72 | Ga0070700_100024644 | 3300005441 | Bacteria | 3535 |
| 73 | Ga0070700_100026858 | 3300005441 | Bacteria | 3406 |
| 74 | Ga0070694_100077454 | 3300005444 | Bacteria | 2304 |
| 75 | Ga0070663_100133644 | 3300005455 | Bacteria | 1887 |
| 76 | Ga0070678_100008058 | 3300005456 | Bacteria | 6286 |
| 77 | Ga0070681_10080756 | 3300005458 | Bacteria | 3207 |
| 78 | Ga0068867_100130062 | 3300005459 | Bacteria | 1955 |
| 79 | Ga0070685_10014514 | 3300005466 | Bacteria | 4175 |
| 80 | Ga0070685_10025538 | 3300005466 | Bacteria | 3252 |
| 81 | Ga0070679_100028649 | 3300005530 | Bacteria | 5492 |
| 82 | Ga0070684_100086734 | 3300005535 | Bacteria | 2778 |
| 83 | Ga0068853_100040252 | 3300005539 | Bacteria | 3987 |
| 84 | Ga0068853_100089506 | 3300005539 | Bacteria | 2703 |
| 85 | Ga0070693_100014346 | 3300005547 | Bacteria | 4058 |
| 86 | Ga0070693_100038801 | 3300005547 | Bacteria | 2665 |
| 87 | Ga0070665_100004766 | 3300005548 | Bacteria | 14124 |
| 88 | Ga0068855_100200238 | 3300005563 | Bacteria | 2248 |
| 89 | Ga0070664_100011829 | 3300005564 | Bacteria | 7084 |
| 90 | Ga0070664_100106009 | 3300005564 | Bacteria | 2448 |
| 91 | Ga0068856_100023654 | 3300005614 | Bacteria | 5974 |
| 92 | Ga0068856_100052891 | 3300005614 | Bacteria | 4005 |
| 93 | Ga0068856_100059277 | 3300005614 | Bacteria | 3781 |
| 94 | Ga0068856_100072075 | 3300005614 | Bacteria | 3420 |
| 95 | Ga0070702_100003832 | 3300005615 | Bacteria | 6804 |
| 96 | Ga0068852_100017909 | 3300005616 | Bacteria | 5569 |
| 97 | Ga0068852_100018166 | 3300005616 | Bacteria | 5536 |
| 98 | Ga0068852_100033198 | 3300005616 | Bacteria | 4283 |
| 99 | Ga0068852_100069538 | 3300005616 | Bacteria | 3086 |
| 100 | Ga0068852_100070518 | 3300005616 | Bacteria | 3066 |
| 101 | Ga0068859_100057502 | 3300005617 | Bacteria | 3917 |
| 102 | Ga0068864_100003545 | 3300005618 | Bacteria | 12905 |
| 103 | Ga0068864_100026757 | 3300005618 | Bacteria | 4865 |
| 104 | Ga0068861_100012298 | 3300005719 | Bacteria | 5970 |
| 105 | Ga0068870_10000189 | 3300005840 | Bacteria | 21936 |
| 106 | Ga0068863_100050054 | 3300005841 | Bacteria | 3962 |
| 107 | Ga0068858_100099714 | 3300005842 | Bacteria | 2708 |
| 108 | Ga0068860_100060923 | 3300005843 | Bacteria | 3586 |
| 109 | Ga0081455_10001027 | 3300005937 | Bacteria | 35198 |
| 110 | Ga0081455_10001544 | 3300005937 | Bacteria | 28365 |
| 111 | Ga0081455_10005985 | 3300005937 | Bacteria | 13194 |
| 112 | Ga0081455_10028470 | 3300005937 | Bacteria | 5105 |
| 113 | Ga0081538_10000397 | 3300005981 | Bacteria | 49637 |
| 114 | Ga0081538_10001212 | 3300005981 | Bacteria | 27078 |
| 115 | Ga0081538_10003684 | 3300005981 | Bacteria | 14386 |
| 116 | Ga0081538_10009951 | 3300005981 | Bacteria | 7854 |
| 117 | Ga0081538_10027072 | 3300005981 | Bacteria | 3986 |
| 118 | Ga0081540_1000312 | 3300005983 | Bacteria | 50256 |
| 119 | Ga0081540_1029928 | 3300005983 | Bacteria | 3024 |
| 120 | Ga0081539_10000834 | 3300005985 | Bacteria | 59270 |
| 121 | Ga0081539_10001116 | 3300005985 | Bacteria | 48712 |
| 122 | Ga0081539_10001410 | 3300005985 | Bacteria | 41377 |
| 123 | Ga0081539_10004305 | 3300005985 | Bacteria | 15916 |
| 124 | Ga0081539_10033090 | 3300005985 | Bacteria | 3154 |
| 125 | Ga0081539_10035014 | 3300005985 | Bacteria | 3025 |
| 126 | Ga0070717_10021853 | 3300006028 | Bacteria | 5048 |
| 127 | Ga0075432_10005785 | 3300006058 | Bacteria | 4205 |
| 128 | Ga0070715_10037590 | 3300006163 | Bacteria | 2004 |
| 129 | Ga0070712_100039424 | 3300006175 | Bacteria | 3233 |
| 130 | Ga0070712_100047517 | 3300006175 | Bacteria | 2971 |
| 131 | Ga0097621_100070992 | 3300006237 | Bacteria | 2877 |
| 132 | Ga0097621_100098840 | 3300006237 | Bacteria | 2452 |
| 133 | Ga0068871_100005745 | 3300006358 | Bacteria | 8712 |
| 134 | Ga0075430_100005761 | 3300006846 | Bacteria | 10452 |
| 135 | Ga0075431_100004111 | 3300006847 | Bacteria | 14211 |
| 136 | Ga0075431_100024615 | 3300006847 | Bacteria | 6171 |
| 137 | Ga0075433_10010431 | 3300006852 | Bacteria | 7456 |
| 138 | Ga0075434_100003608 | 3300006871 | Bacteria | 13816 |
| 139 | Ga0097620_100057503 | 3300006931 | Bacteria | 3917 |
| 140 | Ga0111539_10036479 | 3300009094 | Bacteria | 5944 |
| 141 | Ga0111539_10091964 | 3300009094 | Bacteria | 3565 |
| 142 | Ga0105245_10004392 | 3300009098 | Bacteria | 12476 |
| 143 | Ga0105245_10028968 | 3300009098 | Bacteria | 4889 |
| 144 | Ga0105247_10015678 | 3300009101 | Bacteria | 4537 |
| 145 | Ga0114129_10116706 | 3300009147 | Bacteria | 3678 |
| 146 | Ga0105241_10021155 | 3300009174 | Bacteria | 4809 |
| 147 | Ga0105242_10022936 | 3300009176 | Bacteria | 4916 |
| 148 | Ga0105248_10033923 | 3300009177 | Bacteria | 5704 |
| 149 | Ga0105248_10115538 | 3300009177 | Bacteria | 3027 |
| 150 | Ga0105237_10139520 | 3300009545 | Bacteria | 2418 |
| 151 | Ga0105238_10040007 | 3300009551 | Bacteria | 4752 |
| 152 | Ga0105238_10104610 | 3300009551 | Bacteria | 2812 |
| 153 | Ga0105249_10007578 | 3300009553 | Bacteria | 9471 |
| 154 | Ga0105239_10028396 | 3300010375 | Bacteria | 6154 |
| 155 | Ga0105246_10030849 | 3300011119 | Bacteria | 3544 |
| 156 | Ga0105246_10087818 | 3300011119 | Bacteria | 2233 |
| 157 | Ga0154018_116725 | 3300013043 | Bacteria | 2301 |
| 158 | Ga0154019_116697 | 3300013044 | Bacteria | 1918 |
| 159 | Ga0154019_117904 | 3300013044 | Bacteria | 2528 |
| 160 | Ga0154010_114046 | 3300013062 | Bacteria | 1893 |
| 161 | Ga0157371_10036482 | 3300013102 | Bacteria | 3520 |
| 162 | Ga0157369_10190807 | 3300013105 | Bacteria | 2153 |
| 163 | Ga0157374_10005682 | 3300013296 | Bacteria | 10516 |
| 164 | Ga0157374_10025412 | 3300013296 | Bacteria | 5318 |
| 165 | Ga0157378_10086512 | 3300013297 | Bacteria | 2841 |
| 166 | Ga0157372_10115801 | 3300013307 | Bacteria | 3073 |
| 167 | Ga0157375_10085882 | 3300013308 | Bacteria | 3197 |
| 168 | Ga0157375_10121317 | 3300013308 | Bacteria | 2724 |
| 169 | Ga0157377_10001262 | 3300014745 | Bacteria | 10819 |
| 170 | Ga0157379_10112967 | 3300014968 | Bacteria | 2441 |
| 171 | Ga0197907_10712108 | 3300020069 | Bacteria | 2212 |
| 172 | Ga0197907_11193090 | 3300020069 | Bacteria | 3739 |
| 173 | Ga0197907_11347956 | 3300020069 | Bacteria | 2459 |
