F463456
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 558 | 268 | 521 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100002381|Ga0307408_1000023817 |
| Length | 206 |
| Sequence | MMIGTKYKIALKQQVIERFTFRNRIFALMENRKLKLWELDRVGEEEFRAQKKFPIILVLNDIRSLNNIGSFFRTADALNIEKIYLCGITAVPPHRDIHKTALGATETVEWEYRENILELVSELQNNGVSVCTIEQTEKTTLLHQIDQLTEERFALVFGNEVDGVDQEVINAADHIIEIPQFGTKHSFNVAVCAGIVTWEFAKRYIA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 5 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 6 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 7 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 8 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 9 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 10 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 11 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 12 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 13 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 14 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 15 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 16 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 17 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 18 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 19 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 20 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 21 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 22 | 2890804823 | Fluviicola sp. SGL-29 | Isolate | Rhizosphere |
| 23 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 24 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 25 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 26 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 27 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 28 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 29 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 30 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 31 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 32 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 33 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 34 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 35 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 36 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 37 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 38 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 39 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 40 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 41 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 42 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 43 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 44 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 45 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 46 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 47 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 48 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 49 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 50 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 51 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 52 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 53 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 54 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 55 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 59 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 60 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 62 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 123 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 172 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 173 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 174 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 200 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 201 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 240 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 241 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 242 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 243 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 244 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 245 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 246 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 247 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 255 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 258 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 262 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 263 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 264 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 267 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 268 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.65 |
| Metatranscriptomes | 0.36 |
| Isolates | 6.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.89 |
| Nodule | 0 |
| Rhizoplane | 0.72 |
| Rhizosphere | 79.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1953040 | 2162886007 | Bacteria | 2255 |
| 2 | SwRhRL2b_contig_3746020 | 2162886007 | Bacteria | 5379 |
| 3 | JGI24740J21852_10027594 | 3300001979 | Bacteria | 1887 |
| 4 | JGI24739J22299_10003124 | 3300001989 | Bacteria | 6320 |
| 5 | JGI24737J22298_10000081 | 3300001990 | Bacteria | 27733 |
| 6 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 7 | JGI25162J39368_1000089 | 3300002737 | Bacteria | 104054 |
| 8 | JGI25162J39368_1001026 | 3300002737 | Bacteria | 17284 |
| 9 | JGI25157J39369_1012911 | 3300002741 | Bacteria | 1058 |
| 10 | JGI25164J39214_1003551 | 3300002772 | Bacteria | 1953 |
| 11 | JGI25152J39213_1000111 | 3300002773 | Bacteria | 57579 |
| 12 | JGI25150J39212_1000009 | 3300002774 | Bacteria | 249509 |
| 13 | JGI25151J46595_10000017 | 3300003187 | Bacteria | 249509 |
| 14 | JGI25165J46597_1000694 | 3300003214 | Bacteria | 26947 |
| 15 | JGI25153J46596_10000023 | 3300003215 | Bacteria | 249509 |
| 16 | rootH1_10005699 | 3300003316 | Bacteria | 17995 |
| 17 | rootH1_10005699 | 3300003323 | Bacteria | 16393 |
| 18 | rootH1_10075429 | 3300003316 | Bacteria | 2683 |
| 19 | rootH1_10075429 | 3300003323 | Bacteria | 1366 |
| 20 | rootH1_10188739 | 3300003316 | Bacteria | 1308 |
| 21 | rootH2_10001891 | 3300003320 | Bacteria | 464318 |
| 22 | rootH2_10004559 | 3300003320 | Bacteria | 142332 |
| 23 | rootH2_10057459 | 3300003320 | Bacteria | 9721 |
| 24 | rootH2_10097202 | 3300003320 | Bacteria | 1012 |
| 25 | rootH2_10242585 | 3300003320 | Bacteria | 1802 |
| 26 | rootH2_10248911 | 3300003320 | Unclassified | 1192 |
| 27 | rootL2_10000423 | 3300003322 | Bacteria | 50071 |
| 28 | rootL2_10023987 | 3300003322 | Bacteria | 8007 |
| 29 | rootL2_10103496 | 3300003322 | Bacteria | 14927 |
| 30 | rootL2_10117027 | 3300003322 | Bacteria | 6802 |
| 31 | rootL2_10122988 | 3300003322 | Bacteria | 1485 |
| 32 | rootL2_10197573 | 3300003322 | Bacteria | 1536 |
| 33 | rootL2_10211968 | 3300003322 | Eukaryota | 1447 |
| 34 | rootL2_10237433 | 3300003322 | Bacteria | 2990 |
| 35 | rootH1_10000380 | 3300003323 | Bacteria | 28122 |
| 36 | rootH1_10002701 | 3300003323 | Bacteria | 73970 |
| 37 | rootH1_10020300 | 3300003323 | Bacteria | 21210 |
| 38 | rootH1_10037471 | 3300003323 | Bacteria | 3102 |
| 39 | rootH1_10076174 | 3300003323 | Bacteria | 6293 |
| 40 | rootH1_10204861 | 3300003323 | Bacteria | 4238 |
| 41 | Ga0055536_1000003 | 3300003781 | Bacteria | 447744 |
| 42 | Ga0055530_10003135 | 3300003791 | Bacteria | 9760 |
| 43 | Ga0055530_10051576 | 3300003791 | Bacteria | 953 |
| 44 | Ga0055531_10000058 | 3300003794 | Bacteria | 121538 |
| 45 | Ga0058863_11778257 | 3300004799 | Bacteria | 2697 |
| 46 | Ga0058862_12758247 | 3300004803 | Bacteria | 3125 |
| 47 | Ga0065714_10002530 | 3300005288 | Bacteria | 17684 |
| 48 | Ga0065714_10002817 | 3300005288 | Bacteria | 18955 |
| 49 | Ga0065714_10004334 | 3300005288 | Bacteria | 6040 |
| 50 | Ga0065714_10008852 | 3300005288 | Bacteria | 4290 |
| 51 | Ga0065714_10065450 | 3300005288 | Bacteria | 10008 |
| 52 | Ga0065714_10065676 | 3300005288 | Bacteria | 8876 |
| 53 | Ga0065714_10068853 | 3300005288 | Bacteria | 4504 |
| 54 | Ga0065714_10101961 | 3300005288 | Bacteria | 1632 |
| 55 | Ga0065714_10195385 | 3300005288 | Bacteria | 913 |
| 56 | Ga0065714_10251702 | 3300005288 | Bacteria | 774 |
| 57 | Ga0065714_10288274 | 3300005288 | Bacteria | 712 |
| 58 | Ga0065704_10000288 | 3300005289 | Bacteria | 77379 |
| 59 | Ga0065704_10018848 | 3300005289 | Bacteria | 1651 |
| 60 | Ga0065704_10083289 | 3300005289 | Bacteria | 3484 |
| 61 | Ga0065704_10085946 | 3300005289 | Bacteria | 3171 |
| 62 | Ga0065704_10157972 | 3300005289 | Bacteria | 1376 |
| 63 | Ga0065704_10178827 | 3300005289 | Bacteria | 1248 |
| 64 | Ga0070658_10000049 | 3300005327 | Bacteria | 119985 |
| 65 | Ga0070658_10165199 | 3300005327 | Bacteria | 1858 |
| 66 | Ga0070676_10000563 | 3300005328 | Bacteria | 17973 |
| 67 | Ga0070683_100626514 | 3300005329 | Unclassified | 1030 |
| 68 | Ga0070680_100040500 | 3300005336 | Bacteria | 3772 |
| 69 | Ga0068868_100026907 | 3300005338 | Bacteria | 4385 |
| 70 | Ga0068868_100812297 | 3300005338 | Bacteria | 844 |
| 71 | Ga0070660_100026708 | 3300005339 | Bacteria | 4302 |
| 72 | Ga0070660_100080720 | 3300005339 | Bacteria | 2553 |
| 73 | Ga0070660_100106243 | 3300005339 | Unclassified | 2229 |
| 74 | Ga0070689_101258510 | 3300005340 | Bacteria | 665 |
| 75 | Ga0070691_10356766 | 3300005341 | Bacteria | 813 |
| 76 | Ga0070671_100007939 | 3300005355 | Bacteria | 8487 |
| 77 | Ga0070674_100083649 | 3300005356 | Bacteria | 2286 |
| 78 | Ga0070673_100093520 | 3300005364 | Bacteria | 2462 |
| 79 | Ga0070673_100652513 | 3300005364 | Bacteria | 963 |
| 80 | Ga0070659_100000432 | 3300005366 | Bacteria | 31586 |