| 174 | Ga0206356_10717600 | 3300020070 | Bacteria | 1939 |
| 175 | Ga0206356_10760723 | 3300020070 | Bacteria | 1916 |
| 176 | Ga0206356_11166442 | 3300020070 | Bacteria | 2326 |
| 177 | Ga0206356_11623651 | 3300020070 | Bacteria | 2499 |
| 178 | Ga0206356_11656272 | 3300020070 | Bacteria | 2725 |
| 179 | Ga0206349_1063486 | 3300020075 | Bacteria | 2391 |
| 180 | Ga0206349_1130736 | 3300020075 | Bacteria | 2267 |
| 181 | Ga0206349_1481511 | 3300020075 | Bacteria | 2508 |
| 182 | Ga0206355_1033109 | 3300020076 | Bacteria | 2567 |
| 183 | Ga0206355_1101757 | 3300020076 | Bacteria | 3598 |
| 184 | Ga0206355_1167982 | 3300020076 | Bacteria | 2210 |
| 185 | Ga0206355_1243473 | 3300020076 | Bacteria | 3064 |
| 186 | Ga0206355_1360583 | 3300020076 | Bacteria | 2639 |
| 187 | Ga0206351_10042734 | 3300020077 | Bacteria | 2478 |
| 188 | Ga0206351_10266398 | 3300020077 | Bacteria | 2601 |
| 189 | Ga0206352_10155988 | 3300020078 | Bacteria | 2666 |
| 190 | Ga0206352_10330544 | 3300020078 | Bacteria | 2620 |
| 191 | Ga0206352_10545168 | 3300020078 | Bacteria | 2461 |
| 192 | Ga0206350_10164620 | 3300020080 | Bacteria | 2566 |
| 193 | Ga0206350_10484114 | 3300020080 | Bacteria | 2509 |
| 194 | Ga0206350_11095238 | 3300020080 | Bacteria | 2889 |
| 195 | Ga0206354_10133038 | 3300020081 | Bacteria | 2409 |
| 196 | Ga0206354_10194144 | 3300020081 | Bacteria | 2483 |
| 197 | Ga0206354_10596313 | 3300020081 | Bacteria | 4149 |
| 198 | Ga0206354_11373415 | 3300020081 | Bacteria | 3345 |
| 199 | Ga0206353_10532549 | 3300020082 | Bacteria | 2599 |
| 200 | Ga0206353_11086046 | 3300020082 | Bacteria | 2266 |
| 201 | Ga0206353_11235669 | 3300020082 | Bacteria | 1848 |
| 202 | Ga0154015_1196169 | 3300020610 | Bacteria | 3155 |
| 203 | Ga0154015_1271345 | 3300020610 | Bacteria | 3014 |
| 204 | Ga0154015_1419653 | 3300020610 | Bacteria | 2647 |
| 205 | Ga0213876_10073983 | 3300021384 | Bacteria | 1799 |
| 206 | Ga0213875_10000225 | 3300021388 | Bacteria | 57756 |
| 207 | Ga0213875_10000286 | 3300021388 | Bacteria | 49191 |
| 208 | Ga0213875_10001346 | 3300021388 | Bacteria | 16188 |
| 209 | Ga0213875_10008561 | 3300021388 | Bacteria | 5231 |
| 210 | Ga0224712_10004330 | 3300022467 | Bacteria | 3815 |
| 211 | Ga0224712_10005119 | 3300022467 | Bacteria | 3616 |
| 212 | Ga0224712_10009256 | 3300022467 | Bacteria | 2959 |
| 213 | Ga0207653_10008227 | 3300025885 | Bacteria | 3252 |
| 214 | Ga0207682_10007999 | 3300025893 | Bacteria | 4199 |
| 215 | Ga0207642_10059039 | 3300025899 | Bacteria | 1772 |
| 216 | Ga0207688_10000417 | 3300025901 | Bacteria | 20012 |
| 217 | Ga0207688_10017685 | 3300025901 | Bacteria | 3878 |
| 218 | Ga0207647_10006330 | 3300025904 | Bacteria | 8612 |
| 219 | Ga0207647_10062302 | 3300025904 | Bacteria | 2273 |
| 220 | Ga0207699_10063834 | 3300025906 | Bacteria | 2226 |
| 221 | Ga0207645_10010229 | 3300025907 | Bacteria | 6448 |
| 222 | Ga0207645_10064633 | 3300025907 | Bacteria | 2338 |
| 223 | Ga0207643_10000261 | 3300025908 | Bacteria | 36615 |
| 224 | Ga0207654_10017256 | 3300025911 | Bacteria | 3770 |
| 225 | Ga0207693_10002432 | 3300025915 | Bacteria | 16169 |
| 226 | Ga0207693_10010540 | 3300025915 | Bacteria | 7501 |
| 227 | Ga0207693_10038821 | 3300025915 | Bacteria | 3749 |
| 228 | Ga0207663_10055281 | 3300025916 | Bacteria | 2490 |
| 229 | Ga0207660_10001785 | 3300025917 | Bacteria | 14387 |
| 230 | Ga0207662_10005289 | 3300025918 | Bacteria | 6860 |
| 231 | Ga0207657_10018487 | 3300025919 | Bacteria | 6648 |
| 232 | Ga0207649_10007284 | 3300025920 | Bacteria | 6016 |
| 233 | Ga0207652_10019986 | 3300025921 | Bacteria | 5513 |
| 234 | Ga0207681_10020581 | 3300025923 | Bacteria | 4184 |
| 235 | Ga0207650_10000761 | 3300025925 | Bacteria | 24753 |
| 236 | Ga0207650_10026777 | 3300025925 | Bacteria | 4118 |
| 237 | Ga0207659_10034216 | 3300025926 | Bacteria | 3502 |
| 238 | Ga0207659_10045432 | 3300025926 | Bacteria | 3097 |
| 239 | Ga0207687_10003002 | 3300025927 | Bacteria | 11444 |
| 240 | Ga0207687_10013358 | 3300025927 | Bacteria | 5362 |
| 241 | Ga0207687_10014902 | 3300025927 | Bacteria | 5092 |
| 242 | Ga0207687_10016192 | 3300025927 | Bacteria | 4895 |
| 243 | Ga0207700_10011239 | 3300025928 | Bacteria | 5699 |
| 244 | Ga0207664_10023254 | 3300025929 | Bacteria | 4640 |
| 245 | Ga0207664_10024695 | 3300025929 | Bacteria | 4519 |
| 246 | Ga0207644_10009429 | 3300025931 | Bacteria | 6409 |
| 247 | Ga0207644_10024247 | 3300025931 | Bacteria | 4163 |
| 248 | Ga0207706_10056098 | 3300025933 | Bacteria | 3474 |
| 249 | Ga0207706_10061605 | 3300025933 | Bacteria | 3304 |
| 250 | Ga0207706_10068445 | 3300025933 | Bacteria | 3124 |
| 251 | Ga0207709_10006789 | 3300025935 | Bacteria | 6403 |
| 252 | Ga0207669_10002929 | 3300025937 | Bacteria | 7332 |
| 253 | Ga0207665_10002140 | 3300025939 | Bacteria | 13357 |
| 254 | Ga0207691_10018372 | 3300025940 | Bacteria | 6624 |
| 255 | Ga0207691_10036270 | 3300025940 | Bacteria | 4568 |
| 256 | Ga0207711_10062713 | 3300025941 | Bacteria | 3207 |
| 257 | Ga0207711_10065025 | 3300025941 | Bacteria | 3152 |
| 258 | Ga0207689_10005920 | 3300025942 | Bacteria | 10830 |
| 259 | Ga0207689_10061345 | 3300025942 | Bacteria | 3092 |
| 260 | Ga0207689_10074010 | 3300025942 | Bacteria | 2799 |
| 261 | Ga0207661_10009581 | 3300025944 | Bacteria | 6953 |
| 262 | Ga0207661_10034644 | 3300025944 | Bacteria | 3929 |
| 263 | Ga0207661_10070118 | 3300025944 | Bacteria | 2861 |
| 264 | Ga0207661_10100067 | 3300025944 | Bacteria | 2432 |
| 265 | Ga0207679_10008502 | 3300025945 | Bacteria | 6541 |
| 266 | Ga0207667_10072112 | 3300025949 | Bacteria | 3590 |
| 267 | Ga0207651_10045619 | 3300025960 | Bacteria | 2941 |
| 268 | Ga0207677_10005733 | 3300026023 | Bacteria | 6753 |
| 269 | Ga0207703_10032908 | 3300026035 | Bacteria | 4107 |
| 270 | Ga0207703_10098113 | 3300026035 | Bacteria | 2477 |
| 271 | Ga0207703_10153872 | 3300026035 | Bacteria | 2008 |
| 272 | Ga0207639_10025198 | 3300026041 | Bacteria | 4312 |
| 273 | Ga0207678_10005211 | 3300026067 | Bacteria | 11651 |
| 274 | Ga0207678_10012130 | 3300026067 | Bacteria | 7568 |
| 275 | Ga0207678_10016374 | 3300026067 | Bacteria | 6509 |
| 276 | Ga0207708_10000271 | 3300026075 | Bacteria | 40456 |
| 277 | Ga0207702_10000505 | 3300026078 | Bacteria | 44014 |
| 278 | Ga0207641_10169198 | 3300026088 | Bacteria | 1993 |
| 279 | Ga0207676_10000495 | 3300026095 | Bacteria | 33137 |
| 280 | Ga0207676_10031983 | 3300026095 | Bacteria | 3960 |
| 281 | Ga0207674_10029427 | 3300026116 | Bacteria | 5782 |
| 282 | Ga0207674_10111348 | 3300026116 | Bacteria | 2712 |
| 283 | Ga0207675_100005705 | 3300026118 | Bacteria | 11914 |
| 284 | Ga0207675_100024837 | 3300026118 | Bacteria | 5576 |
| 285 | Ga0207683_10000524 | 3300026121 | Bacteria | 35526 |
| 286 | Ga0207683_10049277 | 3300026121 | Bacteria | 3687 |
| 287 | Ga0207698_10005868 | 3300026142 | Bacteria | 7630 |
| 288 | Ga0207698_10030758 | 3300026142 | Bacteria | 3866 |
| 289 | Ga0207428_10007798 | 3300027907 | Bacteria | 9745 |
| 290 | Ga0207428_10067896 | 3300027907 | Bacteria | 2806 |
| 291 | Ga0268266_10005503 | 3300028379 | Bacteria | 11794 |
| 292 | Ga0268264_10061884 | 3300028381 | Bacteria | 3141 |
| 293 | Ga0265766_1000237 | 3300030863 | Bacteria | 2220 |
| 294 | Ga0265340_10015454 | 3300031247 | Bacteria | 3965 |
| 295 | Ga0307408_100035361 | 3300031548 | Bacteria | 3505 |
| 296 | Ga0307413_10092059 | 3300031824 | Bacteria | 1977 |
| 297 | Ga0307518_10003635 | 3300031838 | Bacteria | 11093 |
| 298 | Ga0307410_10055499 | 3300031852 | Bacteria | 2689 |
| 299 | Ga0307406_10022258 | 3300031901 | Bacteria | 3758 |
| 300 | Ga0307407_10032306 | 3300031903 | Bacteria | 2844 |
| 301 | Ga0307409_100021941 | 3300031995 | Bacteria | 4391 |
| 302 | Ga0307409_100097207 | 3300031995 | Bacteria | 2432 |
| 303 | Ga0307409_100123061 | 3300031995 | Bacteria | 2201 |
| 304 | Ga0307416_100002309 | 3300032002 | Bacteria | 10896 |
| 305 | Ga0307416_100070184 | 3300032002 | Bacteria | 2903 |
| 306 | Ga0307414_10073627 | 3300032004 | Bacteria | 2472 |
| 307 | Ga0307415_100012647 | 3300032126 | Bacteria | 4888 |
| 308 | Ga0307415_100064422 | 3300032126 | Bacteria | 2550 |
| 309 | Ga0373926_0002072 | 3300035083 | Bacteria | 6311 |
| 310 | Ga0373944_0000887 | 3300035089 | Bacteria | 7371 |
| 311 | Ga0373951_0010322 | 3300035091 | Bacteria | 2096 |
| 312 | Ga0373939_0006695 | 3300035114 | Bacteria | 2782 |
| 313 | Ga0373957_0037957 | 3300035120 | Bacteria | 1802 |
| 314 | Ga0373943_0003924 | 3300035170 | Bacteria | 6771 |
| 315 | Ga0373946_0000452 | 3300035171 | Bacteria | 13505 |
| 316 | Ga0373942_0006004 | 3300035207 | Bacteria | 2805 |
| 317 | Ga0373924_0019734 | 3300035410 | Bacteria | 2614 |
| 318 | Ga0373935_0058898 | 3300035692 | Bacteria | 2454 |
| 319 | Ga0373933_0019617 | 3300035724 | Bacteria | 3822 |
| 320 | Ga0373937_0010782 | 3300036401 | Bacteria | 8000 |
| 321 | Ga0373937_0020349 | 3300036401 | Bacteria | 5950 |
| 322 | Ga0373925_0006377 | 3300037068 | Bacteria | 8683 |
| 323 | Ga0395899_0007323 | 3300037312 | Bacteria | 8535 |
| 324 | Ga0395900_0159643 | 3300037418 | Bacteria | 2300 |
| 325 | Ga0395898_0029492 | 3300037466 | Bacteria | 5495 |
| 326 | Ga0436364_0420889 | 3300037853 | Bacteria | 36146 |
| 327 | Ga0436364_0455306 | 3300037853 | Bacteria | 18481 |
| 328 | Ga0436364_0872840 | 3300037853 | Bacteria | 2107 |
| 329 | Ga0436364_1299740 | 3300037853 | Bacteria | 98238 |
| 330 | Ga0436364_1496151 | 3300037853 | Bacteria | 11311 |
| 331 | Ga0395901_0019307 | 3300038443 | Bacteria | 6968 |
| 332 | Ga0436365_0584563 | 3300039437 | Bacteria | 13176 |
| 333 | Ga0436365_0855511 | 3300039437 | Bacteria | 21676 |
| 334 | Ga0436365_1015637 | 3300039437 | Bacteria | 4663 |
| 335 | Ga0436365_1324271 | 3300039437 | Bacteria | 6495 |
| 336 | Ga0436363_0839818 | 3300039450 | Bacteria | 3744 |
| 337 | Ga0466972_0004294 | 3300044658 | Bacteria | 7121 |
| 338 | Ga0466965_0021763 | 3300044683 | Bacteria | 3089 |
| 339 | Ga0466965_0065546 | 3300044683 | Bacteria | 1820 |
| 340 | Ga0466966_0001327 | 3300044684 | Bacteria | 15860 |
| 341 | Ga0466963_0000174 | 3300044694 | Bacteria | 26596 |
| 342 | Ga0466963_0002996 | 3300044694 | Bacteria | 9554 |
| 343 | Ga0466963_0004285 | 3300044694 | Bacteria | 8279 |
| 344 | Ga0466963_0017094 | 3300044694 | Bacteria | 4518 |
| 345 | Ga0466963_0032908 | 3300044694 | Bacteria | 3361 |
| 346 | Ga0466971_0000718 | 3300044719 | Bacteria | 13252 |
| 347 | Ga0466971_0001963 | 3300044719 | Bacteria | 8710 |
| 348 | Ga0466970_0004247 | 3300044765 | Bacteria | 7051 |
| 349 | Ga0466957_0010409 | 3300044842 | Bacteria | 5338 |
| 350 | Ga0466957_0072910 | 3300044842 | Bacteria | 2127 |
| 351 | Ga0466960_0001561 | 3300044901 | Bacteria | 8381 |
| 352 | Ga0466960_0036665 | 3300044901 | Bacteria | 2297 |
| 353 | Ga0466959_0000228 | 3300045049 | Bacteria | 35389 |
| 354 | Ga0466959_0023344 | 3300045049 | Bacteria | 4577 |
| 355 | Ga0466958_0002105 | 3300045836 | Bacteria | 9870 |
| 356 | Ga0466958_0003604 | 3300045836 | Bacteria | 8070 |
| 357 | Ga0466958_0049626 | 3300045836 | Bacteria | 2539 |
| 358 | Ga0466958_0052634 | 3300045836 | Bacteria | 2468 |
| 359 | Ga0466967_0001896 | 3300045976 | Bacteria | 12634 |
| 360 | Ga0466967_0010613 | 3300045976 | Bacteria | 6922 |
| 361 | Ga0466967_0010669 | 3300045976 | Bacteria | 6907 |
| 362 | Ga0466967_0023007 | 3300045976 | Bacteria | 5099 |
| 363 | Ga0466967_0031551 | 3300045976 | Bacteria | 4462 |
| 364 | Ga0466967_0034313 | 3300045976 | Bacteria | 4305 |
| 365 | Ga0466967_0038170 | 3300045976 | Bacteria | 4117 |
| 366 | Ga0495592_0063193 | 3300046454 | Bacteria | 2716 |
| 367 | Ga0495641_0006750 | 3300046461 | Bacteria | 7365 |
| 368 | Ga0495651_0006381 | 3300046462 | Bacteria | 9026 |
| 369 | Ga0495651_0022134 | 3300046462 | Bacteria | 4942 |
| 370 | Ga0495653_0013198 | 3300046463 | Bacteria | 6735 |
| 371 | Ga0495653_0014374 | 3300046463 | Bacteria | 6459 |
| 372 | Ga0495605_0001961 | 3300046474 | Bacteria | 13049 |
| 373 | Ga0495662_0038420 | 3300046476 | Bacteria | 2313 |
| 374 | Ga0495664_0000449 | 3300046477 | Bacteria | 20198 |
| 375 | Ga0495585_0005511 | 3300046492 | Bacteria | 7968 |
| 376 | Ga0495596_0031283 | 3300046500 | Bacteria | 2127 |
| 377 | Ga0495583_0006012 | 3300046506 | Bacteria | 8041 |
| 378 | Ga0495606_0020536 | 3300046507 | Bacteria | 4866 |
| 379 | Ga0495608_0010061 | 3300046511 | Bacteria | 6598 |