| 81 | Ga0070659_100014484 | 3300005366 | Bacteria | 5894 |
| 82 | Ga0070659_100052411 | 3300005366 | Bacteria | 3209 |
| 83 | Ga0070663_100084313 | 3300005455 | Bacteria | 2342 |
| 84 | Ga0070662_100000045 | 3300005457 | Bacteria | 67900 |
| 85 | Ga0068867_100000344 | 3300005459 | Bacteria | 30803 |
| 86 | Ga0070685_10028821 | 3300005466 | Bacteria | 3080 |
| 87 | Ga0070679_100352893 | 3300005530 | Bacteria | 1418 |
| 88 | Ga0068853_100054716 | 3300005539 | Bacteria | 3440 |
| 89 | Ga0068853_100091965 | 3300005539 | Bacteria | 2668 |
| 90 | Ga0068853_100273701 | 3300005539 | Bacteria | 1555 |
| 91 | Ga0068853_100822244 | 3300005539 | Bacteria | 890 |
| 92 | Ga0070665_100000020 | 3300005548 | Bacteria | 389687 |
| 93 | Ga0068855_100000195 | 3300005563 | Bacteria | 78223 |
| 94 | Ga0068855_100000988 | 3300005563 | Bacteria | 35353 |
| 95 | Ga0068855_100044282 | 3300005563 | Bacteria | 5267 |
| 96 | Ga0068855_100094219 | 3300005563 | Bacteria | 3453 |
| 97 | Ga0068855_100106546 | 3300005563 | Bacteria | 3222 |
| 98 | Ga0068855_100695735 | 3300005563 | Bacteria | 1088 |
| 99 | Ga0068856_100000935 | 3300005614 | Bacteria | 31259 |
| 100 | Ga0068856_100013777 | 3300005614 | Bacteria | 7815 |
| 101 | Ga0068856_100232393 | 3300005614 | Bacteria | 1859 |
| 102 | Ga0068852_100107178 | 3300005616 | Bacteria | 2534 |
| 103 | Ga0068852_100196573 | 3300005616 | Bacteria | 1906 |
| 104 | Ga0068859_100996033 | 3300005617 | Bacteria | 920 |
| 105 | Ga0068866_10027440 | 3300005718 | Bacteria | 2700 |
| 106 | Ga0068870_10097036 | 3300005840 | Bacteria | 1658 |
| 107 | Ga0068860_100122107 | 3300005843 | Bacteria | 2495 |
| 108 | Ga0075366_10001766 | 3300006195 | Bacteria | 10903 |
| 109 | Ga0075366_10003263 | 3300006195 | Bacteria | 8527 |
| 110 | Ga0075366_10175961 | 3300006195 | Bacteria | 1299 |
| 111 | Ga0097621_100005555 | 3300006237 | Bacteria | 8890 |
| 112 | Ga0068871_100000100 | 3300006358 | Bacteria | 51253 |
| 113 | Ga0075430_100662081 | 3300006846 | Bacteria | 861 |
| 114 | Ga0068865_100005711 | 3300006881 | Bacteria | 7561 |
| 115 | Ga0097620_100995863 | 3300006931 | Bacteria | 920 |
| 116 | Ga0105244_10038104 | 3300009036 | Bacteria | 2509 |
| 117 | Ga0105244_10156571 | 3300009036 | Bacteria | 1090 |
| 118 | Ga0105240_10000193 | 3300009093 | Bacteria | 124087 |
| 119 | Ga0105240_10002893 | 3300009093 | Bacteria | 27105 |
| 120 | Ga0105240_10008133 | 3300009093 | Bacteria | 15046 |
| 121 | Ga0105240_10030991 | 3300009093 | Bacteria | 6941 |
| 122 | Ga0105240_10105032 | 3300009093 | Bacteria | 3429 |
| 123 | Ga0105240_10162937 | 3300009093 | Bacteria | 2647 |
| 124 | Ga0105240_10190532 | 3300009093 | Bacteria | 2412 |
| 125 | Ga0105240_11016994 | 3300009093 | Bacteria | 886 |
| 126 | Ga0111539_10008369 | 3300009094 | Bacteria | 13164 |
| 127 | Ga0105245_10060462 | 3300009098 | Bacteria | 3412 |
| 128 | Ga0105245_10747241 | 3300009098 | Bacteria | 1014 |
| 129 | Ga0105245_10758896 | 3300009098 | Bacteria | 1006 |
| 130 | Ga0105243_10103104 | 3300009148 | Bacteria | 2372 |
| 131 | Ga0105241_10000086 | 3300009174 | Bacteria | 69935 |
| 132 | Ga0105241_10008186 | 3300009174 | Bacteria | 7696 |
| 133 | Ga0105241_10034569 | 3300009174 | Bacteria | 3798 |
| 134 | Ga0105241_10156565 | 3300009174 | Bacteria | 1869 |
| 135 | Ga0105241_10365578 | 3300009174 | Bacteria | 1256 |
| 136 | Ga0105241_11017757 | 3300009174 | Unclassified | 776 |
| 137 | Ga0105242_10016851 | 3300009176 | Bacteria | 5688 |
| 138 | Ga0105242_10025626 | 3300009176 | Bacteria | 4669 |
| 139 | Ga0105237_10002494 | 3300009545 | Bacteria | 22822 |
| 140 | Ga0105237_10005037 | 3300009545 | Bacteria | 15043 |
| 141 | Ga0105237_10011464 | 3300009545 | Bacteria | 9377 |
| 142 | Ga0105237_10026888 | 3300009545 | Bacteria | 5880 |
| 143 | Ga0105237_10045858 | 3300009545 | Bacteria | 4398 |
| 144 | Ga0105237_10079727 | 3300009545 | Bacteria | 3264 |
| 145 | Ga0105237_10084715 | 3300009545 | Bacteria | 3160 |
| 146 | Ga0105237_10094863 | 3300009545 | Bacteria | 2972 |
| 147 | Ga0105237_10268714 | 3300009545 | Bacteria | 1708 |
| 148 | Ga0105238_10007399 | 3300009551 | Bacteria | 11001 |
| 149 | Ga0105238_10182444 | 3300009551 | Bacteria | 2075 |
| 150 | Ga0105239_10000578 | 3300010375 | Bacteria | 52273 |
| 151 | Ga0105239_10000586 | 3300010375 | Bacteria | 51873 |
| 152 | Ga0105239_10004569 | 3300010375 | Bacteria | 16504 |
| 153 | Ga0105239_10007004 | 3300010375 | Bacteria | 12974 |
| 154 | Ga0105239_10008129 | 3300010375 | Bacteria | 11976 |
| 155 | Ga0105239_10047030 | 3300010375 | Bacteria | 4728 |
| 156 | Ga0105239_10082682 | 3300010375 | Bacteria | 3536 |
| 157 | Ga0105239_10097072 | 3300010375 | Bacteria | 3256 |
| 158 | Ga0105239_10189692 | 3300010375 | Bacteria | 2301 |
| 159 | Ga0105239_10205160 | 3300010375 | Bacteria | 2209 |
| 160 | Ga0105239_10309078 | 3300010375 | Bacteria | 1781 |
| 161 | Ga0157373_10000041 | 3300013100 | Bacteria | 113871 |
| 162 | Ga0157373_10000337 | 3300013100 | Bacteria | 38082 |
| 163 | Ga0157373_10028839 | 3300013100 | Bacteria | 4002 |
| 164 | Ga0157373_10030355 | 3300013100 | Bacteria | 3889 |
| 165 | Ga0157373_10086529 | 3300013100 | Bacteria | 2209 |
| 166 | Ga0157373_10135681 | 3300013100 | Bacteria | 1730 |
| 167 | Ga0157373_10263564 | 3300013100 | Bacteria | 1219 |
| 168 | Ga0157371_10000009 | 3300013102 | Bacteria | 392895 |
| 169 | Ga0157371_10000135 | 3300013102 | Bacteria | 107607 |
| 170 | Ga0157371_10002029 | 3300013102 | Bacteria | 19994 |
| 171 | Ga0157371_10004696 | 3300013102 | Bacteria | 11804 |
| 172 | Ga0157371_10014439 | 3300013102 | Bacteria | 5959 |
| 173 | Ga0157371_10015862 | 3300013102 | Bacteria | 5636 |
| 174 | Ga0157371_10048591 | 3300013102 | Bacteria | 3016 |
| 175 | Ga0157371_10075092 | 3300013102 | Bacteria | 2394 |
| 176 | Ga0157371_10151627 | 3300013102 | Bacteria | 1653 |
| 177 | Ga0157371_10483507 | 3300013102 | Bacteria | 913 |
| 178 | Ga0157371_10814988 | 3300013102 | Bacteria | 704 |
| 179 | Ga0157370_10008331 | 3300013104 | Bacteria | 11182 |
| 180 | Ga0157370_10017168 | 3300013104 | Bacteria | 7306 |
| 181 | Ga0157370_10022230 | 3300013104 | Bacteria | 6311 |
| 182 | Ga0157370_10029541 | 3300013104 | Bacteria | 5376 |
| 183 | Ga0157370_10047084 | 3300013104 | Bacteria | 4134 |
| 184 | Ga0157370_10051390 | 3300013104 | Bacteria | 3937 |
| 185 | Ga0157370_10092087 | 3300013104 | Bacteria | 2846 |
| 186 | Ga0157370_10166267 | 3300013104 | Bacteria | 2051 |
| 187 | Ga0157370_10613148 | 3300013104 | Bacteria | 996 |
| 188 | Ga0157369_10000006 | 3300013105 | Bacteria | 412230 |
| 189 | Ga0157369_10005660 | 3300013105 | Bacteria | 14515 |
| 190 | Ga0157369_10019913 | 3300013105 | Bacteria | 7505 |
| 191 | Ga0157369_10558898 | 3300013105 | Bacteria | 1182 |
| 192 | Ga0157369_10615316 | 3300013105 | Bacteria | 1121 |
| 193 | Ga0157369_11265142 | 3300013105 | Bacteria | 752 |
| 194 | Ga0157374_10000128 | 3300013296 | Bacteria | 69753 |
| 195 | Ga0157374_10000202 | 3300013296 | Bacteria | 54739 |
| 196 | Ga0157374_10007012 | 3300013296 | Bacteria | 9591 |
| 197 | Ga0157374_10345422 | 3300013296 | Bacteria | 1478 |
| 198 | Ga0157374_10429317 | 3300013296 | Bacteria | 1321 |
| 199 | Ga0157378_10004756 | 3300013297 | Bacteria | 11898 |
| 200 | Ga0157378_10014634 | 3300013297 | Bacteria | 6869 |
| 201 | Ga0157378_10550504 | 3300013297 | Bacteria | 1159 |
| 202 | Ga0163162_10000032 | 3300013306 | Bacteria | 156609 |
| 203 | Ga0163162_10003807 | 3300013306 | Bacteria | 14466 |
| 204 | Ga0163162_10156190 | 3300013306 | Bacteria | 2402 |
| 205 | Ga0163162_10185627 | 3300013306 | Bacteria | 2206 |
| 206 | Ga0163162_10334499 | 3300013306 | Bacteria | 1647 |
| 207 | Ga0163162_10705086 | 3300013306 | Bacteria | 1131 |
| 208 | Ga0157372_10000017 | 3300013307 | Bacteria | 219543 |
| 209 | Ga0157372_10000061 | 3300013307 | Bacteria | 119814 |
| 210 | Ga0157372_10000250 | 3300013307 | Bacteria | 59465 |
| 211 | Ga0157372_10003385 | 3300013307 | Bacteria | 17204 |
| 212 | Ga0157372_10031266 | 3300013307 | Bacteria | 5828 |
| 213 | Ga0157372_10047894 | 3300013307 | Bacteria | 4750 |
| 214 | Ga0157372_10165362 | 3300013307 | Bacteria | 2558 |
| 215 | Ga0157372_10261689 | 3300013307 | Unclassified | 2009 |
| 216 | Ga0157375_10008600 | 3300013308 | Bacteria | 8939 |
| 217 | Ga0157375_10198211 | 3300013308 | Bacteria | 2163 |
| 218 | Ga0163163_11560809 | 3300014325 | Unclassified | 721 |
| 219 | Ga0182008_10000001 | 3300014497 | Bacteria | 540790 |
| 220 | Ga0182008_10004035 | 3300014497 | Bacteria | 8665 |
| 221 | Ga0182008_10012175 | 3300014497 | Bacteria | 4547 |
| 222 | Ga0182008_10088698 | 3300014497 | Bacteria | 1524 |
| 223 | Ga0157377_10128216 | 3300014745 | Bacteria | 1546 |
| 224 | Ga0157376_11633635 | 3300014969 | Unclassified | 679 |
| 225 | Ga0182006_1000244 | 3300015261 | Bacteria | 50752 |
| 226 | Ga0182006_1000646 | 3300015261 | Bacteria | 24714 |
| 227 | Ga0182006_1004222 | 3300015261 | Bacteria | 7123 |
| 228 | Ga0182006_1004407 | 3300015261 | Bacteria | 6956 |
| 229 | Ga0182006_1006216 | 3300015261 | Bacteria | 5573 |
| 230 | Ga0182006_1093123 | 3300015261 | Bacteria | 1081 |
| 231 | Ga0182007_10000001 | 3300015262 | Bacteria | 1127301 |
| 232 | Ga0182007_10070898 | 3300015262 | Unclassified | 1142 |
| 233 | Ga0182007_10082031 | 3300015262 | Bacteria | 1058 |
| 234 | Ga0183373_1010 | 3300015682 | Bacteria | 196982 |
| 235 | Ga0163161_10000468 | 3300017792 | Bacteria | 33545 |
| 236 | Ga0163161_10000919 | 3300017792 | Bacteria | 22732 |
| 237 | Ga0163161_10003366 | 3300017792 | Bacteria | 11214 |
| 238 | Ga0163161_10007612 | 3300017792 | Bacteria | 7491 |
| 239 | Ga0163161_10061405 | 3300017792 | Bacteria | 2736 |
| 240 | Ga0163161_10074368 | 3300017792 | Bacteria | 2491 |
| 241 | Ga0163161_11108622 | 3300017792 | Bacteria | 681 |
| 242 | Ga0213872_10048195 | 3300021361 | Bacteria | 1936 |
| 243 | Ga0209437_100008 | 3300025233 | Bacteria | 921142 |
| 244 | Ga0209437_100221 | 3300025233 | Bacteria | 104135 |
| 245 | Ga0207425_1000007 | 3300025245 | Bacteria | 777411 |
| 246 | Ga0209026_1000383 | 3300025250 | Bacteria | 40563 |
| 247 | Ga0209026_1005674 | 3300025250 | Bacteria | 3285 |
| 248 | Ga0209026_1008704 | 3300025250 | Bacteria | 2086 |
| 249 | Ga0209026_1027504 | 3300025250 | Bacteria | 852 |
| 250 | Ga0209129_1000006 | 3300025258 | Bacteria | 777761 |
| 251 | Ga0209129_1012982 | 3300025258 | Bacteria | 1866 |
| 252 | Ga0209233_1000024 | 3300025261 | Bacteria | 695418 |
| 253 | Ga0209233_1001531 | 3300025261 | Bacteria | 9060 |
| 254 | Ga0209233_1020955 | 3300025261 | Bacteria | 1703 |
| 255 | Ga0209455_1010452 | 3300025272 | Bacteria | 2359 |
| 256 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 257 | Ga0209025_1000025 | 3300025294 | Bacteria | 524454 |
| 258 | Ga0209758_1000016 | 3300025297 | Bacteria | 778557 |
| 259 | Ga0209050_1000016 | 3300025298 | Bacteria | 729149 |
| 260 | Ga0209050_1011974 | 3300025298 | Bacteria | 4038 |
| 261 | Ga0209050_1030128 | 3300025298 | Bacteria | 1718 |
| 262 | Ga0207426_1043502 | 3300025302 | Bacteria | 1379 |
| 263 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 264 | Ga0207642_10387734 | 3300025899 | Unclassified | 833 |
| 265 | Ga0207647_10000105 | 3300025904 | Bacteria | 65502 |
| 266 | Ga0207647_10002524 | 3300025904 | Bacteria | 13860 |
| 267 | Ga0207645_10001210 | 3300025907 | Bacteria | 21312 |
| 268 | Ga0207643_10104961 | 3300025908 | Bacteria | 1660 |
| 269 | Ga0207705_10000079 | 3300025909 | Bacteria | 119999 |
| 270 | Ga0207654_10001404 | 3300025911 | Bacteria | 12762 |
| 271 | Ga0207654_10006969 | 3300025911 | Bacteria | 5695 |
| 272 | Ga0207654_10025621 | 3300025911 | Bacteria | 3184 |
| 273 | Ga0207654_10296593 | 3300025911 | Bacteria | 1098 |
| 274 | Ga0207707_10006352 | 3300025912 | Bacteria | 10323 |
| 275 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 276 | Ga0207695_10004447 | 3300025913 | Bacteria | 19105 |
| 277 | Ga0207695_10013327 | 3300025913 | Bacteria | 9810 |
| 278 | Ga0207695_10059228 | 3300025913 | Bacteria | 3972 |
| 279 | Ga0207695_10078483 | 3300025913 | Bacteria | 3349 |
| 280 | Ga0207695_10118678 | 3300025913 | Bacteria | 2616 |
| 281 | Ga0207695_10142414 | 3300025913 | Bacteria | 2344 |
| 282 | Ga0207671_10001943 | 3300025914 | Bacteria | 22809 |
| 283 | Ga0207671_10003540 | 3300025914 | Bacteria | 15488 |
| 284 | Ga0207671_10026583 | 3300025914 | Bacteria | 4334 |
| 285 | Ga0207671_10049682 | 3300025914 | Bacteria | 3105 |
| 286 | Ga0207671_10062493 | 3300025914 | Bacteria | 2765 |
| 287 | Ga0207671_10073367 | 3300025914 | Bacteria | 2556 |
| 288 | Ga0207660_10038332 | 3300025917 | Bacteria | 3345 |
| 289 | Ga0207657_10063077 | 3300025919 | Bacteria | 3171 |
| 290 | Ga0207657_10065835 | 3300025919 | Unclassified | 3087 |
| 291 | Ga0207652_10090977 | 3300025921 | Bacteria | 2682 |
| 292 | Ga0207652_10204581 | 3300025921 | Bacteria | 1777 |
| 293 | Ga0207694_10108772 | 3300025924 | Bacteria | 2203 |
| 294 | Ga0207694_10426127 | 3300025924 | Bacteria | 1106 |
| 295 | Ga0207644_10007769 | 3300025931 | Bacteria | 7002 |
| 296 | Ga0207690_10000610 | 3300025932 | Bacteria | 23101 |
| 297 | Ga0207690_10035281 | 3300025932 | Bacteria | 3230 |
| 298 | Ga0207706_10000120 | 3300025933 | Bacteria | 84222 |
| 299 | Ga0207706_10500197 | 3300025933 | Unclassified | 1049 |
| 300 | Ga0207686_10008042 | 3300025934 | Bacteria | 5690 |
| 301 | Ga0207686_10055303 | 3300025934 | Bacteria | 2490 |
| 302 | Ga0207709_10000072 | 3300025935 | Bacteria | 178084 |
| 303 | Ga0207670_10818463 | 3300025936 | Bacteria | 777 |
| 304 | Ga0207704_10000099 | 3300025938 | Bacteria | 48088 |
| 305 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 306 | Ga0207667_10001052 | 3300025949 | Bacteria | 35129 |
| 307 | Ga0207667_10115477 | 3300025949 | Bacteria | 2767 |
| 308 | Ga0207667_10287147 | 3300025949 | Bacteria | 1681 |
| 309 | Ga0207667_10301528 | 3300025949 | Bacteria | 1637 |
| 310 | Ga0207667_10412279 | 3300025949 | Bacteria | 1375 |
| 311 | Ga0207667_10480572 | 3300025949 | Bacteria | 1261 |
| 312 | Ga0207667_10575087 | 3300025949 | Bacteria | 1138 |
| 313 | Ga0207667_11158734 | 3300025949 | Bacteria | 754 |
| 314 | Ga0207651_10214500 | 3300025960 | Bacteria | 1552 |
| 315 | Ga0207651_10291006 | 3300025960 | Bacteria | 1354 |
| 316 | Ga0207677_10044162 | 3300026023 | Bacteria | 2967 |
| 317 | Ga0207639_10038699 | 3300026041 | Bacteria | 3549 |
| 318 | Ga0207639_10462656 | 3300026041 | Unclassified | 1153 |
| 319 | Ga0207639_10660145 | 3300026041 | Bacteria | 968 |
| 320 | Ga0207678_10110737 | 3300026067 | Bacteria | 2342 |
| 321 | Ga0207702_10003141 | 3300026078 | Bacteria | 15314 |
| 322 | Ga0207702_10045811 | 3300026078 | Bacteria | 3680 |
| 323 | Ga0207648_10011576 | 3300026089 | Bacteria | 8305 |
| 324 | Ga0207683_10140590 | 3300026121 | Bacteria | 2175 |
| 325 | Ga0207683_10706708 | 3300026121 | Bacteria | 935 |
| 326 | Ga0207698_10272596 | 3300026142 | Bacteria | 1561 |
| 327 | Ga0207698_10609507 | 3300026142 | Bacteria | 1077 |
| 328 | Ga0209968_1048157 | 3300027526 | Bacteria | 737 |
| 329 | Ga0207428_10216296 | 3300027907 | Bacteria | 1438 |
| 330 | Ga0268266_10000018 | 3300028379 | Bacteria | 569141 |
| 331 | Ga0268264_10099390 | 3300028381 | Bacteria | 2525 |
| 332 | Ga0307517_10003095 | 3300028786 | Bacteria | 26254 |
| 333 | Ga0307515_10000094 | 3300028794 | Bacteria | 210723 |
| 334 | Ga0307515_10000353 | 3300028794 | Bacteria | 112876 |
| 335 | Ga0307515_10000859 | 3300028794 | Bacteria | 69963 |
| 336 | Ga0307515_10039499 | 3300028794 | Bacteria | 7501 |
| 337 | Ga0307515_10113784 | 3300028794 | Bacteria | 3134 |
| 338 | Ga0307515_10139434 | 3300028794 | Bacteria | 2611 |
| 339 | Ga0265338_10024738 | 3300028800 | Bacteria | 6123 |
| 340 | Ga0316177_1179722 | 3300030731 | Bacteria | 6329 |
| 341 | Ga0316176_1157629 | 3300030732 | Bacteria | 1984 |
| 342 | Ga0316183_1027629 | 3300030742 | Bacteria | 11015 |
| 343 | Ga0316181_1023435 | 3300030744 | Bacteria | 1081 |
| 344 | Ga0316181_1051627 | 3300030744 | Bacteria | 18287 |
| 345 | Ga0307513_10078981 | 3300031456 | Bacteria | 3401 |
| 346 | Ga0307513_10550792 | 3300031456 | Bacteria | 866 |
| 347 | Ga0307509_10310740 | 3300031507 | Bacteria | 1319 |
| 348 | Ga0307509_10331298 | 3300031507 | Bacteria | 1254 |
| 349 | Ga0307408_100002381 | 3300031548 | Bacteria | 13266 |
| 350 | Ga0307408_100006190 | 3300031548 | Bacteria | 7946 |
| 351 | Ga0307408_100017152 | 3300031548 | Bacteria | 4845 |
| 352 | Ga0265342_10073159 | 3300031712 | Bacteria | 1994 |
| 353 | Ga0265342_10076799 | 3300031712 | Bacteria | 1936 |
| 354 | Ga0316576_10052599 | 3300031727 | Bacteria | 2966 |
| 355 | Ga0307405_10000010 | 3300031731 | Bacteria | 250978 |
| 356 | Ga0307405_10214521 | 3300031731 | Bacteria | 1408 |
| 357 | Ga0307405_10262355 | 3300031731 | Bacteria | 1291 |
| 358 | Ga0307405_10966005 | 3300031731 | Bacteria | 725 |
| 359 | Ga0307413_10133524 | 3300031824 | Bacteria | 1703 |
| 360 | Ga0307407_10000009 | 3300031903 | Bacteria | 188746 |
| 361 | Ga0307412_10000033 | 3300031911 | Bacteria | 206649 |
| 362 | Ga0307412_10002746 | 3300031911 | Bacteria | 9787 |
| 363 | Ga0307412_10159973 | 3300031911 | Bacteria | 1672 |
| 364 | Ga0307412_10570827 | 3300031911 | Bacteria | 953 |
| 365 | Ga0307412_10600544 | 3300031911 | Bacteria | 932 |
| 366 | Ga0307409_100454927 | 3300031995 | Bacteria | 1236 |
| 367 | Ga0307416_100000019 | 3300032002 | Bacteria | 199706 |
| 368 | Ga0307416_100039847 | 3300032002 | Bacteria | 3642 |
| 369 | Ga0307414_10000768 | 3300032004 | Bacteria | 16444 |
| 370 | Ga0307414_10015945 | 3300032004 | Bacteria | 4553 |
| 371 | Ga0307414_10036368 | 3300032004 | Bacteria | 3287 |
| 372 | Ga0307414_10044883 | 3300032004 | Bacteria | 3023 |
| 373 | Ga0307414_10057038 | 3300032004 | Bacteria | 2743 |
| 374 | Ga0307414_10072788 | 3300032004 | Bacteria | 2484 |
| 375 | Ga0307414_10086977 | 3300032004 | Bacteria | 2308 |
| 376 | Ga0307414_10335834 | 3300032004 | Bacteria | 1292 |
| 377 | Ga0307414_10864553 | 3300032004 | Bacteria | 827 |
| 378 | Ga0307414_11476284 | 3300032004 | Unclassified | 632 |
| 379 | Ga0307411_10043126 | 3300032005 | Bacteria | 2885 |
| 380 | Ga0307415_100022233 | 3300032126 | Bacteria | 3910 |
| 381 | Ga0307507_10000362 | 3300033179 | Bacteria | 93053 |
| 382 | Ga0307510_10002860 | 3300033180 | Bacteria | 19841 |
| 383 | Ga0373941_0008478 | 3300035115 | Bacteria | 2554 |
| 384 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 385 | Ga0395899_0000493 | 3300037312 | Bacteria | 44066 |
| 386 | Ga0395899_0000629 | 3300037312 | Bacteria | 36706 |
| 387 | Ga0395899_0121552 | 3300037312 | Unclassified | 1870 |
| 388 | Ga0395899_0255074 | 3300037312 | Unclassified | 1202 |
| 389 | Ga0395899_0388527 | 3300037312 | Bacteria | 926 |
| 390 | Ga0395900_0000480 | 3300037418 | Bacteria | 56578 |
| 391 | Ga0395900_0000506 | 3300037418 | Bacteria | 54890 |
| 392 | Ga0395900_0095707 | 3300037418 | Unclassified | 3051 |
| 393 | Ga0395900_0191559 | 3300037418 | Bacteria | 2074 |
| 394 | Ga0395900_0208558 | 3300037418 | Unclassified | 1974 |
| 395 | Ga0395898_0012125 | 3300037466 | Bacteria | 8921 |
| 396 | Ga0395905_0001166 | 3300037471 | Bacteria | 32800 |
| 397 | Ga0395905_0004696 | 3300037471 | Bacteria | 14123 |
| 398 | Ga0395901_0000853 | 3300038443 | Bacteria | 33521 |
| 399 | Ga0395901_0002096 | 3300038443 | Bacteria | 20476 |
| 400 | Ga0395901_0171434 | 3300038443 | Unclassified | 2277 |
| 401 | Ga0436361_1016771 | 3300039447 | Bacteria | 9117 |
| 402 | Ga0451795_0270238 | 3300041456 | Bacteria | 799 |