| 380 | Ga0495608_0051651 | 3300046511 | Bacteria | 2724 |
| 381 | Ga0495608_0107164 | 3300046511 | Bacteria | 1798 |
| 382 | Ga0495618_0018692 | 3300046514 | Bacteria | 4257 |
| 383 | Ga0495620_0001163 | 3300046515 | Bacteria | 16111 |
| 384 | Ga0495628_0029883 | 3300046516 | Bacteria | 4416 |
| 385 | Ga0495628_0114202 | 3300046516 | Bacteria | 2075 |
| 386 | Ga0495631_0012273 | 3300046518 | Bacteria | 4192 |
| 387 | Ga0495652_0016029 | 3300046529 | Bacteria | 6706 |
| 388 | Ga0495652_0047649 | 3300046529 | Bacteria | 3675 |
| 389 | Ga0495652_0131002 | 3300046529 | Bacteria | 1985 |
| 390 | Ga0495640_0012022 | 3300046533 | Bacteria | 6634 |
| 391 | Ga0495587_0010914 | 3300046536 | Bacteria | 5765 |
| 392 | Ga0495645_0016408 | 3300046543 | Bacteria | 5287 |
| 393 | Ga0495667_0004492 | 3300046559 | Bacteria | 9410 |
| 394 | Ga0495667_0013305 | 3300046559 | Bacteria | 5570 |
| 395 | Ga0495668_0003363 | 3300046616 | Bacteria | 12057 |
| 396 | Ga0495625_0010890 | 3300046660 | Bacteria | 7471 |
| 397 | Ga0495635_0012561 | 3300046663 | Bacteria | 5935 |
| 398 | Ga0495661_0071139 | 3300046665 | Bacteria | 2034 |
| 399 | Ga0495657_0014724 | 3300046675 | Bacteria | 5740 |
| 400 | Ga0495657_0020239 | 3300046675 | Bacteria | 4786 |
| 401 | Ga0495646_0009174 | 3300046680 | Bacteria | 6277 |
| 402 | Ga0495624_0010135 | 3300046690 | Bacteria | 6498 |
| 403 | Ga0495589_0021790 | 3300046794 | Bacteria | 3274 |
| 404 | Ga0495600_0018098 | 3300046809 | Bacteria | 4486 |
| 405 | Ga0495660_0036139 | 3300046810 | Bacteria | 2756 |
| 406 | Ga0495581_0015836 | 3300047315 | Bacteria | 4380 |
| 407 | Ga0495604_0038244 | 3300047317 | Bacteria | 3775 |
| 408 | Ga0495674_0016265 | 3300047319 | Bacteria | 6941 |
| 409 | Ga0495674_0059184 | 3300047319 | Bacteria | 3346 |
| 410 | Ga0495672_0002584 | 3300047320 | Bacteria | 16441 |
| 411 | Ga0495676_0005502 | 3300047321 | Bacteria | 11617 |
| 412 | Ga0495680_0005032 | 3300047322 | Bacteria | 12498 |
| 413 | Ga0495680_0011913 | 3300047322 | Bacteria | 7673 |
| 414 | Ga0495683_0000181 | 3300047323 | Bacteria | 61963 |
| 415 | Ga0495683_0012380 | 3300047323 | Bacteria | 4478 |
| 416 | Ga0495687_006145 | 3300047443 | Bacteria | 7442 |
| 417 | Ga0495675_0004532 | 3300047444 | Bacteria | 8424 |
| 418 | Ga0495685_003387 | 3300047447 | Bacteria | 5088 |
| 419 | Ga0495673_0001734 | 3300047469 | Bacteria | 16659 |
| 420 | Ga0495684_0002060 | 3300047471 | Bacteria | 16163 |
| 421 | Ga0495684_0029866 | 3300047471 | Bacteria | 4184 |
| 422 | Ga0495686_0018214 | 3300047472 | Bacteria | 4717 |
| 423 | Ga0495602_0012209 | 3300048088 | Bacteria | 8845 |
| 424 | Ga0496100_0023541 | 3300048903 | Bacteria | 3743 |
| 425 | Ga0496101_0003564 | 3300048904 | Bacteria | 9713 |
| 426 | Ga0496101_0064645 | 3300048904 | Bacteria | 2665 |
| 427 | Ga0496102_0005604 | 3300048905 | Bacteria | 10658 |
| 428 | Ga0496102_0050295 | 3300048905 | Bacteria | 3794 |
| 429 | Ga0496104_0005397 | 3300048907 | Bacteria | 11184 |
| 430 | Ga0496104_0015960 | 3300048907 | Bacteria | 6817 |
| 431 | Ga0496104_0021478 | 3300048907 | Bacteria | 5926 |
| 432 | Ga0496104_0034290 | 3300048907 | Bacteria | 4731 |
| 433 | Ga0496104_0084833 | 3300048907 | Bacteria | 3023 |
| 434 | Ga0496105_0012520 | 3300048908 | Bacteria | 6716 |
| 435 | Ga0496105_0025577 | 3300048908 | Bacteria | 4807 |
| 436 | Ga0496105_0026922 | 3300048908 | Bacteria | 4693 |
| 437 | Ga0496105_0038128 | 3300048908 | Bacteria | 3959 |
| 438 | Ga0496105_0158976 | 3300048908 | Bacteria | 1855 |
| 439 | Ga0496106_0004952 | 3300048909 | Bacteria | 9853 |
| 440 | Ga0496106_0013769 | 3300048909 | Bacteria | 5975 |
| 441 | Ga0496106_0017885 | 3300048909 | Bacteria | 5242 |
| 442 | Ga0496106_0037761 | 3300048909 | Bacteria | 3613 |
| 443 | Ga0496107_0024845 | 3300048910 | Bacteria | 4240 |
| 444 | Ga0496107_0035699 | 3300048910 | Bacteria | 3564 |
| 445 | Ga0496108_0000534 | 3300048911 | Bacteria | 29627 |
| 446 | Ga0496108_0011234 | 3300048911 | Bacteria | 7274 |
| 447 | Ga0496108_0037136 | 3300048911 | Bacteria | 4056 |
| 448 | Ga0496109_0006294 | 3300048912 | Bacteria | 9991 |
| 449 | Ga0496109_0014054 | 3300048912 | Bacteria | 6959 |
| 450 | Ga0496109_0029610 | 3300048912 | Bacteria | 4904 |
| 451 | Ga0496109_0151612 | 3300048912 | Bacteria | 2170 |
| 452 | Ga0496110_0017012 | 3300048913 | Bacteria | 6078 |
| 453 | Ga0496110_0030458 | 3300048913 | Bacteria | 4652 |
| 454 | Ga0496110_0038185 | 3300048913 | Bacteria | 4176 |
| 455 | Ga0496110_0193732 | 3300048913 | Bacteria | 1845 |
| 456 | Ga0496111_0007559 | 3300048914 | Bacteria | 7130 |
| 457 | Ga0496111_0028865 | 3300048914 | Bacteria | 3934 |
| 458 | Ga0496112_0009048 | 3300048915 | Bacteria | 8944 |
| 459 | Ga0496112_0010375 | 3300048915 | Bacteria | 8447 |
| 460 | Ga0496112_0022269 | 3300048915 | Bacteria | 6037 |
| 461 | Ga0496112_0029517 | 3300048915 | Bacteria | 5303 |
| 462 | Ga0496113_0002393 | 3300048916 | Bacteria | 10896 |
| 463 | Ga0496113_0022005 | 3300048916 | Bacteria | 4503 |
| 464 | Ga0496115_0024602 | 3300048918 | Bacteria | 4683 |
| 465 | Ga0496115_0115271 | 3300048918 | Bacteria | 2209 |
| 466 | Ga0496126_0003818 | 3300048929 | Bacteria | 18667 |
| 467 | Ga0501315_003873 | 3300049531 | Bacteria | 1528 |
| 468 | Ga0501032_0107829 | 3300049569 | Bacteria | 1844 |
| 469 | Ga0501039_0199238 | 3300049575 | Bacteria | 1574 |
| 470 | Ga0501042_0116202 | 3300049578 | Bacteria | 1926 |
| 471 | Ga0501043_0001195 | 3300049579 | Bacteria | 22851 |
| 472 | Ga0501076_0022536 | 3300049592 | Bacteria | 4841 |
| 473 | Ga0501077_0034319 | 3300049593 | Bacteria | 3229 |
| 474 | Ga0501077_0090950 | 3300049593 | Bacteria | 1934 |
| 475 | Ga0501044_0001610 | 3300049823 | Bacteria | 26428 |
| 476 | Ga0501044_0005840 | 3300049823 | Bacteria | 13631 |
| 477 | nmdc:mga0qj67_54128_c1 | 3300050509 | Bacteria | 3178 |
| 478 | nmdc:mga06r32_70618_c1 | 3300050510 | Bacteria | 3378 |
| 479 | nmdc:mga06r32_8703_c1 | 3300050510 | Bacteria | 9148 |
| 480 | nmdc:mga08y16_1370_c1 | 3300050511 | Bacteria | 24348 |
| 481 | nmdc:mga08y16_266009_c1 | 3300050511 | Bacteria | 1770 |
| 482 | nmdc:mga08y16_65846_c1 | 3300050511 | Bacteria | 3782 |