| 403 | Ga0451833_1402693 | 3300041491 | Bacteria | 876 |
| 404 | Ga0439448_0172325 | 3300042005 | Bacteria | 755 |
| 405 | Ga0439446_0136796 | 3300042156 | Bacteria | 798 |
| 406 | Ga0451577_0042134 | 3300042876 | Bacteria | 4095 |
| 407 | Ga0451577_0060228 | 3300042876 | Bacteria | 3384 |
| 408 | Ga0453683_0040722 | 3300044673 | Bacteria | 2916 |
| 409 | Ga0466966_0028917 | 3300044684 | Bacteria | 3608 |
| 410 | Ga0466961_0060846 | 3300044693 | Bacteria | 2401 |
| 411 | Ga0466964_0013762 | 3300044706 | Bacteria | 3071 |
| 412 | Ga0453684_0001421 | 3300044712 | Bacteria | 68890 |
| 413 | Ga0453684_0013194 | 3300044712 | Bacteria | 13472 |
| 414 | Ga0453684_0018082 | 3300044712 | Bacteria | 10851 |
| 415 | Ga0453684_0032119 | 3300044712 | Bacteria | 7356 |
| 416 | Ga0453684_0536959 | 3300044712 | Bacteria | 1290 |
| 417 | Ga0453684_0555366 | 3300044712 | Bacteria | 1264 |
| 418 | Ga0453684_0702570 | 3300044712 | Bacteria | 1099 |
| 419 | Ga0453684_1225681 | 3300044712 | Bacteria | 786 |
| 420 | Ga0466959_0036343 | 3300045049 | Bacteria | 3640 |
| 421 | Ga0451576_0051858 | 3300045051 | Bacteria | 4300 |
| 422 | Ga0451576_0062486 | 3300045051 | Bacteria | 3882 |
| 423 | Ga0451576_0237784 | 3300045051 | Bacteria | 1902 |
| 424 | Ga0451576_0283830 | 3300045051 | Bacteria | 1731 |
| 425 | Ga0451576_0310393 | 3300045051 | Bacteria | 1650 |
| 426 | Ga0466958_0281339 | 3300045836 | Unclassified | 1066 |
| 427 | Ga0495651_0074069 | 3300046462 | Bacteria | 2584 |
| 428 | Ga0495650_0000132 | 3300046471 | Bacteria | 174226 |
| 429 | Ga0495650_0032725 | 3300046471 | Bacteria | 2322 |
| 430 | Ga0495650_0055942 | 3300046471 | Bacteria | 1603 |
| 431 | Ga0495585_0007009 | 3300046492 | Bacteria | 6939 |
| 432 | Ga0495585_0018872 | 3300046492 | Bacteria | 3978 |
| 433 | Ga0495583_0024265 | 3300046506 | Bacteria | 3051 |
| 434 | Ga0495583_0111811 | 3300046506 | Bacteria | 1157 |
| 435 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 436 | Ga0495606_0039595 | 3300046507 | Bacteria | 3174 |
| 437 | Ga0495606_0055333 | 3300046507 | Bacteria | 2566 |
| 438 | Ga0495606_0150390 | 3300046507 | Bacteria | 1367 |
| 439 | Ga0495608_0657234 | 3300046511 | Bacteria | 626 |
| 440 | Ga0495610_0000028 | 3300046512 | Bacteria | 272572 |
| 441 | Ga0495610_0002790 | 3300046512 | Bacteria | 14304 |
| 442 | Ga0495610_0007329 | 3300046512 | Bacteria | 7374 |
| 443 | Ga0495616_0002258 | 3300046513 | Bacteria | 12901 |
| 444 | Ga0495631_0008558 | 3300046518 | Bacteria | 5151 |
| 445 | Ga0495632_0213220 | 3300046519 | Bacteria | 875 |
| 446 | Ga0495637_0078135 | 3300046520 | Bacteria | 1323 |
| 447 | Ga0495644_0013045 | 3300046523 | Bacteria | 3194 |
| 448 | Ga0495648_0005421 | 3300046524 | Bacteria | 10602 |
| 449 | Ga0495648_0111319 | 3300046524 | Bacteria | 1489 |
| 450 | Ga0495652_0176037 | 3300046529 | Bacteria | 1647 |
| 451 | Ga0495652_0259897 | 3300046529 | Bacteria | 1282 |
| 452 | Ga0495652_0324472 | 3300046529 | Bacteria | 1111 |
| 453 | Ga0495654_0057738 | 3300046530 | Bacteria | 1874 |
| 454 | Ga0495609_0008958 | 3300046538 | Bacteria | 4868 |
| 455 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 456 | Ga0495633_0017420 | 3300046558 | Bacteria | 3675 |
| 457 | Ga0495668_0000134 | 3300046616 | Bacteria | 112135 |
| 458 | Ga0495668_0367189 | 3300046616 | Bacteria | 790 |
| 459 | Ga0495611_0145368 | 3300046648 | Bacteria | 1107 |
| 460 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 461 | Ga0495625_0000385 | 3300046660 | Bacteria | 67419 |
| 462 | Ga0495625_0045319 | 3300046660 | Bacteria | 3179 |
| 463 | Ga0495625_0068103 | 3300046660 | Bacteria | 2503 |
| 464 | Ga0495625_0096836 | 3300046660 | Bacteria | 2032 |
| 465 | Ga0495625_0297104 | 3300046660 | Bacteria | 1034 |
| 466 | Ga0495625_0373706 | 3300046660 | Bacteria | 896 |
| 467 | Ga0495625_0526560 | 3300046660 | Bacteria | 719 |
| 468 | Ga0495625_0655433 | 3300046660 | Unclassified | 625 |
| 469 | Ga0495661_0003481 | 3300046665 | Bacteria | 11604 |
| 470 | Ga0495661_0013574 | 3300046665 | Bacteria | 5468 |
| 471 | Ga0495661_0455480 | 3300046665 | Unclassified | 615 |
| 472 | Ga0495658_0137911 | 3300046683 | Bacteria | 1490 |
| 473 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 474 | Ga0495649_0031446 | 3300046694 | Bacteria | 2927 |
| 475 | Ga0495600_0278965 | 3300046809 | Bacteria | 1058 |
| 476 | Ga0495660_0024577 | 3300046810 | Bacteria | 3431 |
| 477 | Ga0495687_006934 | 3300047443 | Bacteria | 6813 |
| 478 | Ga0495687_019030 | 3300047443 | Bacteria | 3379 |
| 479 | Ga0495687_140429 | 3300047443 | Bacteria | 841 |
| 480 | Ga0495686_0001016 | 3300047472 | Bacteria | 33934 |
| 481 | Ga0495686_0004451 | 3300047472 | Bacteria | 11539 |
| 482 | Ga0495686_0088508 | 3300047472 | Unclassified | 1882 |
| 483 | Ga0495686_0451054 | 3300047472 | Bacteria | 683 |
| 484 | Ga0495614_0007965 | 3300048089 | Bacteria | 4709 |
| 485 | Ga0496115_0421152 | 3300048918 | Bacteria | 1082 |
| 486 | Ga0496115_0928643 | 3300048918 | Bacteria | 669 |
| 487 | Ga0496117_0003502 | 3300048920 | Bacteria | 18193 |
| 488 | Ga0496118_0034888 | 3300048921 | Bacteria | 4096 |
| 489 | Ga0496122_0134452 | 3300048925 | Bacteria | 1562 |
| 490 | Ga0496123_0012094 | 3300048926 | Bacteria | 7399 |
| 491 | Ga0496123_0023603 | 3300048926 | Bacteria | 4703 |
| 492 | Ga0496124_0062742 | 3300048927 | Bacteria | 3109 |
| 493 | Ga0496125_0093490 | 3300048928 | Bacteria | 2244 |
| 494 | Ga0496126_0187828 | 3300048929 | Bacteria | 1752 |
| 495 | Ga0495678_011416 | 3300049459 | Bacteria | 4256 |
| 496 | Ga0495682_0068128 | 3300049460 | Bacteria | 1282 |
| 497 | Ga0501300_000801 | 3300049523 | Bacteria | 4778 |
| 498 | Ga0501034_0032078 | 3300049571 | Bacteria | 5337 |
| 499 | Ga0501217_002500 | 3300049661 | Unclassified | 3627 |
| 500 | Ga0501217_031740 | 3300049661 | Bacteria | 1303 |
| 501 | Ga0501223_000180 | 3300049663 | Bacteria | 16493 |
| 502 | Ga0501223_000717 | 3300049663 | Bacteria | 7903 |
| 503 | Ga0501247_001377 | 3300049677 | Unclassified | 2324 |
| 504 | Ga0501257_032119 | 3300049686 | Bacteria | 1269 |
| 505 | Ga0501225_0157620 | 3300049705 | Bacteria | 696 |
| 506 | Ga0501241_020478 | 3300049758 | Bacteria | 1216 |
| 507 | Ga0501263_047563 | 3300049760 | Bacteria | 645 |
| 508 | Ga0501279_003985 | 3300049775 | Bacteria | 1933 |
| 509 | nmdc:mga0k408_1182_c2 | 3300050493 | Bacteria | 11156 |
| 510 | nmdc:mga0k408_164047_c1 | 3300050493 | Bacteria | 1324 |
| 511 | nmdc:mga0k408_21723_c1 | 3300050493 | Bacteria | 3607 |
| 512 | nmdc:mga0k408_824_c1 | 3300050493 | Bacteria | 17116 |
| 513 | nmdc:mga08y16_117080_c1 | 3300050511 | Bacteria | 2774 |
| 514 | Ga0500635_0055047 | 3300053080 | Bacteria | 1373 |
| 515 | Ga0500651_0020646 | 3300053093 | Bacteria | 4101 |
| 516 | Ga0500608_005499 | 3300053122 | Bacteria | 5046 |
| 517 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 518 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 519 | Ga0500616_0169303 | 3300053153 | Bacteria | 994 |
| 520 | Ga0500622_0000768 | 3300053156 | Bacteria | 27944 |
| 521 | Ga0500624_000504 | 3300053157 | Bacteria | 11390 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009098 | Ga0105245_10747241 | Ga0105245_107472411 | 166 |
| 2 | 3300042156 | Ga0439446_0136796 | Ga0439446_0136796_265_780 | 168 |
| 3 | 3300003320 | rootH2_10057459 | rootH2_100574597 | 171 |
| 4 | 3300005289 | Ga0065704_10085946 | Ga0065704_100859465 | 171 |
| 5 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013243 | 171 |
| 6 | 3300025935 | Ga0207709_10000072 | Ga0207709_100000725 | 171 |
| 7 | 3300032004 | Ga0307414_10086977 | Ga0307414_100869773 | 171 |
| 8 | 3300037312 | Ga0395899_0255074 | Ga0395899_0255074_455_994 | 171 |
| 9 | iso_pu_bacteria | 2585427687 | 2586206602 | 172 |
| 10 | iso_pu_bacteria | 2599185184 | 2599478354 | 172 |
| 11 | iso_pu_bacteria | 2738541283 | 2738754837 | 172 |
| 12 | iso_pu_bacteria | 2738541284 | 2738761244 | 172 |
| 13 | iso_pu_bacteria | 2738541302 | 2738853897 | 172 |
| 14 | iso_pu_bacteria | 2738543023 | 2739304586 | 172 |
| 15 | iso_pu_bacteria | 2739367651 | 2739588487 | 172 |
| 16 | iso_pu_bacteria | 2739367656 | 2739616142 | 172 |
| 17 | iso_pu_bacteria | 2739367663 | 2739645164 | 172 |
| 18 | iso_pu_bacteria | 2775506987 | 2776613413 | 172 |
| 19 | iso_pu_bacteria | 2818991437 | 2819549838 | 172 |
| 20 | iso_pu_bacteria | 2842722452 | 2842723629 | 172 |
| 21 | iso_pu_bacteria | 2842903701 | 2842906725 | 172 |
| 22 | iso_pu_bacteria | 2842909656 | 2842910135 | 172 |
| 23 | iso_pu_bacteria | 2849281842 | 2849284376 | 172 |
| 24 | iso_pu_bacteria | 2852623160 | 2852623174 | 172 |
| 25 | iso_pu_bacteria | 2852627209 | 2852631951 | 172 |
| 26 | iso_pu_bacteria | 2857627736 | 2857631027 | 172 |
| 27 | iso_pu_bacteria | 2884933994 | 2884937961 | 172 |
| 28 | iso_pu_bacteria | 2890737413 | 2890738246 | 172 |
| 29 | iso_pu_bacteria | 2890804823 | 2890807874 | 172 |
| 30 | iso_pu_bacteria | 2896317667 | 2896318813 | 172 |
| 31 | iso_pu_bacteria | 2896344016 | 2896346765 | 172 |
| 32 | iso_pu_bacteria | 2898713307 | 2898715954 | 172 |
| 33 | iso_pu_bacteria | 2902048731 | 2902049257 | 172 |
| 34 | iso_pu_bacteria | 2904445276 | 2904445772 | 172 |
| 35 | iso_pu_bacteria | 2904780799 | 2904782250 | 172 |
| 36 | iso_pu_bacteria | 2919177583 | 2919179653 | 172 |
| 37 | iso_pu_bacteria | 2919186247 | 2919187074 | 172 |
| 38 | iso_pu_bacteria | 2919437846 | 2919442268 | 172 |
| 39 | iso_pu_bacteria | 2928147474 | 2928150821 | 172 |
| 40 | iso_pu_bacteria | 2939664404 | 2939665657 | 172 |
| 41 | iso_pu_bacteria | 2945997725 | 2946000530 | 172 |
| 42 | iso_pu_bacteria | 2977232053 | 2977236080 | 172 |
| 43 | iso_pu_bacteria | 3003233435 | 3003237128 | 172 |
| 44 | iso_pu_bacteria | 8055588893 | 8055588917 | 172 |
| 45 | 3300044712 | Ga0453684_0032119 | Ga0453684_0032119_2465_2986 | 173 |
| 46 | 3300045051 | Ga0451576_0283830 | Ga0451576_0283830_159_680 | 173 |
| 47 | 3300002737 | JGI25162J39368_1001026 | JGI25162J39368_100102613 | 174 |
| 48 | 3300002772 | JGI25164J39214_1003551 | JGI25164J39214_10035512 | 174 |
| 49 | 3300003214 | JGI25165J46597_1000694 | JGI25165J46597_100069414 | 174 |
| 50 | 3300005617 | Ga0068859_100996033 | Ga0068859_1009960332 | 174 |
| 51 | 3300006931 | Ga0097620_100995863 | Ga0097620_1009958631 | 174 |
| 52 | 3300025233 | Ga0209437_100008 | Ga0209437_100008147 | 174 |
| 53 | 3300025250 | Ga0209026_1027504 | Ga0209026_10275041 | 174 |
| 54 | 3300025261 | Ga0209233_1000024 | Ga0209233_1000024512 | 174 |
| 55 | 3300037418 | Ga0395900_0208558 | Ga0395900_0208558_1162_1710 | 174 |
| 56 | iso_pu_bacteria | 2954016120 | 2954017365 | 174 |
| 57 | 3300003322 | rootL2_10122988 | rootL2_101229881 | 175 |
| 58 | 3300003323 | rootH1_10020300 | rootH1_1002030011 | 175 |
| 59 | 3300005340 | Ga0070689_101258510 | Ga0070689_1012585101 | 175 |
| 60 | 3300005366 | Ga0070659_100052411 | Ga0070659_1000524112 | 175 |
| 61 | 3300005466 | Ga0070685_10028821 | Ga0070685_100288211 | 175 |
| 62 | 3300005614 | Ga0068856_100000935 | Ga0068856_10000093518 | 175 |
| 63 | 3300005843 | Ga0068860_100122107 | Ga0068860_1001221072 | 175 |
| 64 | 3300009093 | Ga0105240_10190532 | Ga0105240_101905322 | 175 |
| 65 | 3300009545 | Ga0105237_10084715 | Ga0105237_100847154 | 175 |
| 66 | 3300010375 | Ga0105239_10000586 | Ga0105239_1000058630 | 175 |
| 67 | 3300013102 | Ga0157371_10151627 | Ga0157371_101516272 | 175 |
| 68 | 3300013296 | Ga0157374_10345422 | Ga0157374_103454221 | 175 |
| 69 | 3300013307 | Ga0157372_10000250 | Ga0157372_1000025051 | 175 |
| 70 | 3300025913 | Ga0207695_10142414 | Ga0207695_101424142 | 175 |
| 71 | 3300025914 | Ga0207671_10049682 | Ga0207671_100496824 | 175 |
| 72 | 3300025932 | Ga0207690_10035281 | Ga0207690_100352812 | 175 |
| 73 | 3300025936 | Ga0207670_10818463 | Ga0207670_108184631 | 175 |
| 74 | 3300026078 | Ga0207702_10003141 | Ga0207702_100031413 | 175 |
| 75 | 3300028381 | Ga0268264_10099390 | Ga0268264_100993902 | 175 |
| 76 | 3300028800 | Ga0265338_10024738 | Ga0265338_100247387 | 175 |
| 77 | 3300031507 | Ga0307509_10331298 | Ga0307509_103312981 | 175 |
| 78 | 3300031712 | Ga0265342_10073159 | Ga0265342_100731592 | 175 |
| 79 | 3300031731 | Ga0307405_10214521 | Ga0307405_102145212 | 175 |
| 80 | 3300032004 | Ga0307414_10335834 | Ga0307414_103358342 | 175 |
| 81 | 3300038443 | Ga0395901_0171434 | Ga0395901_0171434_822_1349 | 175 |
| 82 | 3300041456 | Ga0451795_0270238 | Ga0451795_0270238_165_692 | 175 |
| 83 | 3300049661 | Ga0501217_031740 | Ga0501217_031740_40_573 | 175 |
| 84 | 3300049663 | Ga0501223_000180 | Ga0501223_000180_12443_12976 | 175 |
| 85 | 2162886007 | SwRhRL2b_contig_1953040 | SwRhRL2b_0272.00006790 | 176 |
| 86 | 2162886007 | SwRhRL2b_contig_3746020 | SwRhRL2b_0349.00001200 | 176 |
| 87 | 3300001979 | JGI24740J21852_10027594 | JGI24740J21852_100275942 | 176 |
| 88 | 3300001989 | JGI24739J22299_10003124 | JGI24739J22299_100031243 | 176 |
| 89 | 3300001990 | JGI24737J22298_10000081 | JGI24737J22298_1000008118 | 176 |
| 90 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_1000000480 | 176 |
| 91 | 3300002737 | JGI25162J39368_1000089 | JGI25162J39368_10000891 | 176 |
| 92 | 3300002741 | JGI25157J39369_1012911 | JGI25157J39369_10129112 | 176 |
| 93 | 3300002773 | JGI25152J39213_1000111 | JGI25152J39213_100011151 | 176 |
| 94 | 3300002774 | JGI25150J39212_1000009 | JGI25150J39212_1000009141 | 176 |
| 95 | 3300003187 | JGI25151J46595_10000017 | JGI25151J46595_10000017141 | 176 |
| 96 | 3300003215 | JGI25153J46596_10000023 | JGI25153J46596_1000002398 | 176 |
| 97 | 3300003316 | rootH1_10005699 | rootH1_100056993 | 176 |
| 98 | 3300003316 | rootH1_10075429 | rootH1_100754293 | 176 |
| 99 | 3300003316 | rootH1_10188739 | rootH1_101887391 | 176 |
| 100 | 3300003320 | rootH2_10001891 | rootH2_10001891189 | 176 |
| 101 | 3300003320 | rootH2_10004559 | rootH2_1000455998 | 176 |
| 102 | 3300003320 | rootH2_10097202 | rootH2_100972021 | 176 |
| 103 | 3300003320 | rootH2_10242585 | rootH2_102425854 | 176 |
| 104 | 3300003320 | rootH2_10248911 | rootH2_102489112 | 176 |
| 105 | 3300003322 | rootL2_10000423 | rootL2_1000042336 | 176 |
| 106 | 3300003322 | rootL2_10023987 | rootL2_100239877 | 176 |
| 107 | 3300003322 | rootL2_10103496 | rootL2_101034968 | 176 |
| 108 | 3300003322 | rootL2_10117027 | rootL2_101170275 | 176 |
| 109 | 3300003322 | rootL2_10197573 | rootL2_101975732 | 176 |
| 110 | 3300003322 | rootL2_10211968 | rootL2_102119682 | 176 |
| 111 | 3300003322 | rootL2_10237433 | rootL2_102374332 | 176 |
| 112 | 3300003323 | rootH1_10000380 | rootH1_1000038011 | 176 |
| 113 | 3300003323 | rootH1_10002701 | rootH1_100027013 | 176 |
| 114 | 3300003323 | rootH1_10037471 | rootH1_100374714 | 176 |
| 115 | 3300003323 | rootH1_10076174 | rootH1_100761745 | 176 |
| 116 | 3300003323 | rootH1_10204861 | rootH1_102048614 | 176 |
| 117 | 3300003781 | Ga0055536_1000003 | Ga0055536_1000003360 | 176 |
| 118 | 3300003791 | Ga0055530_10003135 | Ga0055530_100031353 | 176 |
| 119 | 3300003791 | Ga0055530_10051576 | Ga0055530_100515761 | 176 |
| 120 | 3300003794 | Ga0055531_10000058 | Ga0055531_1000005857 | 176 |
| 121 | 3300004799 | Ga0058863_11778257 | Ga0058863_117782572 | 176 |
| 122 | 3300004803 | Ga0058862_12758247 | Ga0058862_127582472 | 176 |
| 123 | 3300005288 | Ga0065714_10002530 | Ga0065714_100025302 | 176 |
| 124 | 3300005288 | Ga0065714_10002817 | Ga0065714_1000281714 | 176 |
| 125 | 3300005288 | Ga0065714_10004334 | Ga0065714_100043346 | 176 |
| 126 | 3300005288 | Ga0065714_10008852 | Ga0065714_100088522 | 176 |
| 127 | 3300005288 | Ga0065714_10065450 | Ga0065714_100654502 | 176 |
| 128 | 3300005288 | Ga0065714_10065676 | Ga0065714_100656767 | 176 |
| 129 | 3300005288 | Ga0065714_10068853 | Ga0065714_100688537 | 176 |
| 130 | 3300005288 | Ga0065714_10101961 | Ga0065714_101019612 | 176 |
| 131 | 3300005288 | Ga0065714_10195385 | Ga0065714_101953852 | 176 |
| 132 | 3300005288 | Ga0065714_10251702 | Ga0065714_102517021 | 176 |
| 133 | 3300005288 | Ga0065714_10288274 | Ga0065714_102882741 | 176 |
| 134 | 3300005289 | Ga0065704_10000288 | Ga0065704_100002885 | 176 |
| 135 | 3300005289 | Ga0065704_10018848 | Ga0065704_100188482 | 176 |
| 136 | 3300005289 | Ga0065704_10083289 | Ga0065704_100832894 | 176 |
| 137 | 3300005289 | Ga0065704_10157972 | Ga0065704_101579722 | 176 |
| 138 | 3300005289 | Ga0065704_10178827 | Ga0065704_101788271 | 176 |
| 139 | 3300005327 | Ga0070658_10000049 | Ga0070658_100000496 | 176 |
| 140 | 3300005327 | Ga0070658_10165199 | Ga0070658_101651991 | 176 |
| 141 | 3300005328 | Ga0070676_10000563 | Ga0070676_100005636 | 176 |
| 142 | 3300005329 | Ga0070683_100626514 | Ga0070683_1006265141 | 176 |
| 143 | 3300005336 | Ga0070680_100040500 | Ga0070680_1000405002 | 176 |
| 144 | 3300005338 | Ga0068868_100026907 | Ga0068868_1000269071 | 176 |
| 145 | 3300005338 | Ga0068868_100812297 | Ga0068868_1008122971 | 176 |
| 146 | 3300005339 | Ga0070660_100026708 | Ga0070660_1000267082 | 176 |
| 147 | 3300005339 | Ga0070660_100080720 | Ga0070660_1000807202 | 176 |
| 148 | 3300005339 | Ga0070660_100106243 | Ga0070660_1001062432 | 176 |
| 149 | 3300005341 | Ga0070691_10356766 | Ga0070691_103567661 | 176 |
| 150 | 3300005355 | Ga0070671_100007939 | Ga0070671_1000079393 | 176 |
| 151 | 3300005356 | Ga0070674_100083649 | Ga0070674_1000836492 | 176 |
| 152 | 3300005364 | Ga0070673_100093520 | Ga0070673_1000935203 | 176 |
| 153 | 3300005364 | Ga0070673_100652513 | Ga0070673_1006525131 | 176 |
| 154 | 3300005366 | Ga0070659_100000432 | Ga0070659_1000004325 | 176 |
| 155 | 3300005366 | Ga0070659_100014484 | Ga0070659_1000144844 | 176 |
| 156 | 3300005455 | Ga0070663_100084313 | Ga0070663_1000843132 | 176 |
| 157 | 3300005457 | Ga0070662_100000045 | Ga0070662_10000004535 | 176 |
| 158 | 3300005459 | Ga0068867_100000344 | Ga0068867_10000034434 | 176 |
| 159 | 3300005530 | Ga0070679_100352893 | Ga0070679_1003528932 | 176 |
| 160 | 3300005539 | Ga0068853_100054716 | Ga0068853_1000547163 | 176 |
| 161 | 3300005539 | Ga0068853_100091965 | Ga0068853_1000919652 | 176 |
| 162 | 3300005539 | Ga0068853_100273701 | Ga0068853_1002737012 | 176 |
| 163 | 3300005539 | Ga0068853_100822244 | Ga0068853_1008222441 | 176 |
| 164 | 3300005548 | Ga0070665_100000020 | Ga0070665_100000020196 | 176 |
| 165 | 3300005563 | Ga0068855_100000195 | Ga0068855_10000019586 | 176 |
| 166 | 3300005563 | Ga0068855_100000988 | Ga0068855_10000098814 | 176 |
| 167 | 3300005563 | Ga0068855_100044282 | Ga0068855_1000442822 | 176 |
| 168 | 3300005563 | Ga0068855_100094219 | Ga0068855_1000942194 | 176 |
| 169 | 3300005563 | Ga0068855_100106546 | Ga0068855_1001065465 | 176 |
| 170 | 3300005563 | Ga0068855_100695735 | Ga0068855_1006957352 | 176 |
| 171 | 3300005614 | Ga0068856_100013777 | Ga0068856_1000137774 | 176 |
| 172 | 3300005614 | Ga0068856_100232393 | Ga0068856_1002323932 | 176 |
| 173 | 3300005616 | Ga0068852_100107178 | Ga0068852_1001071781 | 176 |
| 174 | 3300005616 | Ga0068852_100196573 | Ga0068852_1001965732 | 176 |
| 175 | 3300005718 | Ga0068866_10027440 | Ga0068866_100274404 | 176 |
| 176 | 3300005840 | Ga0068870_10097036 | Ga0068870_100970363 | 176 |
| 177 | 3300006195 | Ga0075366_10001766 | Ga0075366_1000176611 | 176 |
| 178 | 3300006195 | Ga0075366_10003263 | Ga0075366_100032638 | 176 |
| 179 | 3300006195 | Ga0075366_10175961 | Ga0075366_101759612 | 176 |
| 180 | 3300006237 | Ga0097621_100005555 | Ga0097621_1000055558 | 176 |
| 181 | 3300006358 | Ga0068871_100000100 | Ga0068871_10000010032 | 176 |