| 483 | nmdc:mga0n895_5860_c1 | 3300050512 | Bacteria | 10329 |
| 484 | nmdc:mga0rr50_5506_c1 | 3300050513 | Bacteria | 7562 |
| 485 | nmdc:mga08x19_2383_c1 | 3300050514 | Bacteria | 11394 |
| 486 | nmdc:mga0a205_8358_c1 | 3300050515 | Bacteria | 9415 |
| 487 | Ga0500635_0002587 | 3300053080 | Bacteria | 4504 |
| 488 | Ga0495619_0006735 | 3300053085 | Bacteria | 7269 |
| 489 | Ga0500643_009919 | 3300053087 | Bacteria | 3593 |
| 490 | Ga0500559_0007497 | 3300053136 | Bacteria | 4826 |
| 491 | Ga0500616_0000251 | 3300053153 | Bacteria | 83237 |
| 492 | Ga0500616_0000966 | 3300053153 | Bacteria | 31132 |
| 493 | Ga0590074_002338 | 3300059423 | Bacteria | 3110 |
| 494 | Ga0590077_005194 | 3300059426 | Bacteria | 2665 |
| 495 | Ga0587066_000964 | 3300059490 | Bacteria | 2698 |
| 496 | Ga0587066_001556 | 3300059490 | Bacteria | 2334 |
| 497 | Ga0587070_001628 | 3300059491 | Bacteria | 2370 |
| 498 | Ga0587073_0000752 | 3300059492 | Bacteria | 3280 |
| 499 | Ga0587073_0000888 | 3300059492 | Bacteria | 3154 |
| 500 | Ga0587073_0001936 | 3300059492 | Bacteria | 2559 |
| 501 | Ga0587077_001804 | 3300059493 | Bacteria | 2396 |
| 502 | Ga0587077_002517 | 3300059493 | Bacteria | 2185 |
| 503 | Ga0587080_001591 | 3300059503 | Bacteria | 2498 |
| 504 | Ga0587080_001731 | 3300059503 | Bacteria | 2435 |
| 505 | Ga0587082_000480 | 3300059504 | Bacteria | 3351 |
| 506 | Ga0587082_000526 | 3300059504 | Bacteria | 3276 |
| 507 | Ga0587082_000997 | 3300059504 | Bacteria | 2732 |
| 508 | Ga0587083_0001051 | 3300059505 | Bacteria | 2910 |
| 509 | Ga0587085_000674 | 3300059506 | Bacteria | 2729 |
| 510 | Ga0587085_000838 | 3300059506 | Bacteria | 2554 |
| 511 | Ga0587086_000737 | 3300059507 | Bacteria | 2577 |
| 512 | Ga0587088_001066 | 3300059508 | Bacteria | 2698 |
| 513 | Ga0587089_001017 | 3300059509 | Bacteria | 2455 |
| 514 | Ga0587090_002703 | 3300059510 | Bacteria | 1979 |
| 515 | Ga0587094_001038 | 3300059513 | Bacteria | 2479 |
| 516 | Ga0587099_000467 | 3300059622 | Bacteria | 2331 |
| 517 | Ga0587099_000803 | 3300059622 | Bacteria | 1994 |
| 518 | Ga0587101_000438 | 3300059623 | Bacteria | 2932 |
| 519 | Ga0587115_000838 | 3300059626 | Bacteria | 2530 |
| 520 | Ga0587128_000501 | 3300059630 | Bacteria | 2940 |
| 521 | Ga0587062_001486 | 3300059639 | Bacteria | 2043 |
| 522 | Ga0587068_001461 | 3300059641 | Bacteria | 2662 |
| 523 | Ga0587068_002395 | 3300059641 | Bacteria | 2274 |
| 524 | Ga0587069_000360 | 3300059642 | Bacteria | 3288 |
| 525 | Ga0587069_000791 | 3300059642 | Bacteria | 2627 |
| 526 | Ga0587075_000776 | 3300059644 | Bacteria | 2798 |
| 527 | Ga0587075_000893 | 3300059644 | Bacteria | 2670 |
| 528 | Ga0587078_001086 | 3300059646 | Bacteria | 2316 |
| 529 | Ga0587100_000219 | 3300059648 | Bacteria | 2439 |
| 530 | Ga0587102_000396 | 3300059649 | Bacteria | 2411 |
| 531 | Ga0587071_001409 | 3300060344 | Bacteria | 2992 |
| 532 | Ga0587071_001935 | 3300060344 | Bacteria | 2706 |
| 533 | Ga0587071_002031 | 3300060344 | Bacteria | 2670 |
| 534 | Ga0587071_002161 | 3300060344 | Bacteria | 2620 |
| 535 | Ga0587071_002870 | 3300060344 | Bacteria | 2402 |
| 536 | Ga0587071_003032 | 3300060344 | Bacteria | 2362 |
| 537 | Ga0587111_0003195 | 3300060346 | Bacteria | 2297 |
| 538 | Ga0587111_0003835 | 3300060346 | Bacteria | 2182 |
| 539 | Ga0587111_0004083 | 3300060346 | Bacteria | 2140 |
| 540 | Ga0501082_0017637 | 3300060353 | Bacteria | 6149 |
| 541 | Ga0466962_0000428 | 3300061719 | Bacteria | 18202 |
| 542 | Ga0530510_0011189 | 3300061734 | Bacteria | 6295 |
| 543 | 2902797421 | 2902792274 | Bacteria | 7270173 |
| 544 | 2558912714 | 2558860112 | Bacteria | 9931328 |
| 545 | 2583153444 | 2582580736 | Bacteria | 5325865 |
| 546 | 2734967969 | 2734482000 | Bacteria | 5525167 |
| 547 | 2816503778 | 2816332139 | Bacteria | 9138787 |
| 548 | 2862514749 | 2862507626 | Bacteria | 9425308 |
| 549 | 2866552302 | 2866552031 | Bacteria | 5824618 |
| 550 | 2866554661 | 2866552031 | Bacteria | 5824618 |
| 551 | 2870787003 | 2870782633 | Bacteria | 9624083 |
| 552 | 2899371364 | 2899370129 | Bacteria | 6781179 |
| 553 | 2899375962 | 2899370129 | Bacteria | 6781179 |
| 554 | 2912727291 | 2912723979 | Bacteria | 8557534 |
| 555 | 2917741932 | 2917736166 | Bacteria | 9690793 |
| 556 | 2919038145 | 2919034639 | Bacteria | 4763403 |
| 557 | 8054477549 | 8054472261 | Bacteria | 7464355 |
| 558 | 8054479085 | 8054472261 | Bacteria | 7464355 |
| 559 | LJQas_1001167 | |||
| 560 | JGI24739J22299_10022113 | |||
| 561 | JGI24744J21845_10001243 | |||
| 562 | JGI24034J26672_10002160 | |||
| 563 | JGI24751J29686_10001477 | |||
| 564 | Ga0006778J45830_1012866 | |||
| 565 | Ga0006778J45830_1055289 | |||
| 566 | JGI25406J46586_10001748 | |||
| 567 | JGI25406J46586_10007760 | |||
| 568 | JGI25406J46586_10010223 | |||
| 569 | JGI25406J46586_10010999 | |||
| 570 | Ga0006777J48905_1003837 | |||
| 571 | JGI25407J50210_10005517 | |||
| 572 | Ga0007417J51691_1012618 | |||
| 573 | Ga0007429J51699_1010982 | |||
| 574 | Ga0007429J51699_1013679 | |||
| 575 | Ga0007429J51699_1044263 | |||
| 576 | Ga0032354_1004748 | |||
| 577 | Ga0032354_1024594 | |||
| 578 | Ga0058859_10029793 | |||
| 579 | Ga0058859_10055871 | |||
| 580 | Ga0058863_10063212 | |||
| 581 | Ga0058861_10072086 | |||
| 582 | Ga0058861_11981103 | |||
| 583 | Ga0058861_12054378 | |||
| 584 | Ga0058860_10034803 | |||
| 585 | Ga0058860_12195742 | |||
| 586 | Ga0058862_10101564 | |||
| 587 | Ga0058862_10178675 | |||
| 588 | Ga0058862_10189429 | |||
| 589 | Ga0058862_12875432 | |||
| 590 | Ga0070676_10031485 | |||
| 591 | Ga0070683_100020931 | |||
| 592 | Ga0070683_100021735 | |||
| 593 | Ga0070683_100049208 | |||
| 594 | Ga0070683_100137434 | |||
| 595 | Ga0070683_100172626 | |||
| 596 | Ga0070690_100026382 | |||
| 597 | Ga0070670_100081887 | |||
| 598 | Ga0068869_100011687 | |||
| 599 | Ga0068869_100014916 | |||
| 600 | Ga0068869_100026539 | |||
| 601 | Ga0070666_10042539 | |||
| 602 | Ga0070680_100014098 | |||
| 603 | Ga0070680_100095406 | |||
| 604 | Ga0070680_100134533 | |||
| 605 | Ga0070682_100005362 | |||
| 606 | Ga0070682_100032790 | |||
| 607 | Ga0068868_100015918 | |||
| 608 | Ga0068868_100118947 | |||
| 609 | Ga0070691_10006728 | |||