| 182 | 3300006846 | Ga0075430_100662081 | Ga0075430_1006620812 | 176 |
| 183 | 3300006881 | Ga0068865_100005711 | Ga0068865_1000057118 | 176 |
| 184 | 3300009036 | Ga0105244_10038104 | Ga0105244_100381042 | 176 |
| 185 | 3300009036 | Ga0105244_10156571 | Ga0105244_101565712 | 176 |
| 186 | 3300009093 | Ga0105240_10000193 | Ga0105240_1000019313 | 176 |
| 187 | 3300009093 | Ga0105240_10002893 | Ga0105240_100028932 | 176 |
| 188 | 3300009093 | Ga0105240_10008133 | Ga0105240_100081337 | 176 |
| 189 | 3300009093 | Ga0105240_10030991 | Ga0105240_100309914 | 176 |
| 190 | 3300009093 | Ga0105240_10105032 | Ga0105240_101050323 | 176 |
| 191 | 3300009093 | Ga0105240_10162937 | Ga0105240_101629373 | 176 |
| 192 | 3300009093 | Ga0105240_11016994 | Ga0105240_110169941 | 176 |
| 193 | 3300009094 | Ga0111539_10008369 | Ga0111539_100083698 | 176 |
| 194 | 3300009098 | Ga0105245_10060462 | Ga0105245_100604625 | 176 |
| 195 | 3300009098 | Ga0105245_10758896 | Ga0105245_107588961 | 176 |
| 196 | 3300009148 | Ga0105243_10103104 | Ga0105243_101031043 | 176 |
| 197 | 3300009174 | Ga0105241_10000086 | Ga0105241_1000008641 | 176 |
| 198 | 3300009174 | Ga0105241_10008186 | Ga0105241_100081864 | 176 |
| 199 | 3300009174 | Ga0105241_10034569 | Ga0105241_100345696 | 176 |
| 200 | 3300009174 | Ga0105241_10156565 | Ga0105241_101565651 | 176 |
| 201 | 3300009174 | Ga0105241_10365578 | Ga0105241_103655781 | 176 |
| 202 | 3300009174 | Ga0105241_11017757 | Ga0105241_110177571 | 176 |
| 203 | 3300009176 | Ga0105242_10016851 | Ga0105242_100168516 | 176 |
| 204 | 3300009176 | Ga0105242_10025626 | Ga0105242_100256262 | 176 |
| 205 | 3300009545 | Ga0105237_10002494 | Ga0105237_1000249421 | 176 |
| 206 | 3300009545 | Ga0105237_10005037 | Ga0105237_1000503714 | 176 |
| 207 | 3300009545 | Ga0105237_10011464 | Ga0105237_100114643 | 176 |
| 208 | 3300009545 | Ga0105237_10026888 | Ga0105237_100268884 | 176 |
| 209 | 3300009545 | Ga0105237_10045858 | Ga0105237_100458582 | 176 |
| 210 | 3300009545 | Ga0105237_10079727 | Ga0105237_100797273 | 176 |
| 211 | 3300009545 | Ga0105237_10094863 | Ga0105237_100948632 | 176 |
| 212 | 3300009545 | Ga0105237_10268714 | Ga0105237_102687142 | 176 |
| 213 | 3300009551 | Ga0105238_10007399 | Ga0105238_100073994 | 176 |
| 214 | 3300009551 | Ga0105238_10182444 | Ga0105238_101824443 | 176 |
| 215 | 3300010375 | Ga0105239_10000578 | Ga0105239_1000057844 | 176 |
| 216 | 3300010375 | Ga0105239_10004569 | Ga0105239_100045693 | 176 |
| 217 | 3300010375 | Ga0105239_10007004 | Ga0105239_100070048 | 176 |
| 218 | 3300010375 | Ga0105239_10008129 | Ga0105239_100081297 | 176 |
| 219 | 3300010375 | Ga0105239_10047030 | Ga0105239_100470303 | 176 |
| 220 | 3300010375 | Ga0105239_10082682 | Ga0105239_100826822 | 176 |
| 221 | 3300010375 | Ga0105239_10097072 | Ga0105239_100970723 | 176 |
| 222 | 3300010375 | Ga0105239_10189692 | Ga0105239_101896922 | 176 |
| 223 | 3300010375 | Ga0105239_10205160 | Ga0105239_102051602 | 176 |
| 224 | 3300010375 | Ga0105239_10309078 | Ga0105239_103090782 | 176 |
| 225 | 3300013100 | Ga0157373_10000041 | Ga0157373_1000004177 | 176 |
| 226 | 3300013100 | Ga0157373_10000337 | Ga0157373_1000033720 | 176 |
| 227 | 3300013100 | Ga0157373_10028839 | Ga0157373_100288394 | 176 |
| 228 | 3300013100 | Ga0157373_10030355 | Ga0157373_100303552 | 176 |
| 229 | 3300013100 | Ga0157373_10086529 | Ga0157373_100865293 | 176 |
| 230 | 3300013100 | Ga0157373_10135681 | Ga0157373_101356812 | 176 |
| 231 | 3300013100 | Ga0157373_10263564 | Ga0157373_102635642 | 176 |
| 232 | 3300013102 | Ga0157371_10000009 | Ga0157371_100000099 | 176 |
| 233 | 3300013102 | Ga0157371_10000135 | Ga0157371_1000013544 | 176 |
| 234 | 3300013102 | Ga0157371_10002029 | Ga0157371_100020293 | 176 |
| 235 | 3300013102 | Ga0157371_10004696 | Ga0157371_1000469610 | 176 |
| 236 | 3300013102 | Ga0157371_10014439 | Ga0157371_100144395 | 176 |
| 237 | 3300013102 | Ga0157371_10015862 | Ga0157371_100158626 | 176 |
| 238 | 3300013102 | Ga0157371_10048591 | Ga0157371_100485914 | 176 |
| 239 | 3300013102 | Ga0157371_10075092 | Ga0157371_100750922 | 176 |
| 240 | 3300013102 | Ga0157371_10483507 | Ga0157371_104835072 | 176 |
| 241 | 3300013102 | Ga0157371_10814988 | Ga0157371_108149881 | 176 |
| 242 | 3300013104 | Ga0157370_10008331 | Ga0157370_100083312 | 176 |
| 243 | 3300013104 | Ga0157370_10017168 | Ga0157370_100171689 | 176 |
| 244 | 3300013104 | Ga0157370_10022230 | Ga0157370_100222306 | 176 |
| 245 | 3300013104 | Ga0157370_10029541 | Ga0157370_100295412 | 176 |
| 246 | 3300013104 | Ga0157370_10047084 | Ga0157370_100470844 | 176 |
| 247 | 3300013104 | Ga0157370_10051390 | Ga0157370_100513903 | 176 |
| 248 | 3300013104 | Ga0157370_10092087 | Ga0157370_100920873 | 176 |
| 249 | 3300013104 | Ga0157370_10166267 | Ga0157370_101662673 | 176 |
| 250 | 3300013104 | Ga0157370_10613148 | Ga0157370_106131482 | 176 |
| 251 | 3300013105 | Ga0157369_10000006 | Ga0157369_10000006231 | 176 |
| 252 | 3300013105 | Ga0157369_10005660 | Ga0157369_1000566012 | 176 |
| 253 | 3300013105 | Ga0157369_10019913 | Ga0157369_100199133 | 176 |
| 254 | 3300013105 | Ga0157369_10558898 | Ga0157369_105588981 | 176 |
| 255 | 3300013105 | Ga0157369_10615316 | Ga0157369_106153162 | 176 |
| 256 | 3300013105 | Ga0157369_11265142 | Ga0157369_112651422 | 176 |
| 257 | 3300013296 | Ga0157374_10000128 | Ga0157374_1000012818 | 176 |
| 258 | 3300013296 | Ga0157374_10000202 | Ga0157374_100002026 | 176 |
| 259 | 3300013296 | Ga0157374_10007012 | Ga0157374_100070122 | 176 |
| 260 | 3300013296 | Ga0157374_10429317 | Ga0157374_104293172 | 176 |
| 261 | 3300013297 | Ga0157378_10004756 | Ga0157378_100047566 | 176 |
| 262 | 3300013297 | Ga0157378_10014634 | Ga0157378_100146346 | 176 |
| 263 | 3300013297 | Ga0157378_10550504 | Ga0157378_105505042 | 176 |
| 264 | 3300013306 | Ga0163162_10000032 | Ga0163162_1000003218 | 176 |
| 265 | 3300013306 | Ga0163162_10003807 | Ga0163162_1000380714 | 176 |
| 266 | 3300013306 | Ga0163162_10156190 | Ga0163162_101561902 | 176 |
| 267 | 3300013306 | Ga0163162_10185627 | Ga0163162_101856272 | 176 |
| 268 | 3300013306 | Ga0163162_10334499 | Ga0163162_103344992 | 176 |
| 269 | 3300013306 | Ga0163162_10705086 | Ga0163162_107050861 | 176 |
| 270 | 3300013307 | Ga0157372_10000017 | Ga0157372_10000017145 | 176 |
| 271 | 3300013307 | Ga0157372_10000061 | Ga0157372_1000006133 | 176 |
| 272 | 3300013307 | Ga0157372_10003385 | Ga0157372_1000338518 | 176 |
| 273 | 3300013307 | Ga0157372_10031266 | Ga0157372_100312661 | 176 |
| 274 | 3300013307 | Ga0157372_10047894 | Ga0157372_100478943 | 176 |
| 275 | 3300013307 | Ga0157372_10165362 | Ga0157372_101653623 | 176 |
| 276 | 3300013307 | Ga0157372_10261689 | Ga0157372_102616893 | 176 |
| 277 | 3300013308 | Ga0157375_10008600 | Ga0157375_100086005 | 176 |
| 278 | 3300013308 | Ga0157375_10198211 | Ga0157375_101982113 | 176 |
| 279 | 3300014325 | Ga0163163_11560809 | Ga0163163_115608091 | 176 |
| 280 | 3300014497 | Ga0182008_10000001 | Ga0182008_10000001249 | 176 |
| 281 | 3300014497 | Ga0182008_10004035 | Ga0182008_100040359 | 176 |
| 282 | 3300014497 | Ga0182008_10012175 | Ga0182008_100121754 | 176 |
| 283 | 3300014497 | Ga0182008_10088698 | Ga0182008_100886982 | 176 |
| 284 | 3300014745 | Ga0157377_10128216 | Ga0157377_101282161 | 176 |
| 285 | 3300014969 | Ga0157376_11633635 | Ga0157376_116336351 | 176 |
| 286 | 3300015261 | Ga0182006_1000244 | Ga0182006_100024420 | 176 |
| 287 | 3300015261 | Ga0182006_1000646 | Ga0182006_10006463 | 176 |
| 288 | 3300015261 | Ga0182006_1004222 | Ga0182006_10042225 | 176 |
| 289 | 3300015261 | Ga0182006_1004407 | Ga0182006_10044071 | 176 |
| 290 | 3300015261 | Ga0182006_1006216 | Ga0182006_10062163 | 176 |
| 291 | 3300015261 | Ga0182006_1093123 | Ga0182006_10931232 | 176 |
| 292 | 3300015262 | Ga0182007_10000001 | Ga0182007_10000001172 | 176 |
| 293 | 3300015262 | Ga0182007_10070898 | Ga0182007_100708981 | 176 |
| 294 | 3300015262 | Ga0182007_10082031 | Ga0182007_100820312 | 176 |
| 295 | 3300015682 | Ga0183373_1010 | Ga0183373_101022 | 176 |
| 296 | 3300017792 | Ga0163161_10000468 | Ga0163161_1000046816 | 176 |
| 297 | 3300017792 | Ga0163161_10000919 | Ga0163161_100009192 | 176 |
| 298 | 3300017792 | Ga0163161_10003366 | Ga0163161_100033664 | 176 |
| 299 | 3300017792 | Ga0163161_10007612 | Ga0163161_100076122 | 176 |
| 300 | 3300017792 | Ga0163161_10061405 | Ga0163161_100614052 | 176 |
| 301 | 3300017792 | Ga0163161_10074368 | Ga0163161_100743682 | 176 |
| 302 | 3300017792 | Ga0163161_11108622 | Ga0163161_111086221 | 176 |
| 303 | 3300021361 | Ga0213872_10048195 | Ga0213872_100481952 | 176 |
| 304 | 3300025233 | Ga0209437_100221 | Ga0209437_100221107 | 176 |
| 305 | 3300025245 | Ga0207425_1000007 | Ga0207425_1000007415 | 176 |
| 306 | 3300025250 | Ga0209026_1000383 | Ga0209026_10003834 | 176 |
| 307 | 3300025250 | Ga0209026_1005674 | Ga0209026_10056741 | 176 |
| 308 | 3300025250 | Ga0209026_1008704 | Ga0209026_10087042 | 176 |
| 309 | 3300025258 | Ga0209129_1000006 | Ga0209129_1000006415 | 176 |
| 310 | 3300025258 | Ga0209129_1012982 | Ga0209129_10129822 | 176 |
| 311 | 3300025261 | Ga0209233_1001531 | Ga0209233_10015314 | 176 |
| 312 | 3300025261 | Ga0209233_1020955 | Ga0209233_10209552 | 176 |
| 313 | 3300025272 | Ga0209455_1010452 | Ga0209455_10104521 | 176 |
| 314 | 3300025292 | Ga0209676_1000001 | Ga0209676_1000001693 | 176 |
| 315 | 3300025294 | Ga0209025_1000025 | Ga0209025_1000025245 | 176 |
| 316 | 3300025297 | Ga0209758_1000016 | Ga0209758_1000016415 | 176 |
| 317 | 3300025298 | Ga0209050_1000016 | Ga0209050_1000016358 | 176 |
| 318 | 3300025298 | Ga0209050_1011974 | Ga0209050_10119744 | 176 |
| 319 | 3300025298 | Ga0209050_1030128 | Ga0209050_10301282 | 176 |
| 320 | 3300025302 | Ga0207426_1043502 | Ga0207426_10435022 | 176 |
| 321 | 3300025304 | Ga0209257_1000007 | Ga0209257_10000071229 | 176 |
| 322 | 3300025899 | Ga0207642_10387734 | Ga0207642_103877342 | 176 |
| 323 | 3300025904 | Ga0207647_10000105 | Ga0207647_1000010537 | 176 |
| 324 | 3300025904 | Ga0207647_10002524 | Ga0207647_100025247 | 176 |
| 325 | 3300025907 | Ga0207645_10001210 | Ga0207645_100012106 | 176 |
| 326 | 3300025908 | Ga0207643_10104961 | Ga0207643_101049612 | 176 |
| 327 | 3300025909 | Ga0207705_10000079 | Ga0207705_1000007994 | 176 |
| 328 | 3300025911 | Ga0207654_10001404 | Ga0207654_100014047 | 176 |
| 329 | 3300025911 | Ga0207654_10006969 | Ga0207654_100069696 | 176 |
| 330 | 3300025911 | Ga0207654_10025621 | Ga0207654_100256213 | 176 |
| 331 | 3300025911 | Ga0207654_10296593 | Ga0207654_102965932 | 176 |
| 332 | 3300025912 | Ga0207707_10006352 | Ga0207707_100063529 | 176 |
| 333 | 3300025913 | Ga0207695_10004447 | Ga0207695_100044475 | 176 |
| 334 | 3300025913 | Ga0207695_10013327 | Ga0207695_100133272 | 176 |
| 335 | 3300025913 | Ga0207695_10059228 | Ga0207695_100592283 | 176 |
| 336 | 3300025913 | Ga0207695_10078483 | Ga0207695_100784832 | 176 |
| 337 | 3300025913 | Ga0207695_10118678 | Ga0207695_101186783 | 176 |
| 338 | 3300025914 | Ga0207671_10001943 | Ga0207671_1000194321 | 176 |
| 339 | 3300025914 | Ga0207671_10003540 | Ga0207671_100035403 | 176 |
| 340 | 3300025914 | Ga0207671_10026583 | Ga0207671_100265834 | 176 |
| 341 | 3300025914 | Ga0207671_10062493 | Ga0207671_100624932 | 176 |
| 342 | 3300025914 | Ga0207671_10073367 | Ga0207671_100733672 | 176 |
| 343 | 3300025917 | Ga0207660_10038332 | Ga0207660_100383322 | 176 |
| 344 | 3300025919 | Ga0207657_10063077 | Ga0207657_100630772 | 176 |
| 345 | 3300025919 | Ga0207657_10065835 | Ga0207657_100658353 | 176 |
| 346 | 3300025921 | Ga0207652_10090977 | Ga0207652_100909771 | 176 |
| 347 | 3300025921 | Ga0207652_10204581 | Ga0207652_102045812 | 176 |
| 348 | 3300025924 | Ga0207694_10108772 | Ga0207694_101087722 | 176 |
| 349 | 3300025924 | Ga0207694_10426127 | Ga0207694_104261271 | 176 |
| 350 | 3300025931 | Ga0207644_10007769 | Ga0207644_100077693 | 176 |
| 351 | 3300025932 | Ga0207690_10000610 | Ga0207690_100006105 | 176 |
| 352 | 3300025933 | Ga0207706_10000120 | Ga0207706_1000012030 | 176 |
| 353 | 3300025933 | Ga0207706_10500197 | Ga0207706_105001971 | 176 |
| 354 | 3300025934 | Ga0207686_10008042 | Ga0207686_100080423 | 176 |
| 355 | 3300025934 | Ga0207686_10055303 | Ga0207686_100553033 | 176 |
| 356 | 3300025938 | Ga0207704_10000099 | Ga0207704_100000993 | 176 |
| 357 | 3300025949 | Ga0207667_10000046 | Ga0207667_100000461 | 176 |
| 358 | 3300025949 | Ga0207667_10001052 | Ga0207667_100010522 | 176 |
| 359 | 3300025949 | Ga0207667_10115477 | Ga0207667_101154773 | 176 |
| 360 | 3300025949 | Ga0207667_10287147 | Ga0207667_102871472 | 176 |
| 361 | 3300025949 | Ga0207667_10301528 | Ga0207667_103015282 | 176 |
| 362 | 3300025949 | Ga0207667_10412279 | Ga0207667_104122792 | 176 |
| 363 | 3300025949 | Ga0207667_10480572 | Ga0207667_104805721 | 176 |
| 364 | 3300025949 | Ga0207667_10575087 | Ga0207667_105750872 | 176 |
| 365 | 3300025949 | Ga0207667_11158734 | Ga0207667_111587342 | 176 |
| 366 | 3300025960 | Ga0207651_10214500 | Ga0207651_102145002 | 176 |
| 367 | 3300025960 | Ga0207651_10291006 | Ga0207651_102910062 | 176 |
| 368 | 3300026023 | Ga0207677_10044162 | Ga0207677_100441622 | 176 |
| 369 | 3300026041 | Ga0207639_10038699 | Ga0207639_100386993 | 176 |
| 370 | 3300026041 | Ga0207639_10462656 | Ga0207639_104626561 | 176 |
| 371 | 3300026041 | Ga0207639_10660145 | Ga0207639_106601452 | 176 |
| 372 | 3300026067 | Ga0207678_10110737 | Ga0207678_101107372 | 176 |
| 373 | 3300026078 | Ga0207702_10045811 | Ga0207702_100458113 | 176 |
| 374 | 3300026089 | Ga0207648_10011576 | Ga0207648_100115764 | 176 |
| 375 | 3300026121 | Ga0207683_10140590 | Ga0207683_101405902 | 176 |
| 376 | 3300026121 | Ga0207683_10706708 | Ga0207683_107067082 | 176 |
| 377 | 3300026142 | Ga0207698_10272596 | Ga0207698_102725962 | 176 |
| 378 | 3300026142 | Ga0207698_10609507 | Ga0207698_106095072 | 176 |
| 379 | 3300027526 | Ga0209968_1048157 | Ga0209968_10481571 | 176 |
| 380 | 3300027907 | Ga0207428_10216296 | Ga0207428_102162961 | 176 |
| 381 | 3300028379 | Ga0268266_10000018 | Ga0268266_10000018273 | 176 |
| 382 | 3300028786 | Ga0307517_10003095 | Ga0307517_100030955 | 176 |
| 383 | 3300028794 | Ga0307515_10000094 | Ga0307515_10000094122 | 176 |
| 384 | 3300028794 | Ga0307515_10000353 | Ga0307515_1000035368 | 176 |
| 385 | 3300028794 | Ga0307515_10000859 | Ga0307515_1000085960 | 176 |
| 386 | 3300028794 | Ga0307515_10039499 | Ga0307515_100394993 | 176 |
| 387 | 3300028794 | Ga0307515_10113784 | Ga0307515_101137843 | 176 |
| 388 | 3300028794 | Ga0307515_10139434 | Ga0307515_101394342 | 176 |
| 389 | 3300030731 | Ga0316177_1179722 | Ga0316177_11797223 | 176 |
| 390 | 3300030732 | Ga0316176_1157629 | Ga0316176_11576292 | 176 |
| 391 | 3300030742 | Ga0316183_1027629 | Ga0316183_10276293 | 176 |
| 392 | 3300030744 | Ga0316181_1023435 | Ga0316181_10234352 | 176 |
| 393 | 3300030744 | Ga0316181_1051627 | Ga0316181_105162714 | 176 |
| 394 | 3300031456 | Ga0307513_10078981 | Ga0307513_100789812 | 176 |
| 395 | 3300031456 | Ga0307513_10550792 | Ga0307513_105507922 | 176 |
| 396 | 3300031507 | Ga0307509_10310740 | Ga0307509_103107401 | 176 |
| 397 | 3300031548 | Ga0307408_100002381 | Ga0307408_1000023817 | 176 |
| 398 | 3300031548 | Ga0307408_100006190 | Ga0307408_1000061903 | 176 |
| 399 | 3300031548 | Ga0307408_100017152 | Ga0307408_1000171523 | 176 |
| 400 | 3300031712 | Ga0265342_10076799 | Ga0265342_100767992 | 176 |
| 401 | 3300031727 | Ga0316576_10052599 | Ga0316576_100525992 | 176 |
| 402 | 3300031731 | Ga0307405_10000010 | Ga0307405_10000010158 | 176 |
| 403 | 3300031731 | Ga0307405_10262355 | Ga0307405_102623552 | 176 |
| 404 | 3300031731 | Ga0307405_10966005 | Ga0307405_109660051 | 176 |
| 405 | 3300031824 | Ga0307413_10133524 | Ga0307413_101335242 | 176 |
| 406 | 3300031903 | Ga0307407_10000009 | Ga0307407_1000000975 | 176 |
| 407 | 3300031911 | Ga0307412_10000033 | Ga0307412_1000003337 | 176 |
| 408 | 3300031911 | Ga0307412_10002746 | Ga0307412_100027465 | 176 |
| 409 | 3300031911 | Ga0307412_10159973 | Ga0307412_101599733 | 176 |
| 410 | 3300031911 | Ga0307412_10570827 | Ga0307412_105708272 | 176 |
| 411 | 3300031911 | Ga0307412_10600544 | Ga0307412_106005442 | 176 |
| 412 | 3300031995 | Ga0307409_100454927 | Ga0307409_1004549272 | 176 |
| 413 | 3300032002 | Ga0307416_100000019 | Ga0307416_100000019120 | 176 |
| 414 | 3300032002 | Ga0307416_100039847 | Ga0307416_1000398472 | 176 |
| 415 | 3300032004 | Ga0307414_10000768 | Ga0307414_100007683 | 176 |
| 416 | 3300032004 | Ga0307414_10015945 | Ga0307414_100159455 | 176 |
| 417 | 3300032004 | Ga0307414_10036368 | Ga0307414_100363683 | 176 |
| 418 | 3300032004 | Ga0307414_10044883 | Ga0307414_100448833 | 176 |
| 419 | 3300032004 | Ga0307414_10057038 | Ga0307414_100570381 | 176 |
| 420 | 3300032004 | Ga0307414_10072788 | Ga0307414_100727882 | 176 |
| 421 | 3300032004 | Ga0307414_10864553 | Ga0307414_108645532 | 176 |
| 422 | 3300032004 | Ga0307414_11476284 | Ga0307414_114762841 | 176 |
| 423 | 3300032005 | Ga0307411_10043126 | Ga0307411_100431262 | 176 |
| 424 | 3300032126 | Ga0307415_100022233 | Ga0307415_1000222333 | 176 |
| 425 | 3300033179 | Ga0307507_10000362 | Ga0307507_1000036216 | 176 |
| 426 | 3300033180 | Ga0307510_10002860 | Ga0307510_100028604 | 176 |
| 427 | 3300035115 | Ga0373941_0008478 | Ga0373941_0008478_699_1238 | 176 |
| 428 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1036821_1037363 | 176 |
| 429 | 3300037312 | Ga0395899_0000493 | Ga0395899_0000493_13867_14400 | 176 |
| 430 | 3300037312 | Ga0395899_0000629 | Ga0395899_0000629_1417_1953 | 176 |
| 431 | 3300037312 | Ga0395899_0121552 | Ga0395899_0121552_1150_1689 | 176 |
| 432 | 3300037312 | Ga0395899_0388527 | Ga0395899_0388527_259_801 | 176 |
| 433 | 3300037418 | Ga0395900_0000480 | Ga0395900_0000480_46974_47510 | 176 |
| 434 | 3300037418 | Ga0395900_0000506 | Ga0395900_0000506_46716_47255 | 176 |
| 435 | 3300037418 | Ga0395900_0095707 | Ga0395900_0095707_1382_1921 | 176 |
| 436 | 3300037418 | Ga0395900_0191559 | Ga0395900_0191559_1328_1861 | 176 |
| 437 | 3300037466 | Ga0395898_0012125 | Ga0395898_0012125_4046_4582 | 176 |
| 438 | 3300037471 | Ga0395905_0001166 | Ga0395905_0001166_9410_9949 | 176 |
| 439 | 3300037471 | Ga0395905_0004696 | Ga0395905_0004696_9582_10118 | 176 |
| 440 | 3300038443 | Ga0395901_0000853 | Ga0395901_0000853_24652_25188 | 176 |
| 441 | 3300038443 | Ga0395901_0002096 | Ga0395901_0002096_1759_2298 | 176 |
| 442 | 3300039447 | Ga0436361_1016771 | Ga0436361_1016771_2913_3455 | 176 |
| 443 | 3300041491 | Ga0451833_1402693 | Ga0451833_1402693_129_659 | 176 |
| 444 | 3300042005 | Ga0439448_0172325 | Ga0439448_0172325_144_677 | 176 |
| 445 | 3300042876 | Ga0451577_0042134 | Ga0451577_0042134_25_558 | 176 |
| 446 | 3300042876 | Ga0451577_0060228 | Ga0451577_0060228_838_1374 | 176 |
| 447 | 3300044673 | Ga0453683_0040722 | Ga0453683_0040722_330_866 | 176 |
| 448 | 3300044684 | Ga0466966_0028917 | Ga0466966_0028917_1572_2105 | 176 |
| 449 | 3300044693 | Ga0466961_0060846 | Ga0466961_0060846_207_740 | 176 |
| 450 | 3300044706 | Ga0466964_0013762 | Ga0466964_0013762_2103_2636 | 176 |
| 451 | 3300044712 | Ga0453684_0001421 | Ga0453684_0001421_49936_50472 | 176 |
| 452 | 3300044712 | Ga0453684_0013194 | Ga0453684_0013194_6538_7113 | 176 |
| 453 | 3300044712 | Ga0453684_0018082 | Ga0453684_0018082_7032_7568 | 176 |
| 454 | 3300044712 | Ga0453684_0536959 | Ga0453684_0536959_482_1018 | 176 |
| 455 | 3300044712 | Ga0453684_0555366 | Ga0453684_0555366_205_735 | 176 |
| 456 | 3300044712 | Ga0453684_0702570 | Ga0453684_0702570_473_1006 | 176 |