| 610 | Ga0070687_100022479 | |||
| 611 | Ga0070661_100016998 | |||
| 612 | Ga0070692_10055424 | |||
| 613 | Ga0070668_100010915 | |||
| 614 | Ga0070671_100000379 | |||
| 615 | Ga0070671_100050030 | |||
| 616 | Ga0070671_100096313 | |||
| 617 | Ga0070659_100010777 | |||
| 618 | Ga0070659_100020219 | |||
| 619 | Ga0070659_100035081 | |||
| 620 | Ga0070709_10066356 | |||
| 621 | Ga0070714_100024901 | |||
| 622 | Ga0070714_100025435 | |||
| 623 | Ga0070714_100157766 | |||
| 624 | Ga0070713_100004203 | |||
| 625 | Ga0070710_10033141 | |||
| 626 | Ga0070710_10056166 | |||
| 627 | Ga0070701_10019738 | |||
| 628 | Ga0070711_100057795 | |||
| 629 | Ga0070700_100008982 | |||
| 630 | Ga0070700_100024644 | |||
| 631 | Ga0070700_100026858 | |||
| 632 | Ga0070694_100077454 | |||
| 633 | Ga0070663_100133644 | |||
| 634 | Ga0070678_100008058 | |||
| 635 | Ga0070681_10080756 | |||
| 636 | Ga0068867_100130062 | |||
| 637 | Ga0070685_10014514 | |||
| 638 | Ga0070685_10025538 | |||
| 639 | Ga0070679_100028649 | |||
| 640 | Ga0070684_100086734 | |||
| 641 | Ga0068853_100040252 | |||
| 642 | Ga0068853_100089506 | |||
| 643 | Ga0070693_100014346 | |||
| 644 | Ga0070693_100038801 | |||
| 645 | Ga0070665_100004766 | |||
| 646 | Ga0068855_100200238 | |||
| 647 | Ga0070664_100011829 | |||
| 648 | Ga0070664_100106009 | |||
| 649 | Ga0068856_100023654 | |||
| 650 | Ga0068856_100052891 | |||
| 651 | Ga0068856_100059277 | |||
| 652 | Ga0068856_100072075 | |||
| 653 | Ga0070702_100003832 | |||
| 654 | Ga0068852_100017909 | |||
| 655 | Ga0068852_100018166 | |||
| 656 | Ga0068852_100033198 | |||
| 657 | Ga0068852_100069538 | |||
| 658 | Ga0068852_100070518 | |||
| 659 | Ga0068859_100057502 | |||
| 660 | Ga0068864_100003545 | |||
| 661 | Ga0068864_100026757 | |||
| 662 | Ga0068861_100012298 | |||
| 663 | Ga0068870_10000189 | |||
| 664 | Ga0068863_100050054 | |||
| 665 | Ga0068858_100099714 | |||
| 666 | Ga0068860_100060923 | |||
| 667 | Ga0081455_10001027 | |||
| 668 | Ga0081455_10001544 | |||
| 669 | Ga0081455_10005985 | |||
| 670 | Ga0081455_10028470 | |||
| 671 | Ga0081538_10000397 | |||
| 672 | Ga0081538_10001212 | |||
| 673 | Ga0081538_10003684 | |||
| 674 | Ga0081538_10009951 | |||
| 675 | Ga0081538_10027072 | |||
| 676 | Ga0081540_1000312 | |||
| 677 | Ga0081540_1029928 | |||
| 678 | Ga0081539_10000834 | |||
| 679 | Ga0081539_10001116 | |||
| 680 | Ga0081539_10001410 | |||
| 681 | Ga0081539_10004305 | |||
| 682 | Ga0081539_10033090 | |||
| 683 | Ga0081539_10035014 | |||
| 684 | Ga0070717_10021853 | |||
| 685 | Ga0075432_10005785 | |||
| 686 | Ga0070715_10037590 | |||
| 687 | Ga0070712_100039424 | |||
| 688 | Ga0070712_100047517 | |||
| 689 | Ga0097621_100070992 | |||
| 690 | Ga0097621_100098840 | |||
| 691 | Ga0068871_100005745 | |||
| 692 | Ga0075430_100005761 | |||
| 693 | Ga0075431_100004111 | |||
| 694 | Ga0075431_100024615 | |||
| 695 | Ga0075433_10010431 | |||
| 696 | Ga0075434_100003608 | |||
| 697 | Ga0097620_100057503 | |||
| 698 | Ga0111539_10036479 | |||
| 699 | Ga0111539_10091964 | |||
| 700 | Ga0105245_10004392 | |||
| 701 | Ga0105245_10028968 | |||
| 702 | Ga0105247_10015678 | |||
| 703 | Ga0114129_10116706 | |||
| 704 | Ga0105241_10021155 | |||
| 705 | Ga0105242_10022936 | |||
| 706 | Ga0105248_10033923 | |||
| 707 | Ga0105248_10115538 | |||
| 708 | Ga0105237_10139520 | |||
| 709 | Ga0105238_10040007 | |||
| 710 | Ga0105238_10104610 | |||
| 711 | Ga0105249_10007578 | |||
| 712 | Ga0105239_10028396 | |||
| 713 | Ga0105246_10030849 | |||
| 714 | Ga0105246_10087818 | |||
| 715 | Ga0154018_116725 | |||
| 716 | Ga0154019_116697 | |||
| 717 | Ga0154019_117904 | |||
| 718 | Ga0154010_114046 | |||
| 719 | Ga0157371_10036482 | |||
| 720 | Ga0157369_10190807 | |||
| 721 | Ga0157374_10005682 | |||
| 722 | Ga0157374_10025412 | |||
| 723 | Ga0157378_10086512 | |||
| 724 | Ga0157372_10115801 | |||
| 725 | Ga0157375_10085882 | |||
| 726 | Ga0157375_10121317 | |||
| 727 | Ga0157377_10001262 | |||
| 728 | Ga0157379_10112967 | |||
| 729 | Ga0197907_10712108 | |||
| 730 | Ga0197907_11193090 | |||
| 731 | Ga0197907_11347956 | |||
| 732 | Ga0206356_10717600 | |||
| 733 | Ga0206356_10760723 | |||
| 734 | Ga0206356_11166442 | |||
| 735 | Ga0206356_11623651 | |||
| 736 | Ga0206356_11656272 | |||
| 737 | Ga0206349_1063486 | |||
| 738 | Ga0206349_1130736 | |||
| 739 | Ga0206349_1481511 | |||
| 740 | Ga0206355_1033109 | |||
| 741 | Ga0206355_1101757 | |||
| 742 | Ga0206355_1167982 | |||
| 743 | Ga0206355_1243473 | |||
| 744 | Ga0206355_1360583 | |||
| 745 | Ga0206351_10042734 | |||
| 746 | Ga0206351_10266398 | |||
| 747 | Ga0206352_10155988 | |||
| 748 | Ga0206352_10330544 | |||
| 749 | Ga0206352_10545168 | |||
| 750 | Ga0206350_10164620 | |||
| 751 | Ga0206350_10484114 | |||
| 752 | Ga0206350_11095238 | |||
| 753 | Ga0206354_10133038 | |||
| 754 | Ga0206354_10194144 | |||
| 755 | Ga0206354_10596313 | |||
| 756 | Ga0206354_11373415 | |||
| 757 | Ga0206353_10532549 | |||
| 758 | Ga0206353_11086046 | |||
| 759 | Ga0206353_11235669 | |||
| 760 | Ga0154015_1196169 | |||
| 761 | Ga0154015_1271345 | |||
| 762 | Ga0154015_1419653 | |||
| 763 | Ga0213876_10073983 | |||
| 764 | Ga0213875_10000225 | |||
| 765 | Ga0213875_10000286 | |||
| 766 | Ga0213875_10001346 | |||
| 767 | Ga0213875_10008561 | |||
| 768 | Ga0224712_10004330 | |||
| 769 | Ga0224712_10005119 | |||
| 770 | Ga0224712_10009256 | |||
| 771 | Ga0207653_10008227 | |||
| 772 | Ga0207682_10007999 | |||
| 773 | Ga0207642_10059039 | |||
| 774 | Ga0207688_10000417 | |||
| 775 | Ga0207688_10017685 | |||
| 776 | Ga0207647_10006330 | |||
| 777 | Ga0207647_10062302 | |||
| 778 | Ga0207699_10063834 | |||
| 779 | Ga0207645_10010229 | |||
| 780 | Ga0207645_10064633 | |||
| 781 | Ga0207643_10000261 | |||
| 782 | Ga0207654_10017256 | |||
| 783 | Ga0207693_10002432 | |||
| 784 | Ga0207693_10010540 | |||
| 785 | Ga0207693_10038821 | |||
| 786 | Ga0207663_10055281 | |||
| 787 | Ga0207660_10001785 | |||
| 788 | Ga0207662_10005289 | |||
| 789 | Ga0207657_10018487 | |||
| 790 | Ga0207649_10007284 | |||
| 791 | Ga0207652_10019986 | |||
| 792 | Ga0207681_10020581 | |||
| 793 | Ga0207650_10000761 | |||
| 794 | Ga0207650_10026777 | |||
| 795 | Ga0207659_10034216 | |||
| 796 | Ga0207659_10045432 | |||
| 797 | Ga0207687_10003002 | |||
| 798 | Ga0207687_10013358 | |||
| 799 | Ga0207687_10014902 | |||
| 800 | Ga0207687_10016192 | |||
| 801 | Ga0207700_10011239 | |||
| 802 | Ga0207664_10023254 | |||
| 803 | Ga0207664_10024695 | |||
| 804 | Ga0207644_10009429 | |||
| 805 | Ga0207644_10024247 | |||
| 806 | Ga0207706_10056098 | |||
| 807 | Ga0207706_10061605 | |||
| 808 | Ga0207706_10068445 | |||
| 809 | Ga0207709_10006789 | |||
| 810 | Ga0207669_10002929 | |||
| 811 | Ga0207665_10002140 | |||
| 812 | Ga0207691_10018372 | |||
| 813 | Ga0207691_10036270 | |||
| 814 | Ga0207711_10062713 | |||
| 815 | Ga0207711_10065025 | |||
| 816 | Ga0207689_10005920 | |||
| 817 | Ga0207689_10061345 | |||
| 818 | Ga0207689_10074010 | |||
| 819 | Ga0207661_10009581 | |||
| 820 | Ga0207661_10034644 | |||
| 821 | Ga0207661_10070118 | |||
| 822 | Ga0207661_10100067 | |||
| 823 | Ga0207679_10008502 | |||
| 824 | Ga0207667_10072112 | |||
| 825 | Ga0207651_10045619 | |||
| 826 | Ga0207677_10005733 | |||
| 827 | Ga0207703_10032908 | |||
| 828 | Ga0207703_10098113 | |||
| 829 | Ga0207703_10153872 | |||
| 830 | Ga0207639_10025198 | |||
| 831 | Ga0207678_10005211 | |||
| 832 | Ga0207678_10012130 | |||
| 833 | Ga0207678_10016374 | |||
| 834 | Ga0207708_10000271 | |||
| 835 | Ga0207702_10000505 | |||
| 836 | Ga0207641_10169198 | |||
| 837 | Ga0207676_10000495 | |||
| 838 | Ga0207676_10031983 | |||
| 839 | Ga0207674_10029427 | |||
| 840 | Ga0207674_10111348 | |||
| 841 | Ga0207675_100005705 | |||
| 842 | Ga0207675_100024837 | |||
| 843 | Ga0207683_10000524 | |||
| 844 | Ga0207683_10049277 | |||
| 845 | Ga0207698_10005868 | |||
| 846 | Ga0207698_10030758 | |||
| 847 | Ga0207428_10007798 | |||
| 848 | Ga0207428_10067896 | |||
| 849 | Ga0268266_10005503 | |||
| 850 | Ga0268264_10061884 | |||
| 851 | Ga0265766_1000237 | |||
| 852 | Ga0265340_10015454 | |||
| 853 | Ga0307408_100035361 | |||
| 854 | Ga0307413_10092059 | |||
| 855 | Ga0307518_10003635 | |||
| 856 | Ga0307410_10055499 | |||
| 857 | Ga0307406_10022258 | |||
| 858 | Ga0307407_10032306 | |||
| 859 | Ga0307409_100021941 | |||
| 860 | Ga0307409_100097207 | |||
| 861 | Ga0307409_100123061 | |||
| 862 | Ga0307416_100002309 | |||
| 863 | Ga0307416_100070184 | |||
| 864 | Ga0307414_10073627 | |||
| 865 | Ga0307415_100012647 | |||
| 866 | Ga0307415_100064422 | |||
| 867 | Ga0373926_0002072 | |||
| 868 | Ga0373944_0000887 | |||
| 869 | Ga0373951_0010322 | |||
| 870 | Ga0373939_0006695 | |||
| 871 | Ga0373957_0037957 | |||
| 872 | Ga0373943_0003924 | |||
| 873 | Ga0373946_0000452 | |||
| 874 | Ga0373942_0006004 | |||
| 875 | Ga0373924_0019734 | |||
| 876 | Ga0373935_0058898 | |||
| 877 | Ga0373933_0019617 | |||
| 878 | Ga0373937_0010782 | |||
| 879 | Ga0373937_0020349 | |||
| 880 | Ga0373925_0006377 | |||
| 881 | Ga0395899_0007323 | |||
| 882 | Ga0395900_0159643 | |||
| 883 | Ga0395898_0029492 | |||
| 884 | Ga0436364_0420889 | |||
| 885 | Ga0436364_0455306 | |||
| 886 | Ga0436364_0872840 | |||
| 887 | Ga0436364_1299740 | |||
| 888 | Ga0436364_1496151 | |||
| 889 | Ga0395901_0019307 | |||
| 890 | Ga0436365_0584563 | |||
| 891 | Ga0436365_0855511 | |||
| 892 | Ga0436365_1015637 | |||
| 893 | Ga0436365_1324271 | |||
| 894 | Ga0436363_0839818 | |||
| 895 | Ga0466972_0004294 | |||
| 896 | Ga0466965_0021763 | |||
| 897 | Ga0466965_0065546 | |||
| 898 | Ga0466966_0001327 | |||
| 899 | Ga0466963_0000174 | |||
| 900 | Ga0466963_0002996 | |||
| 901 | Ga0466963_0004285 | |||
| 902 | Ga0466963_0017094 | |||
| 903 | Ga0466963_0032908 | |||
| 904 | Ga0466971_0000718 | |||
| 905 | Ga0466971_0001963 | |||
| 906 | Ga0466970_0004247 | |||
| 907 | Ga0466957_0010409 | |||
| 908 | Ga0466957_0072910 | |||
| 909 | Ga0466960_0001561 | |||
| 910 | Ga0466960_0036665 | |||
| 911 | Ga0466959_0000228 | |||
| 912 | Ga0466959_0023344 | |||
| 913 | Ga0466958_0002105 | |||
| 914 | Ga0466958_0003604 | |||
| 915 | Ga0466958_0049626 | |||
| 916 | Ga0466958_0052634 | |||
| 917 | Ga0466967_0001896 | |||
| 918 | Ga0466967_0010613 | |||
| 919 | Ga0466967_0010669 | |||
| 920 | Ga0466967_0023007 | |||
| 921 | Ga0466967_0031551 | |||
| 922 | Ga0466967_0034313 | |||
| 923 | Ga0466967_0038170 | |||
| 924 | Ga0495592_0063193 | |||
| 925 | Ga0495641_0006750 | |||
| 926 | Ga0495651_0006381 | |||
| 927 | Ga0495651_0022134 | |||
| 928 | Ga0495653_0013198 | |||
| 929 | Ga0495653_0014374 | |||
| 930 | Ga0495605_0001961 | |||
| 931 | Ga0495662_0038420 | |||
| 932 | Ga0495664_0000449 | |||
| 933 | Ga0495585_0005511 | |||
| 934 | Ga0495596_0031283 | |||
| 935 | Ga0495583_0006012 | |||
| 936 | Ga0495606_0020536 | |||
| 937 | Ga0495608_0010061 | |||
| 938 | Ga0495608_0051651 | |||
| 939 | Ga0495608_0107164 | |||
| 940 | Ga0495618_0018692 | |||
| 941 | Ga0495620_0001163 | |||
| 942 | Ga0495628_0029883 | |||
| 943 | Ga0495628_0114202 | |||
| 944 | Ga0495631_0012273 | |||
| 945 | Ga0495652_0016029 | |||
| 946 | Ga0495652_0047649 | |||
| 947 | Ga0495652_0131002 | |||
| 948 | Ga0495640_0012022 | |||
| 949 | Ga0495587_0010914 | |||
| 950 | Ga0495645_0016408 | |||
| 951 | Ga0495667_0004492 | |||
| 952 | Ga0495667_0013305 | |||
| 953 | Ga0495668_0003363 | |||
| 954 | Ga0495625_0010890 | |||
| 955 | Ga0495635_0012561 | |||
| 956 | Ga0495661_0071139 | |||
| 957 | Ga0495657_0014724 | |||
| 958 | Ga0495657_0020239 | |||
| 959 | Ga0495646_0009174 | |||
| 960 | Ga0495624_0010135 | |||
| 961 | Ga0495589_0021790 | |||
| 962 | Ga0495600_0018098 | |||
| 963 | Ga0495660_0036139 | |||
| 964 | Ga0495581_0015836 | |||
| 965 | Ga0495604_0038244 | |||
| 966 | Ga0495674_0016265 | |||
| 967 | Ga0495674_0059184 | |||
| 968 | Ga0495672_0002584 | |||
| 969 | Ga0495676_0005502 | |||
| 970 | Ga0495680_0005032 | |||
| 971 | Ga0495680_0011913 | |||
| 972 | Ga0495683_0000181 | |||
| 973 | Ga0495683_0012380 | |||
| 974 | Ga0495687_006145 | |||
| 975 | Ga0495675_0004532 | |||
| 976 | Ga0495685_003387 | |||
| 977 | Ga0495673_0001734 | |||
| 978 | Ga0495684_0002060 | |||
| 979 | Ga0495684_0029866 | |||
| 980 | Ga0495686_0018214 | |||
| 981 | Ga0495602_0012209 | |||
| 982 | Ga0496100_0023541 | |||
| 983 | Ga0496101_0003564 | |||
| 984 | Ga0496101_0064645 | |||
| 985 | Ga0496102_0005604 | |||
| 986 | Ga0496102_0050295 | |||
| 987 | Ga0496104_0005397 | |||
| 988 | Ga0496104_0015960 | |||
| 989 | Ga0496104_0021478 | |||
| 990 | Ga0496104_0034290 | |||
| 991 | Ga0496104_0084833 | |||
| 992 | Ga0496105_0012520 | |||
| 993 | Ga0496105_0025577 | |||
| 994 | Ga0496105_0026922 | |||
| 995 | Ga0496105_0038128 | |||
| 996 | Ga0496105_0158976 | |||
| 997 | Ga0496106_0004952 | |||
| 998 | Ga0496106_0013769 | |||
| 999 | Ga0496106_0017885 | |||
| 1000 | Ga0496106_0037761 | |||
| 1001 | Ga0496107_0024845 | |||
| 1002 | Ga0496107_0035699 | |||
| 1003 | Ga0496108_0000534 | |||
| 1004 | Ga0496108_0011234 | |||
| 1005 | Ga0496108_0037136 | |||
| 1006 | Ga0496109_0006294 | |||
| 1007 | Ga0496109_0014054 | |||
| 1008 | Ga0496109_0029610 | |||
| 1009 | Ga0496109_0151612 | |||
| 1010 | Ga0496110_0017012 | |||
| 1011 | Ga0496110_0030458 | |||
| 1012 | Ga0496110_0038185 | |||
| 1013 | Ga0496110_0193732 | |||
| 1014 | Ga0496111_0007559 | |||
| 1015 | Ga0496111_0028865 | |||
| 1016 | Ga0496112_0009048 | |||
| 1017 | Ga0496112_0010375 | |||
| 1018 | Ga0496112_0022269 | |||
| 1019 | Ga0496112_0029517 | |||
| 1020 | Ga0496113_0002393 | |||
| 1021 | Ga0496113_0022005 | |||
| 1022 | Ga0496115_0024602 | |||
| 1023 | Ga0496115_0115271 | |||
| 1024 | Ga0496126_0003818 | |||
| 1025 | Ga0501315_003873 | |||
| 1026 | Ga0501032_0107829 | |||
| 1027 | Ga0501039_0199238 | |||
| 1028 | Ga0501042_0116202 | |||
| 1029 | Ga0501043_0001195 | |||
| 1030 | Ga0501076_0022536 | |||
| 1031 | Ga0501077_0034319 | |||
| 1032 | Ga0501077_0090950 | |||
| 1033 | Ga0501044_0001610 | |||
| 1034 | Ga0501044_0005840 | |||
| 1035 | nmdc:mga0qj67_54128_c1 | |||
| 1036 | nmdc:mga06r32_70618_c1 | |||
| 1037 | nmdc:mga06r32_8703_c1 | |||
| 1038 | nmdc:mga08y16_1370_c1 | |||
| 1039 | nmdc:mga08y16_266009_c1 | |||
| 1040 | nmdc:mga08y16_65846_c1 | |||
| 1041 | nmdc:mga0n895_5860_c1 | |||
| 1042 | nmdc:mga0rr50_5506_c1 | |||
| 1043 | nmdc:mga08x19_2383_c1 | |||
| 1044 | nmdc:mga0a205_8358_c1 | |||
| 1045 | Ga0500635_0002587 | |||
| 1046 | Ga0495619_0006735 | |||
| 1047 | Ga0500643_009919 | |||
| 1048 | Ga0500559_0007497 | |||
| 1049 | Ga0500616_0000251 | |||
| 1050 | Ga0500616_0000966 | |||
| 1051 | Ga0590074_002338 | |||
| 1052 | Ga0590077_005194 | |||
| 1053 | Ga0587066_000964 | |||
| 1054 | Ga0587066_001556 | |||
| 1055 | Ga0587070_001628 | |||
| 1056 | Ga0587073_0000752 | |||
| 1057 | Ga0587073_0000888 | |||
| 1058 | Ga0587073_0001936 | |||
| 1059 | Ga0587077_001804 | |||
| 1060 | Ga0587077_002517 | |||
| 1061 | Ga0587080_001591 | |||
| 1062 | Ga0587080_001731 | |||
| 1063 | Ga0587082_000480 | |||
| 1064 | Ga0587082_000526 | |||
| 1065 | Ga0587082_000997 | |||
| 1066 | Ga0587083_0001051 | |||
| 1067 | Ga0587085_000674 | |||
| 1068 | Ga0587085_000838 | |||
| 1069 | Ga0587086_000737 | |||
| 1070 | Ga0587088_001066 | |||
| 1071 | Ga0587089_001017 | |||
| 1072 | Ga0587090_002703 | |||
| 1073 | Ga0587094_001038 | |||
| 1074 | Ga0587099_000467 | |||
| 1075 | Ga0587099_000803 | |||
| 1076 | Ga0587101_000438 | |||
| 1077 | Ga0587115_000838 | |||
| 1078 | Ga0587128_000501 | |||
| 1079 | Ga0587062_001486 | |||
| 1080 | Ga0587068_001461 | |||
| 1081 | Ga0587068_002395 | |||
| 1082 | Ga0587069_000360 | |||
| 1083 | Ga0587069_000791 | |||
| 1084 | Ga0587075_000776 | |||
| 1085 | Ga0587075_000893 | |||
| 1086 | Ga0587078_001086 | |||
| 1087 | Ga0587100_000219 | |||
| 1088 | Ga0587102_000396 | |||
| 1089 | Ga0587071_001409 | |||
| 1090 | Ga0587071_001935 | |||
| 1091 | Ga0587071_002031 | |||
| 1092 | Ga0587071_002161 | |||
| 1093 | Ga0587071_002870 | |||
| 1094 | Ga0587071_003032 | |||
| 1095 | Ga0587111_0003195 | |||
| 1096 | Ga0587111_0003835 | |||
| 1097 | Ga0587111_0004083 | |||
| 1098 | Ga0501082_0017637 | |||
| 1099 | Ga0466962_0000428 | |||
| 1100 | Ga0530510_0011189 | |||
| 1101 | 2902797421 | |||
| 1102 | 2558912714 | |||
| 1103 | 2583153444 | |||
| 1104 | 2734967969 | |||
| 1105 | 2816503778 | |||
| 1106 | 2862514749 | |||
| 1107 | 2866552302 | |||
| 1108 | 2866554661 | |||
| 1109 | 2870787003 | |||
| 1110 | 2899371364 | |||
| 1111 | 2899375962 | |||
| 1112 | 2912727291 | |||
| 1113 | 2917741932 | |||
| 1114 | 2919038145 | |||
| 1115 | 8054477549 | |||
| 1116 | 8054479085 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6zcw-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.8883 | 31 | 543 |
| 1flg-assembly1.cif.gz_B | crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa | 0.886 | 33 | 544 |
| 6zcv-assembly1.cif.gz_A | crystal structure of lanthanide-dependent alcohol dehydrogenase pedh from pseudomonas putida kt2440 | 0.8826 | 31 | 543 |
| 7cdl-assembly2.cif.gz_D | holo-methanol dehydrogenase (mdh) with cys131-cys132 reduced from methylococcus capsulatus (bath) | 0.8675 | 35 | 542 |
| 6oc6-assembly2.cif.gz_B | lanthanide-dependent methanol dehydrogenase xoxf from methylobacterium extorquens, in complex with lanthanum and pyrroloquinoline quinone | 0.867 | 35 | 544 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1flgA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8963 | 33 | 544 | 2.140.10.10 |
| 4tqoD00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8735 | 35 | 542 | 2.140.10.10 |
| 6damA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8644 | 35 | 544 | 2.140.10.10 |
| 1flgA00 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.8448 | 33 | 544 | 2.140.10.10 |
| 1kb0A01 | Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily | 0.842 | 28 | 542 | 2.140.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9A5M0-F1-model_v4 | Cytochrome c domain-containing protein | 0.9483 | 430 | 515 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A7W1LMC4-F1-model_v4 | PQQ-dependent dehydrogenase, methanol/ethanol family (EC 1.1.2.-) | 0.9365 | 109 | 544 |
GO:0005509
GO:0016020 GO:0016614 |
| AF-A0A848SK55-F1-model_v4 | PQQ-binding-like beta-propeller repeat protein | 0.9305 | 429 | 516 |
GO:0009055
GO:0020037 GO:0046872 |
| AF-A0A7W1JR84-F1-model_v4 | PQQ-dependent dehydrogenase, methanol/ethanol family (EC 1.1.2.-) | 0.9223 | 21 | 543 |
GO:0005509
GO:0016020 GO:0016614 |
| AF-A0A7C7PDP6-F1-model_v4 | deleted | 0.9183 | 433 | 544 |
|