| 457 | 3300044712 | Ga0453684_1225681 | Ga0453684_1225681_28_558 | 176 |
| 458 | 3300045049 | Ga0466959_0036343 | Ga0466959_0036343_742_1275 | 176 |
| 459 | 3300045051 | Ga0451576_0051858 | Ga0451576_0051858_2792_3322 | 176 |
| 460 | 3300045051 | Ga0451576_0062486 | Ga0451576_0062486_1645_2181 | 176 |
| 461 | 3300045051 | Ga0451576_0237784 | Ga0451576_0237784_28_558 | 176 |
| 462 | 3300045051 | Ga0451576_0310393 | Ga0451576_0310393_317_853 | 176 |
| 463 | 3300045836 | Ga0466958_0281339 | Ga0466958_0281339_184_717 | 176 |
| 464 | 3300046462 | Ga0495651_0074069 | Ga0495651_0074069_790_1326 | 176 |
| 465 | 3300046471 | Ga0495650_0000132 | Ga0495650_0000132_173548_174078 | 176 |
| 466 | 3300046471 | Ga0495650_0032725 | Ga0495650_0032725_1277_1819 | 176 |
| 467 | 3300046471 | Ga0495650_0055942 | Ga0495650_0055942_1041_1574 | 176 |
| 468 | 3300046492 | Ga0495585_0007009 | Ga0495585_0007009_4059_4589 | 176 |
| 469 | 3300046492 | Ga0495585_0018872 | Ga0495585_0018872_3276_3842 | 176 |
| 470 | 3300046506 | Ga0495583_0024265 | Ga0495583_0024265_278_823 | 176 |
| 471 | 3300046506 | Ga0495583_0111811 | Ga0495583_0111811_270_803 | 176 |
| 472 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_193794_194327 | 176 |
| 473 | 3300046507 | Ga0495606_0039595 | Ga0495606_0039595_1298_1831 | 176 |
| 474 | 3300046507 | Ga0495606_0055333 | Ga0495606_0055333_355_885 | 176 |
| 475 | 3300046507 | Ga0495606_0150390 | Ga0495606_0150390_421_966 | 176 |
| 476 | 3300046511 | Ga0495608_0657234 | Ga0495608_0657234_59_595 | 176 |
| 477 | 3300046512 | Ga0495610_0000028 | Ga0495610_0000028_154568_155098 | 176 |
| 478 | 3300046512 | Ga0495610_0002790 | Ga0495610_0002790_2584_3114 | 176 |
| 479 | 3300046512 | Ga0495610_0007329 | Ga0495610_0007329_2027_2560 | 176 |
| 480 | 3300046513 | Ga0495616_0002258 | Ga0495616_0002258_10744_11277 | 176 |
| 481 | 3300046518 | Ga0495631_0008558 | Ga0495631_0008558_780_1313 | 176 |
| 482 | 3300046519 | Ga0495632_0213220 | Ga0495632_0213220_316_846 | 176 |
| 483 | 3300046520 | Ga0495637_0078135 | Ga0495637_0078135_700_1230 | 176 |
| 484 | 3300046523 | Ga0495644_0013045 | Ga0495644_0013045_728_1261 | 176 |
| 485 | 3300046524 | Ga0495648_0005421 | Ga0495648_0005421_1306_1872 | 176 |
| 486 | 3300046524 | Ga0495648_0111319 | Ga0495648_0111319_623_1189 | 176 |
| 487 | 3300046529 | Ga0495652_0176037 | Ga0495652_0176037_447_983 | 176 |
| 488 | 3300046529 | Ga0495652_0259897 | Ga0495652_0259897_514_1050 | 176 |
| 489 | 3300046529 | Ga0495652_0324472 | Ga0495652_0324472_442_975 | 176 |
| 490 | 3300046530 | Ga0495654_0057738 | Ga0495654_0057738_178_744 | 176 |
| 491 | 3300046538 | Ga0495609_0008958 | Ga0495609_0008958_3406_3939 | 176 |
| 492 | 3300046558 | Ga0495633_0000015 | Ga0495633_0000015_228436_228978 | 176 |
| 493 | 3300046558 | Ga0495633_0017420 | Ga0495633_0017420_859_1392 | 176 |
| 494 | 3300046616 | Ga0495668_0000134 | Ga0495668_0000134_100390_100956 | 176 |
| 495 | 3300046616 | Ga0495668_0367189 | Ga0495668_0367189_187_732 | 176 |
| 496 | 3300046648 | Ga0495611_0145368 | Ga0495611_0145368_307_852 | 176 |
| 497 | 3300046660 | Ga0495625_0000036 | Ga0495625_0000036_23749_24282 | 176 |
| 498 | 3300046660 | Ga0495625_0000385 | Ga0495625_0000385_52318_52860 | 176 |
| 499 | 3300046660 | Ga0495625_0045319 | Ga0495625_0045319_362_928 | 176 |
| 500 | 3300046660 | Ga0495625_0068103 | Ga0495625_0068103_1209_1742 | 176 |
| 501 | 3300046660 | Ga0495625_0096836 | Ga0495625_0096836_976_1536 | 176 |
| 502 | 3300046660 | Ga0495625_0297104 | Ga0495625_0297104_48_587 | 176 |
| 503 | 3300046660 | Ga0495625_0373706 | Ga0495625_0373706_330_866 | 176 |
| 504 | 3300046660 | Ga0495625_0526560 | Ga0495625_0526560_44_574 | 176 |
| 505 | 3300046660 | Ga0495625_0655433 | Ga0495625_0655433_28_570 | 176 |
| 506 | 3300046665 | Ga0495661_0003481 | Ga0495661_0003481_7014_7547 | 176 |
| 507 | 3300046665 | Ga0495661_0013574 | Ga0495661_0013574_2698_3228 | 176 |
| 508 | 3300046665 | Ga0495661_0455480 | Ga0495661_0455480_58_591 | 176 |
| 509 | 3300046683 | Ga0495658_0137911 | Ga0495658_0137911_475_1041 | 176 |
| 510 | 3300046694 | Ga0495649_0000017 | Ga0495649_0000017_197429_197962 | 176 |
| 511 | 3300046694 | Ga0495649_0031446 | Ga0495649_0031446_2196_2726 | 176 |
| 512 | 3300046809 | Ga0495600_0278965 | Ga0495600_0278965_380_946 | 176 |
| 513 | 3300046810 | Ga0495660_0024577 | Ga0495660_0024577_771_1301 | 176 |
| 514 | 3300047443 | Ga0495687_006934 | Ga0495687_006934_2613_3146 | 176 |
| 515 | 3300047443 | Ga0495687_019030 | Ga0495687_019030_832_1365 | 176 |
| 516 | 3300047443 | Ga0495687_140429 | Ga0495687_140429_157_690 | 176 |
| 517 | 3300047472 | Ga0495686_0001016 | Ga0495686_0001016_19379_19924 | 176 |
| 518 | 3300047472 | Ga0495686_0004451 | Ga0495686_0004451_6902_7432 | 176 |
| 519 | 3300047472 | Ga0495686_0088508 | Ga0495686_0088508_993_1526 | 176 |
| 520 | 3300047472 | Ga0495686_0451054 | Ga0495686_0451054_113_658 | 176 |
| 521 | 3300048089 | Ga0495614_0007965 | Ga0495614_0007965_2438_3004 | 176 |
| 522 | 3300048918 | Ga0496115_0421152 | Ga0496115_0421152_241_771 | 176 |
| 523 | 3300048918 | Ga0496115_0928643 | Ga0496115_0928643_73_606 | 176 |
| 524 | 3300048920 | Ga0496117_0003502 | Ga0496117_0003502_14580_15113 | 176 |
| 525 | 3300048921 | Ga0496118_0034888 | Ga0496118_0034888_1271_1804 | 176 |
| 526 | 3300048925 | Ga0496122_0134452 | Ga0496122_0134452_50_583 | 176 |
| 527 | 3300048926 | Ga0496123_0012094 | Ga0496123_0012094_4292_4825 | 176 |
| 528 | 3300048926 | Ga0496123_0023603 | Ga0496123_0023603_685_1215 | 176 |
| 529 | 3300048927 | Ga0496124_0062742 | Ga0496124_0062742_1605_2138 | 176 |
| 530 | 3300048928 | Ga0496125_0093490 | Ga0496125_0093490_361_894 | 176 |
| 531 | 3300048929 | Ga0496126_0187828 | Ga0496126_0187828_10_543 | 176 |
| 532 | 3300049459 | Ga0495678_011416 | Ga0495678_011416_1921_2484 | 176 |
| 533 | 3300049460 | Ga0495682_0068128 | Ga0495682_0068128_658_1224 | 176 |
| 534 | 3300049523 | Ga0501300_000801 | Ga0501300_000801_1250_1783 | 176 |
| 535 | 3300049571 | Ga0501034_0032078 | Ga0501034_0032078_766_1317 | 176 |
| 536 | 3300049661 | Ga0501217_002500 | Ga0501217_002500_1537_2070 | 176 |
| 537 | 3300049663 | Ga0501223_000717 | Ga0501223_000717_3583_4116 | 176 |
| 538 | 3300049677 | Ga0501247_001377 | Ga0501247_001377_1741_2274 | 176 |
| 539 | 3300049686 | Ga0501257_032119 | Ga0501257_032119_646_1176 | 176 |
| 540 | 3300049705 | Ga0501225_0157620 | Ga0501225_0157620_26_559 | 176 |
| 541 | 3300049758 | Ga0501241_020478 | Ga0501241_020478_141_671 | 176 |
| 542 | 3300049760 | Ga0501263_047563 | Ga0501263_047563_43_588 | 176 |
| 543 | 3300049775 | Ga0501279_003985 | Ga0501279_003985_660_1190 | 176 |
| 544 | 3300050493 | nmdc:mga0k408_1182_c2 | nmdc:mga0k408_1182_c2_1302_1844 | 176 |
| 545 | 3300050493 | nmdc:mga0k408_164047_c1 | nmdc:mga0k408_164047_c1_586_1119 | 176 |
| 546 | 3300050493 | nmdc:mga0k408_21723_c1 | nmdc:mga0k408_21723_c1_329_859 | 176 |
| 547 | 3300050493 | nmdc:mga0k408_824_c1 | nmdc:mga0k408_824_c1_12125_12658 | 176 |
| 548 | 3300050511 | nmdc:mga08y16_117080_c1 | nmdc:mga08y16_117080_c1_1009_1548 | 176 |
| 549 | 3300053080 | Ga0500635_0055047 | Ga0500635_0055047_530_1072 | 176 |
| 550 | 3300053093 | Ga0500651_0020646 | Ga0500651_0020646_1850_2380 | 176 |
| 551 | 3300053122 | Ga0500608_005499 | Ga0500608_005499_4118_4648 | 176 |
| 552 | 3300053125 | Ga0500618_000013 | Ga0500618_000013_131712_132242 | 176 |
| 553 | 3300053153 | Ga0500616_0000015 | Ga0500616_0000015_552361_552891 | 176 |
| 554 | 3300053153 | Ga0500616_0169303 | Ga0500616_0169303_244_783 | 176 |
| 555 | 3300053156 | Ga0500622_0000768 | Ga0500622_0000768_13215_13748 | 176 |
| 556 | 3300053157 | Ga0500624_000504 | Ga0500624_000504_9025_9558 | 176 |
| 557 | iso_pu_bacteria | 2928078545 | 2928080596 | 176 |
| 558 | iso_pu_bacteria | 2932082852 | 2932083022 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qiu-assembly1.cif.gz_B | ysga 23s rna methyltransferase from bacillus subtilis | 0.9344 | 26 | 171 |
| 2ha8-assembly1.cif.gz_B | methyltransferase domain of human tar (hiv-1) rna binding protein 1 | 0.925 | 25 | 173 |
| 2i6d-assembly1.cif.gz_A | the structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis. | 0.9055 | 25 | 170 |
| 5co4-assembly1.cif.gz_A | structural insights into the 2-oh methylation of c/u34 on trna | 0.8978 | 25 | 174 |
| 1v2x-assembly1.cif.gz_A-2 | trmh | 0.8944 | 14 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P94978_97_258_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9463 | 24 | 174 | 3.40.1280.10 |
| af_Q2FZE0_99_246_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9368 | 26 | 171 | 3.40.1280.10 |
| af_Q54XF8_1505_1680_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9226 | 19 | 173 | 3.40.1280.10 |
| af_P9WFY5_148_322_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9224 | 25 | 176 | 3.40.1280.10 |
| af_A0A0G2JYA7_1418_1569_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.9197 | 26 | 173 | 3.40.1280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519W263-F1-model_v4 | TrmH family RNA methyltransferase | 0.9949 | 1 | 176 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A1Q5ZZ49-F1-model_v4 | tRNA/rRNA methyltransferase SpoU type domain-containing protein | 0.9945 | 1 | 175 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A3B9FR95-F1-model_v4 | RNA methyltransferase | 0.9945 | 1 | 175 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A0A7X9D5R9-F1-model_v4 | RNA methyltransferase | 0.9942 | 1 | 174 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
| AF-A6E8P1-F1-model_v4 | Putative SpoU rRNA methylase family protein | 0.994 | 1 | 176 |
GO:0003723
GO:0005829 GO:0006396 GO:0008173 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar