F463456

General Info

Members Datasets Scaffolds Average Seq Length
558 268 521 178

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100002381|Ga0307408_1000023817
Length 206
Sequence MMIGTKYKIALKQQVIERFTFRNRIFALMENRKLKLWELDRVGEEEFRAQKKFPIILVLNDIRSLNNIGSFFRTADALNIEKIYLCGITAVPPHRDIHKTALGATETVEWEYRENILELVSELQNNGVSVCTIEQTEKTTLLHQIDQLTEERFALVFGNEVDGVDQEVINAADHIIEIPQFGTKHSFNVAVCAGIVTWEFAKRYIA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
15 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
16 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
17 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
18 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
19 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
20 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
21 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
22 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
23 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
24 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
25 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
28 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
29 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
30 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
31 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
32 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
33 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
34 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
35 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
36 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
37 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
38 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
39 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
40 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
41 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
42 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
43 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
44 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
45 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
46 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
58 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
59 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
62 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
70 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
71 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
72 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
73 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
172 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
173 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
174 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
248 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
249 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
254 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
257 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
258 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
268 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.65
Metatranscriptomes 0.36
Isolates 6.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.89
Nodule 0
Rhizoplane 0.72
Rhizosphere 79.39
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1953040 2162886007 Bacteria 2255
2 SwRhRL2b_contig_3746020 2162886007 Bacteria 5379
3 JGI24740J21852_10027594 3300001979 Bacteria 1887
4 JGI24739J22299_10003124 3300001989 Bacteria 6320
5 JGI24737J22298_10000081 3300001990 Bacteria 27733
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI25162J39368_1000089 3300002737 Bacteria 104054
8 JGI25162J39368_1001026 3300002737 Bacteria 17284
9 JGI25157J39369_1012911 3300002741 Bacteria 1058
10 JGI25164J39214_1003551 3300002772 Bacteria 1953
11 JGI25152J39213_1000111 3300002773 Bacteria 57579
12 JGI25150J39212_1000009 3300002774 Bacteria 249509
13 JGI25151J46595_10000017 3300003187 Bacteria 249509
14 JGI25165J46597_1000694 3300003214 Bacteria 26947
15 JGI25153J46596_10000023 3300003215 Bacteria 249509
16 rootH1_10005699 3300003316 Bacteria 17995
17 rootH1_10005699 3300003323 Bacteria 16393
18 rootH1_10075429 3300003316 Bacteria 2683
19 rootH1_10075429 3300003323 Bacteria 1366
20 rootH1_10188739 3300003316 Bacteria 1308
21 rootH2_10001891 3300003320 Bacteria 464318
22 rootH2_10004559 3300003320 Bacteria 142332
23 rootH2_10057459 3300003320 Bacteria 9721
24 rootH2_10097202 3300003320 Bacteria 1012
25 rootH2_10242585 3300003320 Bacteria 1802
26 rootH2_10248911 3300003320 Unclassified 1192
27 rootL2_10000423 3300003322 Bacteria 50071
28 rootL2_10023987 3300003322 Bacteria 8007
29 rootL2_10103496 3300003322 Bacteria 14927
30 rootL2_10117027 3300003322 Bacteria 6802
31 rootL2_10122988 3300003322 Bacteria 1485
32 rootL2_10197573 3300003322 Bacteria 1536
33 rootL2_10211968 3300003322 Eukaryota 1447
34 rootL2_10237433 3300003322 Bacteria 2990
35 rootH1_10000380 3300003323 Bacteria 28122
36 rootH1_10002701 3300003323 Bacteria 73970
37 rootH1_10020300 3300003323 Bacteria 21210
38 rootH1_10037471 3300003323 Bacteria 3102
39 rootH1_10076174 3300003323 Bacteria 6293
40 rootH1_10204861 3300003323 Bacteria 4238
41 Ga0055536_1000003 3300003781 Bacteria 447744
42 Ga0055530_10003135 3300003791 Bacteria 9760
43 Ga0055530_10051576 3300003791 Bacteria 953
44 Ga0055531_10000058 3300003794 Bacteria 121538
45 Ga0058863_11778257 3300004799 Bacteria 2697
46 Ga0058862_12758247 3300004803 Bacteria 3125
47 Ga0065714_10002530 3300005288 Bacteria 17684
48 Ga0065714_10002817 3300005288 Bacteria 18955
49 Ga0065714_10004334 3300005288 Bacteria 6040
50 Ga0065714_10008852 3300005288 Bacteria 4290
51 Ga0065714_10065450 3300005288 Bacteria 10008
52 Ga0065714_10065676 3300005288 Bacteria 8876
53 Ga0065714_10068853 3300005288 Bacteria 4504
54 Ga0065714_10101961 3300005288 Bacteria 1632
55 Ga0065714_10195385 3300005288 Bacteria 913
56 Ga0065714_10251702 3300005288 Bacteria 774
57 Ga0065714_10288274 3300005288 Bacteria 712
58 Ga0065704_10000288 3300005289 Bacteria 77379
59 Ga0065704_10018848 3300005289 Bacteria 1651
60 Ga0065704_10083289 3300005289 Bacteria 3484
61 Ga0065704_10085946 3300005289 Bacteria 3171
62 Ga0065704_10157972 3300005289 Bacteria 1376
63 Ga0065704_10178827 3300005289 Bacteria 1248
64 Ga0070658_10000049 3300005327 Bacteria 119985
65 Ga0070658_10165199 3300005327 Bacteria 1858
66 Ga0070676_10000563 3300005328 Bacteria 17973
67 Ga0070683_100626514 3300005329 Unclassified 1030
68 Ga0070680_100040500 3300005336 Bacteria 3772
69 Ga0068868_100026907 3300005338 Bacteria 4385
70 Ga0068868_100812297 3300005338 Bacteria 844
71 Ga0070660_100026708 3300005339 Bacteria 4302
72 Ga0070660_100080720 3300005339 Bacteria 2553
73 Ga0070660_100106243 3300005339 Unclassified 2229
74 Ga0070689_101258510 3300005340 Bacteria 665
75 Ga0070691_10356766 3300005341 Bacteria 813
76 Ga0070671_100007939 3300005355 Bacteria 8487
77 Ga0070674_100083649 3300005356 Bacteria 2286
78 Ga0070673_100093520 3300005364 Bacteria 2462
79 Ga0070673_100652513 3300005364 Bacteria 963
80 Ga0070659_100000432 3300005366 Bacteria 31586
81 Ga0070659_100014484 3300005366 Bacteria 5894
82 Ga0070659_100052411 3300005366 Bacteria 3209
83 Ga0070663_100084313 3300005455 Bacteria 2342
84 Ga0070662_100000045 3300005457 Bacteria 67900
85 Ga0068867_100000344 3300005459 Bacteria 30803
86 Ga0070685_10028821 3300005466 Bacteria 3080
87 Ga0070679_100352893 3300005530 Bacteria 1418
88 Ga0068853_100054716 3300005539 Bacteria 3440
89 Ga0068853_100091965 3300005539 Bacteria 2668
90 Ga0068853_100273701 3300005539 Bacteria 1555
91 Ga0068853_100822244 3300005539 Bacteria 890
92 Ga0070665_100000020 3300005548 Bacteria 389687
93 Ga0068855_100000195 3300005563 Bacteria 78223
94 Ga0068855_100000988 3300005563 Bacteria 35353
95 Ga0068855_100044282 3300005563 Bacteria 5267
96 Ga0068855_100094219 3300005563 Bacteria 3453
97 Ga0068855_100106546 3300005563 Bacteria 3222
98 Ga0068855_100695735 3300005563 Bacteria 1088
99 Ga0068856_100000935 3300005614 Bacteria 31259
100 Ga0068856_100013777 3300005614 Bacteria 7815
101 Ga0068856_100232393 3300005614 Bacteria 1859
102 Ga0068852_100107178 3300005616 Bacteria 2534
103 Ga0068852_100196573 3300005616 Bacteria 1906
104 Ga0068859_100996033 3300005617 Bacteria 920
105 Ga0068866_10027440 3300005718 Bacteria 2700
106 Ga0068870_10097036 3300005840 Bacteria 1658
107 Ga0068860_100122107 3300005843 Bacteria 2495
108 Ga0075366_10001766 3300006195 Bacteria 10903
109 Ga0075366_10003263 3300006195 Bacteria 8527
110 Ga0075366_10175961 3300006195 Bacteria 1299
111 Ga0097621_100005555 3300006237 Bacteria 8890
112 Ga0068871_100000100 3300006358 Bacteria 51253
113 Ga0075430_100662081 3300006846 Bacteria 861
114 Ga0068865_100005711 3300006881 Bacteria 7561
115 Ga0097620_100995863 3300006931 Bacteria 920
116 Ga0105244_10038104 3300009036 Bacteria 2509
117 Ga0105244_10156571 3300009036 Bacteria 1090
118 Ga0105240_10000193 3300009093 Bacteria 124087
119 Ga0105240_10002893 3300009093 Bacteria 27105
120 Ga0105240_10008133 3300009093 Bacteria 15046
121 Ga0105240_10030991 3300009093 Bacteria 6941
122 Ga0105240_10105032 3300009093 Bacteria 3429
123 Ga0105240_10162937 3300009093 Bacteria 2647
124 Ga0105240_10190532 3300009093 Bacteria 2412
125 Ga0105240_11016994 3300009093 Bacteria 886
126 Ga0111539_10008369 3300009094 Bacteria 13164
127 Ga0105245_10060462 3300009098 Bacteria 3412
128 Ga0105245_10747241 3300009098 Bacteria 1014
129 Ga0105245_10758896 3300009098 Bacteria 1006
130 Ga0105243_10103104 3300009148 Bacteria 2372
131 Ga0105241_10000086 3300009174 Bacteria 69935
132 Ga0105241_10008186 3300009174 Bacteria 7696
133 Ga0105241_10034569 3300009174 Bacteria 3798
134 Ga0105241_10156565 3300009174 Bacteria 1869
135 Ga0105241_10365578 3300009174 Bacteria 1256
136 Ga0105241_11017757 3300009174 Unclassified 776
137 Ga0105242_10016851 3300009176 Bacteria 5688
138 Ga0105242_10025626 3300009176 Bacteria 4669
139 Ga0105237_10002494 3300009545 Bacteria 22822
140 Ga0105237_10005037 3300009545 Bacteria 15043
141 Ga0105237_10011464 3300009545 Bacteria 9377
142 Ga0105237_10026888 3300009545 Bacteria 5880
143 Ga0105237_10045858 3300009545 Bacteria 4398
144 Ga0105237_10079727 3300009545 Bacteria 3264
145 Ga0105237_10084715 3300009545 Bacteria 3160
146 Ga0105237_10094863 3300009545 Bacteria 2972
147 Ga0105237_10268714 3300009545 Bacteria 1708
148 Ga0105238_10007399 3300009551 Bacteria 11001
149 Ga0105238_10182444 3300009551 Bacteria 2075
150 Ga0105239_10000578 3300010375 Bacteria 52273
151 Ga0105239_10000586 3300010375 Bacteria 51873
152 Ga0105239_10004569 3300010375 Bacteria 16504
153 Ga0105239_10007004 3300010375 Bacteria 12974
154 Ga0105239_10008129 3300010375 Bacteria 11976
155 Ga0105239_10047030 3300010375 Bacteria 4728
156 Ga0105239_10082682 3300010375 Bacteria 3536
157 Ga0105239_10097072 3300010375 Bacteria 3256
158 Ga0105239_10189692 3300010375 Bacteria 2301
159 Ga0105239_10205160 3300010375 Bacteria 2209
160 Ga0105239_10309078 3300010375 Bacteria 1781
161 Ga0157373_10000041 3300013100 Bacteria 113871
162 Ga0157373_10000337 3300013100 Bacteria 38082
163 Ga0157373_10028839 3300013100 Bacteria 4002
164 Ga0157373_10030355 3300013100 Bacteria 3889
165 Ga0157373_10086529 3300013100 Bacteria 2209
166 Ga0157373_10135681 3300013100 Bacteria 1730
167 Ga0157373_10263564 3300013100 Bacteria 1219
168 Ga0157371_10000009 3300013102 Bacteria 392895
169 Ga0157371_10000135 3300013102 Bacteria 107607
170 Ga0157371_10002029 3300013102 Bacteria 19994
171 Ga0157371_10004696 3300013102 Bacteria 11804
172 Ga0157371_10014439 3300013102 Bacteria 5959
173 Ga0157371_10015862 3300013102 Bacteria 5636
174 Ga0157371_10048591 3300013102 Bacteria 3016
175 Ga0157371_10075092 3300013102 Bacteria 2394
176 Ga0157371_10151627 3300013102 Bacteria 1653
177 Ga0157371_10483507 3300013102 Bacteria 913
178 Ga0157371_10814988 3300013102 Bacteria 704
179 Ga0157370_10008331 3300013104 Bacteria 11182
180 Ga0157370_10017168 3300013104 Bacteria 7306
181 Ga0157370_10022230 3300013104 Bacteria 6311
182 Ga0157370_10029541 3300013104 Bacteria 5376
183 Ga0157370_10047084 3300013104 Bacteria 4134
184 Ga0157370_10051390 3300013104 Bacteria 3937
185 Ga0157370_10092087 3300013104 Bacteria 2846
186 Ga0157370_10166267 3300013104 Bacteria 2051
187 Ga0157370_10613148 3300013104 Bacteria 996
188 Ga0157369_10000006 3300013105 Bacteria 412230
189 Ga0157369_10005660 3300013105 Bacteria 14515
190 Ga0157369_10019913 3300013105 Bacteria 7505
191 Ga0157369_10558898 3300013105 Bacteria 1182
192 Ga0157369_10615316 3300013105 Bacteria 1121
193 Ga0157369_11265142 3300013105 Bacteria 752
194 Ga0157374_10000128 3300013296 Bacteria 69753
195 Ga0157374_10000202 3300013296 Bacteria 54739
196 Ga0157374_10007012 3300013296 Bacteria 9591
197 Ga0157374_10345422 3300013296 Bacteria 1478
198 Ga0157374_10429317 3300013296 Bacteria 1321
199 Ga0157378_10004756 3300013297 Bacteria 11898
200 Ga0157378_10014634 3300013297 Bacteria 6869
201 Ga0157378_10550504 3300013297 Bacteria 1159
202 Ga0163162_10000032 3300013306 Bacteria 156609
203 Ga0163162_10003807 3300013306 Bacteria 14466
204 Ga0163162_10156190 3300013306 Bacteria 2402
205 Ga0163162_10185627 3300013306 Bacteria 2206
206 Ga0163162_10334499 3300013306 Bacteria 1647
207 Ga0163162_10705086 3300013306 Bacteria 1131
208 Ga0157372_10000017 3300013307 Bacteria 219543
209 Ga0157372_10000061 3300013307 Bacteria 119814
210 Ga0157372_10000250 3300013307 Bacteria 59465
211 Ga0157372_10003385 3300013307 Bacteria 17204
212 Ga0157372_10031266 3300013307 Bacteria 5828
213 Ga0157372_10047894 3300013307 Bacteria 4750
214 Ga0157372_10165362 3300013307 Bacteria 2558
215 Ga0157372_10261689 3300013307 Unclassified 2009
216 Ga0157375_10008600 3300013308 Bacteria 8939
217 Ga0157375_10198211 3300013308 Bacteria 2163
218 Ga0163163_11560809 3300014325 Unclassified 721
219 Ga0182008_10000001 3300014497 Bacteria 540790
220 Ga0182008_10004035 3300014497 Bacteria 8665
221 Ga0182008_10012175 3300014497 Bacteria 4547
222 Ga0182008_10088698 3300014497 Bacteria 1524
223 Ga0157377_10128216 3300014745 Bacteria 1546
224 Ga0157376_11633635 3300014969 Unclassified 679
225 Ga0182006_1000244 3300015261 Bacteria 50752
226 Ga0182006_1000646 3300015261 Bacteria 24714
227 Ga0182006_1004222 3300015261 Bacteria 7123
228 Ga0182006_1004407 3300015261 Bacteria 6956
229 Ga0182006_1006216 3300015261 Bacteria 5573
230 Ga0182006_1093123 3300015261 Bacteria 1081
231 Ga0182007_10000001 3300015262 Bacteria 1127301
232 Ga0182007_10070898 3300015262 Unclassified 1142
233 Ga0182007_10082031 3300015262 Bacteria 1058
234 Ga0183373_1010 3300015682 Bacteria 196982
235 Ga0163161_10000468 3300017792 Bacteria 33545
236 Ga0163161_10000919 3300017792 Bacteria 22732
237 Ga0163161_10003366 3300017792 Bacteria 11214
238 Ga0163161_10007612 3300017792 Bacteria 7491
239 Ga0163161_10061405 3300017792 Bacteria 2736
240 Ga0163161_10074368 3300017792 Bacteria 2491
241 Ga0163161_11108622 3300017792 Bacteria 681
242 Ga0213872_10048195 3300021361 Bacteria 1936
243 Ga0209437_100008 3300025233 Bacteria 921142
244 Ga0209437_100221 3300025233 Bacteria 104135
245 Ga0207425_1000007 3300025245 Bacteria 777411
246 Ga0209026_1000383 3300025250 Bacteria 40563
247 Ga0209026_1005674 3300025250 Bacteria 3285
248 Ga0209026_1008704 3300025250 Bacteria 2086
249 Ga0209026_1027504 3300025250 Bacteria 852
250 Ga0209129_1000006 3300025258 Bacteria 777761
251 Ga0209129_1012982 3300025258 Bacteria 1866
252 Ga0209233_1000024 3300025261 Bacteria 695418
253 Ga0209233_1001531 3300025261 Bacteria 9060
254 Ga0209233_1020955 3300025261 Bacteria 1703
255 Ga0209455_1010452 3300025272 Bacteria 2359
256 Ga0209676_1000001 3300025292 Bacteria 1852142
257 Ga0209025_1000025 3300025294 Bacteria 524454
258 Ga0209758_1000016 3300025297 Bacteria 778557
259 Ga0209050_1000016 3300025298 Bacteria 729149
260 Ga0209050_1011974 3300025298 Bacteria 4038
261 Ga0209050_1030128 3300025298 Bacteria 1718
262 Ga0207426_1043502 3300025302 Bacteria 1379
263 Ga0209257_1000007 3300025304 Bacteria 1564415
264 Ga0207642_10387734 3300025899 Unclassified 833
265 Ga0207647_10000105 3300025904 Bacteria 65502
266 Ga0207647_10002524 3300025904 Bacteria 13860
267 Ga0207645_10001210 3300025907 Bacteria 21312
268 Ga0207643_10104961 3300025908 Bacteria 1660
269 Ga0207705_10000079 3300025909 Bacteria 119999
270 Ga0207654_10001404 3300025911 Bacteria 12762
271 Ga0207654_10006969 3300025911 Bacteria 5695
272 Ga0207654_10025621 3300025911 Bacteria 3184
273 Ga0207654_10296593 3300025911 Bacteria 1098
274 Ga0207707_10006352 3300025912 Bacteria 10323
275 Ga0207695_10000013 3300025913 Bacteria 821265
276 Ga0207695_10004447 3300025913 Bacteria 19105
277 Ga0207695_10013327 3300025913 Bacteria 9810
278 Ga0207695_10059228 3300025913 Bacteria 3972
279 Ga0207695_10078483 3300025913 Bacteria 3349
280 Ga0207695_10118678 3300025913 Bacteria 2616
281 Ga0207695_10142414 3300025913 Bacteria 2344
282 Ga0207671_10001943 3300025914 Bacteria 22809
283 Ga0207671_10003540 3300025914 Bacteria 15488
284 Ga0207671_10026583 3300025914 Bacteria 4334
285 Ga0207671_10049682 3300025914 Bacteria 3105
286 Ga0207671_10062493 3300025914 Bacteria 2765
287 Ga0207671_10073367 3300025914 Bacteria 2556
288 Ga0207660_10038332 3300025917 Bacteria 3345
289 Ga0207657_10063077 3300025919 Bacteria 3171
290 Ga0207657_10065835 3300025919 Unclassified 3087
291 Ga0207652_10090977 3300025921 Bacteria 2682
292 Ga0207652_10204581 3300025921 Bacteria 1777
293 Ga0207694_10108772 3300025924 Bacteria 2203
294 Ga0207694_10426127 3300025924 Bacteria 1106
295 Ga0207644_10007769 3300025931 Bacteria 7002
296 Ga0207690_10000610 3300025932 Bacteria 23101
297 Ga0207690_10035281 3300025932 Bacteria 3230
298 Ga0207706_10000120 3300025933 Bacteria 84222
299 Ga0207706_10500197 3300025933 Unclassified 1049
300 Ga0207686_10008042 3300025934 Bacteria 5690
301 Ga0207686_10055303 3300025934 Bacteria 2490
302 Ga0207709_10000072 3300025935 Bacteria 178084
303 Ga0207670_10818463 3300025936 Bacteria 777
304 Ga0207704_10000099 3300025938 Bacteria 48088
305 Ga0207667_10000046 3300025949 Bacteria 245420
306 Ga0207667_10001052 3300025949 Bacteria 35129
307 Ga0207667_10115477 3300025949 Bacteria 2767
308 Ga0207667_10287147 3300025949 Bacteria 1681
309 Ga0207667_10301528 3300025949 Bacteria 1637
310 Ga0207667_10412279 3300025949 Bacteria 1375
311 Ga0207667_10480572 3300025949 Bacteria 1261
312 Ga0207667_10575087 3300025949 Bacteria 1138
313 Ga0207667_11158734 3300025949 Bacteria 754
314 Ga0207651_10214500 3300025960 Bacteria 1552
315 Ga0207651_10291006 3300025960 Bacteria 1354
316 Ga0207677_10044162 3300026023 Bacteria 2967
317 Ga0207639_10038699 3300026041 Bacteria 3549
318 Ga0207639_10462656 3300026041 Unclassified 1153
319 Ga0207639_10660145 3300026041 Bacteria 968
320 Ga0207678_10110737 3300026067 Bacteria 2342
321 Ga0207702_10003141 3300026078 Bacteria 15314
322 Ga0207702_10045811 3300026078 Bacteria 3680
323 Ga0207648_10011576 3300026089 Bacteria 8305
324 Ga0207683_10140590 3300026121 Bacteria 2175
325 Ga0207683_10706708 3300026121 Bacteria 935
326 Ga0207698_10272596 3300026142 Bacteria 1561
327 Ga0207698_10609507 3300026142 Bacteria 1077
328 Ga0209968_1048157 3300027526 Bacteria 737
329 Ga0207428_10216296 3300027907 Bacteria 1438
330 Ga0268266_10000018 3300028379 Bacteria 569141
331 Ga0268264_10099390 3300028381 Bacteria 2525
332 Ga0307517_10003095 3300028786 Bacteria 26254
333 Ga0307515_10000094 3300028794 Bacteria 210723
334 Ga0307515_10000353 3300028794 Bacteria 112876
335 Ga0307515_10000859 3300028794 Bacteria 69963
336 Ga0307515_10039499 3300028794 Bacteria 7501
337 Ga0307515_10113784 3300028794 Bacteria 3134
338 Ga0307515_10139434 3300028794 Bacteria 2611
339 Ga0265338_10024738 3300028800 Bacteria 6123
340 Ga0316177_1179722 3300030731 Bacteria 6329
341 Ga0316176_1157629 3300030732 Bacteria 1984
342 Ga0316183_1027629 3300030742 Bacteria 11015
343 Ga0316181_1023435 3300030744 Bacteria 1081
344 Ga0316181_1051627 3300030744 Bacteria 18287
345 Ga0307513_10078981 3300031456 Bacteria 3401
346 Ga0307513_10550792 3300031456 Bacteria 866
347 Ga0307509_10310740 3300031507 Bacteria 1319
348 Ga0307509_10331298 3300031507 Bacteria 1254
349 Ga0307408_100002381 3300031548 Bacteria 13266
350 Ga0307408_100006190 3300031548 Bacteria 7946
351 Ga0307408_100017152 3300031548 Bacteria 4845
352 Ga0265342_10073159 3300031712 Bacteria 1994
353 Ga0265342_10076799 3300031712 Bacteria 1936
354 Ga0316576_10052599 3300031727 Bacteria 2966
355 Ga0307405_10000010 3300031731 Bacteria 250978
356 Ga0307405_10214521 3300031731 Bacteria 1408
357 Ga0307405_10262355 3300031731 Bacteria 1291
358 Ga0307405_10966005 3300031731 Bacteria 725
359 Ga0307413_10133524 3300031824 Bacteria 1703
360 Ga0307407_10000009 3300031903 Bacteria 188746
361 Ga0307412_10000033 3300031911 Bacteria 206649
362 Ga0307412_10002746 3300031911 Bacteria 9787
363 Ga0307412_10159973 3300031911 Bacteria 1672
364 Ga0307412_10570827 3300031911 Bacteria 953
365 Ga0307412_10600544 3300031911 Bacteria 932
366 Ga0307409_100454927 3300031995 Bacteria 1236
367 Ga0307416_100000019 3300032002 Bacteria 199706
368 Ga0307416_100039847 3300032002 Bacteria 3642
369 Ga0307414_10000768 3300032004 Bacteria 16444
370 Ga0307414_10015945 3300032004 Bacteria 4553
371 Ga0307414_10036368 3300032004 Bacteria 3287
372 Ga0307414_10044883 3300032004 Bacteria 3023
373 Ga0307414_10057038 3300032004 Bacteria 2743
374 Ga0307414_10072788 3300032004 Bacteria 2484
375 Ga0307414_10086977 3300032004 Bacteria 2308
376 Ga0307414_10335834 3300032004 Bacteria 1292
377 Ga0307414_10864553 3300032004 Bacteria 827
378 Ga0307414_11476284 3300032004 Unclassified 632
379 Ga0307411_10043126 3300032005 Bacteria 2885
380 Ga0307415_100022233 3300032126 Bacteria 3910
381 Ga0307507_10000362 3300033179 Bacteria 93053
382 Ga0307510_10002860 3300033180 Bacteria 19841
383 Ga0373941_0008478 3300035115 Bacteria 2554
384 Ga0395899_0000002 3300037312 Bacteria 1324310
385 Ga0395899_0000493 3300037312 Bacteria 44066
386 Ga0395899_0000629 3300037312 Bacteria 36706
387 Ga0395899_0121552 3300037312 Unclassified 1870
388 Ga0395899_0255074 3300037312 Unclassified 1202
389 Ga0395899_0388527 3300037312 Bacteria 926
390 Ga0395900_0000480 3300037418 Bacteria 56578
391 Ga0395900_0000506 3300037418 Bacteria 54890
392 Ga0395900_0095707 3300037418 Unclassified 3051
393 Ga0395900_0191559 3300037418 Bacteria 2074
394 Ga0395900_0208558 3300037418 Unclassified 1974
395 Ga0395898_0012125 3300037466 Bacteria 8921
396 Ga0395905_0001166 3300037471 Bacteria 32800
397 Ga0395905_0004696 3300037471 Bacteria 14123
398 Ga0395901_0000853 3300038443 Bacteria 33521
399 Ga0395901_0002096 3300038443 Bacteria 20476
400 Ga0395901_0171434 3300038443 Unclassified 2277
401 Ga0436361_1016771 3300039447 Bacteria 9117
402 Ga0451795_0270238 3300041456 Bacteria 799
403 Ga0451833_1402693 3300041491 Bacteria 876
404 Ga0439448_0172325 3300042005 Bacteria 755
405 Ga0439446_0136796 3300042156 Bacteria 798
406 Ga0451577_0042134 3300042876 Bacteria 4095
407 Ga0451577_0060228 3300042876 Bacteria 3384
408 Ga0453683_0040722 3300044673 Bacteria 2916
409 Ga0466966_0028917 3300044684 Bacteria 3608
410 Ga0466961_0060846 3300044693 Bacteria 2401
411 Ga0466964_0013762 3300044706 Bacteria 3071
412 Ga0453684_0001421 3300044712 Bacteria 68890
413 Ga0453684_0013194 3300044712 Bacteria 13472
414 Ga0453684_0018082 3300044712 Bacteria 10851
415 Ga0453684_0032119 3300044712 Bacteria 7356
416 Ga0453684_0536959 3300044712 Bacteria 1290
417 Ga0453684_0555366 3300044712 Bacteria 1264
418 Ga0453684_0702570 3300044712 Bacteria 1099
419 Ga0453684_1225681 3300044712 Bacteria 786
420 Ga0466959_0036343 3300045049 Bacteria 3640
421 Ga0451576_0051858 3300045051 Bacteria 4300
422 Ga0451576_0062486 3300045051 Bacteria 3882
423 Ga0451576_0237784 3300045051 Bacteria 1902
424 Ga0451576_0283830 3300045051 Bacteria 1731
425 Ga0451576_0310393 3300045051 Bacteria 1650
426 Ga0466958_0281339 3300045836 Unclassified 1066
427 Ga0495651_0074069 3300046462 Bacteria 2584
428 Ga0495650_0000132 3300046471 Bacteria 174226
429 Ga0495650_0032725 3300046471 Bacteria 2322
430 Ga0495650_0055942 3300046471 Bacteria 1603
431 Ga0495585_0007009 3300046492 Bacteria 6939
432 Ga0495585_0018872 3300046492 Bacteria 3978
433 Ga0495583_0024265 3300046506 Bacteria 3051
434 Ga0495583_0111811 3300046506 Bacteria 1157
435 Ga0495606_0000052 3300046507 Bacteria 201529
436 Ga0495606_0039595 3300046507 Bacteria 3174
437 Ga0495606_0055333 3300046507 Bacteria 2566
438 Ga0495606_0150390 3300046507 Bacteria 1367
439 Ga0495608_0657234 3300046511 Bacteria 626
440 Ga0495610_0000028 3300046512 Bacteria 272572
441 Ga0495610_0002790 3300046512 Bacteria 14304
442 Ga0495610_0007329 3300046512 Bacteria 7374
443 Ga0495616_0002258 3300046513 Bacteria 12901
444 Ga0495631_0008558 3300046518 Bacteria 5151
445 Ga0495632_0213220 3300046519 Bacteria 875
446 Ga0495637_0078135 3300046520 Bacteria 1323
447 Ga0495644_0013045 3300046523 Bacteria 3194
448 Ga0495648_0005421 3300046524 Bacteria 10602
449 Ga0495648_0111319 3300046524 Bacteria 1489
450 Ga0495652_0176037 3300046529 Bacteria 1647
451 Ga0495652_0259897 3300046529 Bacteria 1282
452 Ga0495652_0324472 3300046529 Bacteria 1111
453 Ga0495654_0057738 3300046530 Bacteria 1874
454 Ga0495609_0008958 3300046538 Bacteria 4868
455 Ga0495633_0000015 3300046558 Bacteria 254484
456 Ga0495633_0017420 3300046558 Bacteria 3675
457 Ga0495668_0000134 3300046616 Bacteria 112135
458 Ga0495668_0367189 3300046616 Bacteria 790
459 Ga0495611_0145368 3300046648 Bacteria 1107
460 Ga0495625_0000036 3300046660 Bacteria 221680
461 Ga0495625_0000385 3300046660 Bacteria 67419
462 Ga0495625_0045319 3300046660 Bacteria 3179
463 Ga0495625_0068103 3300046660 Bacteria 2503
464 Ga0495625_0096836 3300046660 Bacteria 2032
465 Ga0495625_0297104 3300046660 Bacteria 1034
466 Ga0495625_0373706 3300046660 Bacteria 896
467 Ga0495625_0526560 3300046660 Bacteria 719
468 Ga0495625_0655433 3300046660 Unclassified 625
469 Ga0495661_0003481 3300046665 Bacteria 11604
470 Ga0495661_0013574 3300046665 Bacteria 5468
471 Ga0495661_0455480 3300046665 Unclassified 615
472 Ga0495658_0137911 3300046683 Bacteria 1490
473 Ga0495649_0000017 3300046694 Bacteria 221685
474 Ga0495649_0031446 3300046694 Bacteria 2927
475 Ga0495600_0278965 3300046809 Bacteria 1058
476 Ga0495660_0024577 3300046810 Bacteria 3431
477 Ga0495687_006934 3300047443 Bacteria 6813
478 Ga0495687_019030 3300047443 Bacteria 3379
479 Ga0495687_140429 3300047443 Bacteria 841
480 Ga0495686_0001016 3300047472 Bacteria 33934
481 Ga0495686_0004451 3300047472 Bacteria 11539
482 Ga0495686_0088508 3300047472 Unclassified 1882
483 Ga0495686_0451054 3300047472 Bacteria 683
484 Ga0495614_0007965 3300048089 Bacteria 4709
485 Ga0496115_0421152 3300048918 Bacteria 1082
486 Ga0496115_0928643 3300048918 Bacteria 669
487 Ga0496117_0003502 3300048920 Bacteria 18193
488 Ga0496118_0034888 3300048921 Bacteria 4096
489 Ga0496122_0134452 3300048925 Bacteria 1562
490 Ga0496123_0012094 3300048926 Bacteria 7399
491 Ga0496123_0023603 3300048926 Bacteria 4703
492 Ga0496124_0062742 3300048927 Bacteria 3109
493 Ga0496125_0093490 3300048928 Bacteria 2244
494 Ga0496126_0187828 3300048929 Bacteria 1752
495 Ga0495678_011416 3300049459 Bacteria 4256
496 Ga0495682_0068128 3300049460 Bacteria 1282
497 Ga0501300_000801 3300049523 Bacteria 4778
498 Ga0501034_0032078 3300049571 Bacteria 5337
499 Ga0501217_002500 3300049661 Unclassified 3627
500 Ga0501217_031740 3300049661 Bacteria 1303
501 Ga0501223_000180 3300049663 Bacteria 16493
502 Ga0501223_000717 3300049663 Bacteria 7903
503 Ga0501247_001377 3300049677 Unclassified 2324
504 Ga0501257_032119 3300049686 Bacteria 1269
505 Ga0501225_0157620 3300049705 Bacteria 696
506 Ga0501241_020478 3300049758 Bacteria 1216
507 Ga0501263_047563 3300049760 Bacteria 645
508 Ga0501279_003985 3300049775 Bacteria 1933
509 nmdc:mga0k408_1182_c2 3300050493 Bacteria 11156
510 nmdc:mga0k408_164047_c1 3300050493 Bacteria 1324
511 nmdc:mga0k408_21723_c1 3300050493 Bacteria 3607
512 nmdc:mga0k408_824_c1 3300050493 Bacteria 17116
513 nmdc:mga08y16_117080_c1 3300050511 Bacteria 2774
514 Ga0500635_0055047 3300053080 Bacteria 1373
515 Ga0500651_0020646 3300053093 Bacteria 4101
516 Ga0500608_005499 3300053122 Bacteria 5046
517 Ga0500618_000013 3300053125 Bacteria 183026
518 Ga0500616_0000015 3300053153 Bacteria 633259
519 Ga0500616_0169303 3300053153 Bacteria 994
520 Ga0500622_0000768 3300053156 Bacteria 27944
521 Ga0500624_000504 3300053157 Bacteria 11390

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10747241 Ga0105245_107472411 166
2 3300042156 Ga0439446_0136796 Ga0439446_0136796_265_780 168
3 3300003320 rootH2_10057459 rootH2_100574597 171
4 3300005289 Ga0065704_10085946 Ga0065704_100859465 171
5 3300025913 Ga0207695_10000013 Ga0207695_10000013243 171
6 3300025935 Ga0207709_10000072 Ga0207709_100000725 171
7 3300032004 Ga0307414_10086977 Ga0307414_100869773 171
8 3300037312 Ga0395899_0255074 Ga0395899_0255074_455_994 171
9 iso_pu_bacteria 2585427687 2586206602 172
10 iso_pu_bacteria 2599185184 2599478354 172
11 iso_pu_bacteria 2738541283 2738754837 172
12 iso_pu_bacteria 2738541284 2738761244 172
13 iso_pu_bacteria 2738541302 2738853897 172
14 iso_pu_bacteria 2738543023 2739304586 172
15 iso_pu_bacteria 2739367651 2739588487 172
16 iso_pu_bacteria 2739367656 2739616142 172
17 iso_pu_bacteria 2739367663 2739645164 172
18 iso_pu_bacteria 2775506987 2776613413 172
19 iso_pu_bacteria 2818991437 2819549838 172
20 iso_pu_bacteria 2842722452 2842723629 172
21 iso_pu_bacteria 2842903701 2842906725 172
22 iso_pu_bacteria 2842909656 2842910135 172
23 iso_pu_bacteria 2849281842 2849284376 172
24 iso_pu_bacteria 2852623160 2852623174 172
25 iso_pu_bacteria 2852627209 2852631951 172
26 iso_pu_bacteria 2857627736 2857631027 172
27 iso_pu_bacteria 2884933994 2884937961 172
28 iso_pu_bacteria 2890737413 2890738246 172
29 iso_pu_bacteria 2890804823 2890807874 172
30 iso_pu_bacteria 2896317667 2896318813 172
31 iso_pu_bacteria 2896344016 2896346765 172
32 iso_pu_bacteria 2898713307 2898715954 172
33 iso_pu_bacteria 2902048731 2902049257 172
34 iso_pu_bacteria 2904445276 2904445772 172
35 iso_pu_bacteria 2904780799 2904782250 172
36 iso_pu_bacteria 2919177583 2919179653 172
37 iso_pu_bacteria 2919186247 2919187074 172
38 iso_pu_bacteria 2919437846 2919442268 172
39 iso_pu_bacteria 2928147474 2928150821 172
40 iso_pu_bacteria 2939664404 2939665657 172
41 iso_pu_bacteria 2945997725 2946000530 172
42 iso_pu_bacteria 2977232053 2977236080 172
43 iso_pu_bacteria 3003233435 3003237128 172
44 iso_pu_bacteria 8055588893 8055588917 172
45 3300044712 Ga0453684_0032119 Ga0453684_0032119_2465_2986 173
46 3300045051 Ga0451576_0283830 Ga0451576_0283830_159_680 173
47 3300002737 JGI25162J39368_1001026 JGI25162J39368_100102613 174
48 3300002772 JGI25164J39214_1003551 JGI25164J39214_10035512 174
49 3300003214 JGI25165J46597_1000694 JGI25165J46597_100069414 174
50 3300005617 Ga0068859_100996033 Ga0068859_1009960332 174
51 3300006931 Ga0097620_100995863 Ga0097620_1009958631 174
52 3300025233 Ga0209437_100008 Ga0209437_100008147 174
53 3300025250 Ga0209026_1027504 Ga0209026_10275041 174
54 3300025261 Ga0209233_1000024 Ga0209233_1000024512 174
55 3300037418 Ga0395900_0208558 Ga0395900_0208558_1162_1710 174
56 iso_pu_bacteria 2954016120 2954017365 174
57 3300003322 rootL2_10122988 rootL2_101229881 175
58 3300003323 rootH1_10020300 rootH1_1002030011 175
59 3300005340 Ga0070689_101258510 Ga0070689_1012585101 175
60 3300005366 Ga0070659_100052411 Ga0070659_1000524112 175
61 3300005466 Ga0070685_10028821 Ga0070685_100288211 175
62 3300005614 Ga0068856_100000935 Ga0068856_10000093518 175
63 3300005843 Ga0068860_100122107 Ga0068860_1001221072 175
64 3300009093 Ga0105240_10190532 Ga0105240_101905322 175
65 3300009545 Ga0105237_10084715 Ga0105237_100847154 175
66 3300010375 Ga0105239_10000586 Ga0105239_1000058630 175
67 3300013102 Ga0157371_10151627 Ga0157371_101516272 175
68 3300013296 Ga0157374_10345422 Ga0157374_103454221 175
69 3300013307 Ga0157372_10000250 Ga0157372_1000025051 175
70 3300025913 Ga0207695_10142414 Ga0207695_101424142 175
71 3300025914 Ga0207671_10049682 Ga0207671_100496824 175
72 3300025932 Ga0207690_10035281 Ga0207690_100352812 175
73 3300025936 Ga0207670_10818463 Ga0207670_108184631 175
74 3300026078 Ga0207702_10003141 Ga0207702_100031413 175
75 3300028381 Ga0268264_10099390 Ga0268264_100993902 175
76 3300028800 Ga0265338_10024738 Ga0265338_100247387 175
77 3300031507 Ga0307509_10331298 Ga0307509_103312981 175
78 3300031712 Ga0265342_10073159 Ga0265342_100731592 175
79 3300031731 Ga0307405_10214521 Ga0307405_102145212 175
80 3300032004 Ga0307414_10335834 Ga0307414_103358342 175
81 3300038443 Ga0395901_0171434 Ga0395901_0171434_822_1349 175
82 3300041456 Ga0451795_0270238 Ga0451795_0270238_165_692 175
83 3300049661 Ga0501217_031740 Ga0501217_031740_40_573 175
84 3300049663 Ga0501223_000180 Ga0501223_000180_12443_12976 175
85 2162886007 SwRhRL2b_contig_1953040 SwRhRL2b_0272.00006790 176
86 2162886007 SwRhRL2b_contig_3746020 SwRhRL2b_0349.00001200 176
87 3300001979 JGI24740J21852_10027594 JGI24740J21852_100275942 176
88 3300001989 JGI24739J22299_10003124 JGI24739J22299_100031243 176
89 3300001990 JGI24737J22298_10000081 JGI24737J22298_1000008118 176
90 3300002067 JGI24735J21928_10000004 JGI24735J21928_1000000480 176
91 3300002737 JGI25162J39368_1000089 JGI25162J39368_10000891 176
92 3300002741 JGI25157J39369_1012911 JGI25157J39369_10129112 176
93 3300002773 JGI25152J39213_1000111 JGI25152J39213_100011151 176
94 3300002774 JGI25150J39212_1000009 JGI25150J39212_1000009141 176
95 3300003187 JGI25151J46595_10000017 JGI25151J46595_10000017141 176
96 3300003215 JGI25153J46596_10000023 JGI25153J46596_1000002398 176
97 3300003316 rootH1_10005699 rootH1_100056993 176
98 3300003316 rootH1_10075429 rootH1_100754293 176
99 3300003316 rootH1_10188739 rootH1_101887391 176
100 3300003320 rootH2_10001891 rootH2_10001891189 176
101 3300003320 rootH2_10004559 rootH2_1000455998 176
102 3300003320 rootH2_10097202 rootH2_100972021 176
103 3300003320 rootH2_10242585 rootH2_102425854 176
104 3300003320 rootH2_10248911 rootH2_102489112 176
105 3300003322 rootL2_10000423 rootL2_1000042336 176
106 3300003322 rootL2_10023987 rootL2_100239877 176
107 3300003322 rootL2_10103496 rootL2_101034968 176
108 3300003322 rootL2_10117027 rootL2_101170275 176
109 3300003322 rootL2_10197573 rootL2_101975732 176
110 3300003322 rootL2_10211968 rootL2_102119682 176
111 3300003322 rootL2_10237433 rootL2_102374332 176
112 3300003323 rootH1_10000380 rootH1_1000038011 176
113 3300003323 rootH1_10002701 rootH1_100027013 176
114 3300003323 rootH1_10037471 rootH1_100374714 176
115 3300003323 rootH1_10076174 rootH1_100761745 176
116 3300003323 rootH1_10204861 rootH1_102048614 176
117 3300003781 Ga0055536_1000003 Ga0055536_1000003360 176
118 3300003791 Ga0055530_10003135 Ga0055530_100031353 176
119 3300003791 Ga0055530_10051576 Ga0055530_100515761 176
120 3300003794 Ga0055531_10000058 Ga0055531_1000005857 176
121 3300004799 Ga0058863_11778257 Ga0058863_117782572 176
122 3300004803 Ga0058862_12758247 Ga0058862_127582472 176
123 3300005288 Ga0065714_10002530 Ga0065714_100025302 176
124 3300005288 Ga0065714_10002817 Ga0065714_1000281714 176
125 3300005288 Ga0065714_10004334 Ga0065714_100043346 176
126 3300005288 Ga0065714_10008852 Ga0065714_100088522 176
127 3300005288 Ga0065714_10065450 Ga0065714_100654502 176
128 3300005288 Ga0065714_10065676 Ga0065714_100656767 176
129 3300005288 Ga0065714_10068853 Ga0065714_100688537 176
130 3300005288 Ga0065714_10101961 Ga0065714_101019612 176
131 3300005288 Ga0065714_10195385 Ga0065714_101953852 176
132 3300005288 Ga0065714_10251702 Ga0065714_102517021 176
133 3300005288 Ga0065714_10288274 Ga0065714_102882741 176
134 3300005289 Ga0065704_10000288 Ga0065704_100002885 176
135 3300005289 Ga0065704_10018848 Ga0065704_100188482 176
136 3300005289 Ga0065704_10083289 Ga0065704_100832894 176
137 3300005289 Ga0065704_10157972 Ga0065704_101579722 176
138 3300005289 Ga0065704_10178827 Ga0065704_101788271 176
139 3300005327 Ga0070658_10000049 Ga0070658_100000496 176
140 3300005327 Ga0070658_10165199 Ga0070658_101651991 176
141 3300005328 Ga0070676_10000563 Ga0070676_100005636 176
142 3300005329 Ga0070683_100626514 Ga0070683_1006265141 176
143 3300005336 Ga0070680_100040500 Ga0070680_1000405002 176
144 3300005338 Ga0068868_100026907 Ga0068868_1000269071 176
145 3300005338 Ga0068868_100812297 Ga0068868_1008122971 176
146 3300005339 Ga0070660_100026708 Ga0070660_1000267082 176
147 3300005339 Ga0070660_100080720 Ga0070660_1000807202 176
148 3300005339 Ga0070660_100106243 Ga0070660_1001062432 176
149 3300005341 Ga0070691_10356766 Ga0070691_103567661 176
150 3300005355 Ga0070671_100007939 Ga0070671_1000079393 176
151 3300005356 Ga0070674_100083649 Ga0070674_1000836492 176
152 3300005364 Ga0070673_100093520 Ga0070673_1000935203 176
153 3300005364 Ga0070673_100652513 Ga0070673_1006525131 176
154 3300005366 Ga0070659_100000432 Ga0070659_1000004325 176
155 3300005366 Ga0070659_100014484 Ga0070659_1000144844 176
156 3300005455 Ga0070663_100084313 Ga0070663_1000843132 176
157 3300005457 Ga0070662_100000045 Ga0070662_10000004535 176
158 3300005459 Ga0068867_100000344 Ga0068867_10000034434 176
159 3300005530 Ga0070679_100352893 Ga0070679_1003528932 176
160 3300005539 Ga0068853_100054716 Ga0068853_1000547163 176
161 3300005539 Ga0068853_100091965 Ga0068853_1000919652 176
162 3300005539 Ga0068853_100273701 Ga0068853_1002737012 176
163 3300005539 Ga0068853_100822244 Ga0068853_1008222441 176
164 3300005548 Ga0070665_100000020 Ga0070665_100000020196 176
165 3300005563 Ga0068855_100000195 Ga0068855_10000019586 176
166 3300005563 Ga0068855_100000988 Ga0068855_10000098814 176
167 3300005563 Ga0068855_100044282 Ga0068855_1000442822 176
168 3300005563 Ga0068855_100094219 Ga0068855_1000942194 176
169 3300005563 Ga0068855_100106546 Ga0068855_1001065465 176
170 3300005563 Ga0068855_100695735 Ga0068855_1006957352 176
171 3300005614 Ga0068856_100013777 Ga0068856_1000137774 176
172 3300005614 Ga0068856_100232393 Ga0068856_1002323932 176
173 3300005616 Ga0068852_100107178 Ga0068852_1001071781 176
174 3300005616 Ga0068852_100196573 Ga0068852_1001965732 176
175 3300005718 Ga0068866_10027440 Ga0068866_100274404 176
176 3300005840 Ga0068870_10097036 Ga0068870_100970363 176
177 3300006195 Ga0075366_10001766 Ga0075366_1000176611 176
178 3300006195 Ga0075366_10003263 Ga0075366_100032638 176
179 3300006195 Ga0075366_10175961 Ga0075366_101759612 176
180 3300006237 Ga0097621_100005555 Ga0097621_1000055558 176
181 3300006358 Ga0068871_100000100 Ga0068871_10000010032 176
182 3300006846 Ga0075430_100662081 Ga0075430_1006620812 176
183 3300006881 Ga0068865_100005711 Ga0068865_1000057118 176
184 3300009036 Ga0105244_10038104 Ga0105244_100381042 176
185 3300009036 Ga0105244_10156571 Ga0105244_101565712 176
186 3300009093 Ga0105240_10000193 Ga0105240_1000019313 176
187 3300009093 Ga0105240_10002893 Ga0105240_100028932 176
188 3300009093 Ga0105240_10008133 Ga0105240_100081337 176
189 3300009093 Ga0105240_10030991 Ga0105240_100309914 176
190 3300009093 Ga0105240_10105032 Ga0105240_101050323 176
191 3300009093 Ga0105240_10162937 Ga0105240_101629373 176
192 3300009093 Ga0105240_11016994 Ga0105240_110169941 176
193 3300009094 Ga0111539_10008369 Ga0111539_100083698 176
194 3300009098 Ga0105245_10060462 Ga0105245_100604625 176
195 3300009098 Ga0105245_10758896 Ga0105245_107588961 176
196 3300009148 Ga0105243_10103104 Ga0105243_101031043 176
197 3300009174 Ga0105241_10000086 Ga0105241_1000008641 176
198 3300009174 Ga0105241_10008186 Ga0105241_100081864 176
199 3300009174 Ga0105241_10034569 Ga0105241_100345696 176
200 3300009174 Ga0105241_10156565 Ga0105241_101565651 176
201 3300009174 Ga0105241_10365578 Ga0105241_103655781 176
202 3300009174 Ga0105241_11017757 Ga0105241_110177571 176
203 3300009176 Ga0105242_10016851 Ga0105242_100168516 176
204 3300009176 Ga0105242_10025626 Ga0105242_100256262 176
205 3300009545 Ga0105237_10002494 Ga0105237_1000249421 176
206 3300009545 Ga0105237_10005037 Ga0105237_1000503714 176
207 3300009545 Ga0105237_10011464 Ga0105237_100114643 176
208 3300009545 Ga0105237_10026888 Ga0105237_100268884 176
209 3300009545 Ga0105237_10045858 Ga0105237_100458582 176
210 3300009545 Ga0105237_10079727 Ga0105237_100797273 176
211 3300009545 Ga0105237_10094863 Ga0105237_100948632 176
212 3300009545 Ga0105237_10268714 Ga0105237_102687142 176
213 3300009551 Ga0105238_10007399 Ga0105238_100073994 176
214 3300009551 Ga0105238_10182444 Ga0105238_101824443 176
215 3300010375 Ga0105239_10000578 Ga0105239_1000057844 176
216 3300010375 Ga0105239_10004569 Ga0105239_100045693 176
217 3300010375 Ga0105239_10007004 Ga0105239_100070048 176
218 3300010375 Ga0105239_10008129 Ga0105239_100081297 176
219 3300010375 Ga0105239_10047030 Ga0105239_100470303 176
220 3300010375 Ga0105239_10082682 Ga0105239_100826822 176
221 3300010375 Ga0105239_10097072 Ga0105239_100970723 176
222 3300010375 Ga0105239_10189692 Ga0105239_101896922 176
223 3300010375 Ga0105239_10205160 Ga0105239_102051602 176
224 3300010375 Ga0105239_10309078 Ga0105239_103090782 176
225 3300013100 Ga0157373_10000041 Ga0157373_1000004177 176
226 3300013100 Ga0157373_10000337 Ga0157373_1000033720 176
227 3300013100 Ga0157373_10028839 Ga0157373_100288394 176
228 3300013100 Ga0157373_10030355 Ga0157373_100303552 176
229 3300013100 Ga0157373_10086529 Ga0157373_100865293 176
230 3300013100 Ga0157373_10135681 Ga0157373_101356812 176
231 3300013100 Ga0157373_10263564 Ga0157373_102635642 176
232 3300013102 Ga0157371_10000009 Ga0157371_100000099 176
233 3300013102 Ga0157371_10000135 Ga0157371_1000013544 176
234 3300013102 Ga0157371_10002029 Ga0157371_100020293 176
235 3300013102 Ga0157371_10004696 Ga0157371_1000469610 176
236 3300013102 Ga0157371_10014439 Ga0157371_100144395 176
237 3300013102 Ga0157371_10015862 Ga0157371_100158626 176
238 3300013102 Ga0157371_10048591 Ga0157371_100485914 176
239 3300013102 Ga0157371_10075092 Ga0157371_100750922 176
240 3300013102 Ga0157371_10483507 Ga0157371_104835072 176
241 3300013102 Ga0157371_10814988 Ga0157371_108149881 176
242 3300013104 Ga0157370_10008331 Ga0157370_100083312 176
243 3300013104 Ga0157370_10017168 Ga0157370_100171689 176
244 3300013104 Ga0157370_10022230 Ga0157370_100222306 176
245 3300013104 Ga0157370_10029541 Ga0157370_100295412 176
246 3300013104 Ga0157370_10047084 Ga0157370_100470844 176
247 3300013104 Ga0157370_10051390 Ga0157370_100513903 176
248 3300013104 Ga0157370_10092087 Ga0157370_100920873 176
249 3300013104 Ga0157370_10166267 Ga0157370_101662673 176
250 3300013104 Ga0157370_10613148 Ga0157370_106131482 176
251 3300013105 Ga0157369_10000006 Ga0157369_10000006231 176
252 3300013105 Ga0157369_10005660 Ga0157369_1000566012 176
253 3300013105 Ga0157369_10019913 Ga0157369_100199133 176
254 3300013105 Ga0157369_10558898 Ga0157369_105588981 176
255 3300013105 Ga0157369_10615316 Ga0157369_106153162 176
256 3300013105 Ga0157369_11265142 Ga0157369_112651422 176
257 3300013296 Ga0157374_10000128 Ga0157374_1000012818 176
258 3300013296 Ga0157374_10000202 Ga0157374_100002026 176
259 3300013296 Ga0157374_10007012 Ga0157374_100070122 176
260 3300013296 Ga0157374_10429317 Ga0157374_104293172 176
261 3300013297 Ga0157378_10004756 Ga0157378_100047566 176
262 3300013297 Ga0157378_10014634 Ga0157378_100146346 176
263 3300013297 Ga0157378_10550504 Ga0157378_105505042 176
264 3300013306 Ga0163162_10000032 Ga0163162_1000003218 176
265 3300013306 Ga0163162_10003807 Ga0163162_1000380714 176
266 3300013306 Ga0163162_10156190 Ga0163162_101561902 176
267 3300013306 Ga0163162_10185627 Ga0163162_101856272 176
268 3300013306 Ga0163162_10334499 Ga0163162_103344992 176
269 3300013306 Ga0163162_10705086 Ga0163162_107050861 176
270 3300013307 Ga0157372_10000017 Ga0157372_10000017145 176
271 3300013307 Ga0157372_10000061 Ga0157372_1000006133 176
272 3300013307 Ga0157372_10003385 Ga0157372_1000338518 176
273 3300013307 Ga0157372_10031266 Ga0157372_100312661 176
274 3300013307 Ga0157372_10047894 Ga0157372_100478943 176
275 3300013307 Ga0157372_10165362 Ga0157372_101653623 176
276 3300013307 Ga0157372_10261689 Ga0157372_102616893 176
277 3300013308 Ga0157375_10008600 Ga0157375_100086005 176
278 3300013308 Ga0157375_10198211 Ga0157375_101982113 176
279 3300014325 Ga0163163_11560809 Ga0163163_115608091 176
280 3300014497 Ga0182008_10000001 Ga0182008_10000001249 176
281 3300014497 Ga0182008_10004035 Ga0182008_100040359 176
282 3300014497 Ga0182008_10012175 Ga0182008_100121754 176
283 3300014497 Ga0182008_10088698 Ga0182008_100886982 176
284 3300014745 Ga0157377_10128216 Ga0157377_101282161 176
285 3300014969 Ga0157376_11633635 Ga0157376_116336351 176
286 3300015261 Ga0182006_1000244 Ga0182006_100024420 176
287 3300015261 Ga0182006_1000646 Ga0182006_10006463 176
288 3300015261 Ga0182006_1004222 Ga0182006_10042225 176
289 3300015261 Ga0182006_1004407 Ga0182006_10044071 176
290 3300015261 Ga0182006_1006216 Ga0182006_10062163 176
291 3300015261 Ga0182006_1093123 Ga0182006_10931232 176
292 3300015262 Ga0182007_10000001 Ga0182007_10000001172 176
293 3300015262 Ga0182007_10070898 Ga0182007_100708981 176
294 3300015262 Ga0182007_10082031 Ga0182007_100820312 176
295 3300015682 Ga0183373_1010 Ga0183373_101022 176
296 3300017792 Ga0163161_10000468 Ga0163161_1000046816 176
297 3300017792 Ga0163161_10000919 Ga0163161_100009192 176
298 3300017792 Ga0163161_10003366 Ga0163161_100033664 176
299 3300017792 Ga0163161_10007612 Ga0163161_100076122 176
300 3300017792 Ga0163161_10061405 Ga0163161_100614052 176
301 3300017792 Ga0163161_10074368 Ga0163161_100743682 176
302 3300017792 Ga0163161_11108622 Ga0163161_111086221 176
303 3300021361 Ga0213872_10048195 Ga0213872_100481952 176
304 3300025233 Ga0209437_100221 Ga0209437_100221107 176
305 3300025245 Ga0207425_1000007 Ga0207425_1000007415 176
306 3300025250 Ga0209026_1000383 Ga0209026_10003834 176
307 3300025250 Ga0209026_1005674 Ga0209026_10056741 176
308 3300025250 Ga0209026_1008704 Ga0209026_10087042 176
309 3300025258 Ga0209129_1000006 Ga0209129_1000006415 176
310 3300025258 Ga0209129_1012982 Ga0209129_10129822 176
311 3300025261 Ga0209233_1001531 Ga0209233_10015314 176
312 3300025261 Ga0209233_1020955 Ga0209233_10209552 176
313 3300025272 Ga0209455_1010452 Ga0209455_10104521 176
314 3300025292 Ga0209676_1000001 Ga0209676_1000001693 176
315 3300025294 Ga0209025_1000025 Ga0209025_1000025245 176
316 3300025297 Ga0209758_1000016 Ga0209758_1000016415 176
317 3300025298 Ga0209050_1000016 Ga0209050_1000016358 176
318 3300025298 Ga0209050_1011974 Ga0209050_10119744 176
319 3300025298 Ga0209050_1030128 Ga0209050_10301282 176
320 3300025302 Ga0207426_1043502 Ga0207426_10435022 176
321 3300025304 Ga0209257_1000007 Ga0209257_10000071229 176
322 3300025899 Ga0207642_10387734 Ga0207642_103877342 176
323 3300025904 Ga0207647_10000105 Ga0207647_1000010537 176
324 3300025904 Ga0207647_10002524 Ga0207647_100025247 176
325 3300025907 Ga0207645_10001210 Ga0207645_100012106 176
326 3300025908 Ga0207643_10104961 Ga0207643_101049612 176
327 3300025909 Ga0207705_10000079 Ga0207705_1000007994 176
328 3300025911 Ga0207654_10001404 Ga0207654_100014047 176
329 3300025911 Ga0207654_10006969 Ga0207654_100069696 176
330 3300025911 Ga0207654_10025621 Ga0207654_100256213 176
331 3300025911 Ga0207654_10296593 Ga0207654_102965932 176
332 3300025912 Ga0207707_10006352 Ga0207707_100063529 176
333 3300025913 Ga0207695_10004447 Ga0207695_100044475 176
334 3300025913 Ga0207695_10013327 Ga0207695_100133272 176
335 3300025913 Ga0207695_10059228 Ga0207695_100592283 176
336 3300025913 Ga0207695_10078483 Ga0207695_100784832 176
337 3300025913 Ga0207695_10118678 Ga0207695_101186783 176
338 3300025914 Ga0207671_10001943 Ga0207671_1000194321 176
339 3300025914 Ga0207671_10003540 Ga0207671_100035403 176
340 3300025914 Ga0207671_10026583 Ga0207671_100265834 176
341 3300025914 Ga0207671_10062493 Ga0207671_100624932 176
342 3300025914 Ga0207671_10073367 Ga0207671_100733672 176
343 3300025917 Ga0207660_10038332 Ga0207660_100383322 176
344 3300025919 Ga0207657_10063077 Ga0207657_100630772 176
345 3300025919 Ga0207657_10065835 Ga0207657_100658353 176
346 3300025921 Ga0207652_10090977 Ga0207652_100909771 176
347 3300025921 Ga0207652_10204581 Ga0207652_102045812 176
348 3300025924 Ga0207694_10108772 Ga0207694_101087722 176
349 3300025924 Ga0207694_10426127 Ga0207694_104261271 176
350 3300025931 Ga0207644_10007769 Ga0207644_100077693 176
351 3300025932 Ga0207690_10000610 Ga0207690_100006105 176
352 3300025933 Ga0207706_10000120 Ga0207706_1000012030 176
353 3300025933 Ga0207706_10500197 Ga0207706_105001971 176
354 3300025934 Ga0207686_10008042 Ga0207686_100080423 176
355 3300025934 Ga0207686_10055303 Ga0207686_100553033 176
356 3300025938 Ga0207704_10000099 Ga0207704_100000993 176
357 3300025949 Ga0207667_10000046 Ga0207667_100000461 176
358 3300025949 Ga0207667_10001052 Ga0207667_100010522 176
359 3300025949 Ga0207667_10115477 Ga0207667_101154773 176
360 3300025949 Ga0207667_10287147 Ga0207667_102871472 176
361 3300025949 Ga0207667_10301528 Ga0207667_103015282 176
362 3300025949 Ga0207667_10412279 Ga0207667_104122792 176
363 3300025949 Ga0207667_10480572 Ga0207667_104805721 176
364 3300025949 Ga0207667_10575087 Ga0207667_105750872 176
365 3300025949 Ga0207667_11158734 Ga0207667_111587342 176
366 3300025960 Ga0207651_10214500 Ga0207651_102145002 176
367 3300025960 Ga0207651_10291006 Ga0207651_102910062 176
368 3300026023 Ga0207677_10044162 Ga0207677_100441622 176
369 3300026041 Ga0207639_10038699 Ga0207639_100386993 176
370 3300026041 Ga0207639_10462656 Ga0207639_104626561 176
371 3300026041 Ga0207639_10660145 Ga0207639_106601452 176
372 3300026067 Ga0207678_10110737 Ga0207678_101107372 176
373 3300026078 Ga0207702_10045811 Ga0207702_100458113 176
374 3300026089 Ga0207648_10011576 Ga0207648_100115764 176
375 3300026121 Ga0207683_10140590 Ga0207683_101405902 176
376 3300026121 Ga0207683_10706708 Ga0207683_107067082 176
377 3300026142 Ga0207698_10272596 Ga0207698_102725962 176
378 3300026142 Ga0207698_10609507 Ga0207698_106095072 176
379 3300027526 Ga0209968_1048157 Ga0209968_10481571 176
380 3300027907 Ga0207428_10216296 Ga0207428_102162961 176
381 3300028379 Ga0268266_10000018 Ga0268266_10000018273 176
382 3300028786 Ga0307517_10003095 Ga0307517_100030955 176
383 3300028794 Ga0307515_10000094 Ga0307515_10000094122 176
384 3300028794 Ga0307515_10000353 Ga0307515_1000035368 176
385 3300028794 Ga0307515_10000859 Ga0307515_1000085960 176
386 3300028794 Ga0307515_10039499 Ga0307515_100394993 176
387 3300028794 Ga0307515_10113784 Ga0307515_101137843 176
388 3300028794 Ga0307515_10139434 Ga0307515_101394342 176
389 3300030731 Ga0316177_1179722 Ga0316177_11797223 176
390 3300030732 Ga0316176_1157629 Ga0316176_11576292 176
391 3300030742 Ga0316183_1027629 Ga0316183_10276293 176
392 3300030744 Ga0316181_1023435 Ga0316181_10234352 176
393 3300030744 Ga0316181_1051627 Ga0316181_105162714 176
394 3300031456 Ga0307513_10078981 Ga0307513_100789812 176
395 3300031456 Ga0307513_10550792 Ga0307513_105507922 176
396 3300031507 Ga0307509_10310740 Ga0307509_103107401 176
397 3300031548 Ga0307408_100002381 Ga0307408_1000023817 176
398 3300031548 Ga0307408_100006190 Ga0307408_1000061903 176
399 3300031548 Ga0307408_100017152 Ga0307408_1000171523 176
400 3300031712 Ga0265342_10076799 Ga0265342_100767992 176
401 3300031727 Ga0316576_10052599 Ga0316576_100525992 176
402 3300031731 Ga0307405_10000010 Ga0307405_10000010158 176
403 3300031731 Ga0307405_10262355 Ga0307405_102623552 176
404 3300031731 Ga0307405_10966005 Ga0307405_109660051 176
405 3300031824 Ga0307413_10133524 Ga0307413_101335242 176
406 3300031903 Ga0307407_10000009 Ga0307407_1000000975 176
407 3300031911 Ga0307412_10000033 Ga0307412_1000003337 176
408 3300031911 Ga0307412_10002746 Ga0307412_100027465 176
409 3300031911 Ga0307412_10159973 Ga0307412_101599733 176
410 3300031911 Ga0307412_10570827 Ga0307412_105708272 176
411 3300031911 Ga0307412_10600544 Ga0307412_106005442 176
412 3300031995 Ga0307409_100454927 Ga0307409_1004549272 176
413 3300032002 Ga0307416_100000019 Ga0307416_100000019120 176
414 3300032002 Ga0307416_100039847 Ga0307416_1000398472 176
415 3300032004 Ga0307414_10000768 Ga0307414_100007683 176
416 3300032004 Ga0307414_10015945 Ga0307414_100159455 176
417 3300032004 Ga0307414_10036368 Ga0307414_100363683 176
418 3300032004 Ga0307414_10044883 Ga0307414_100448833 176
419 3300032004 Ga0307414_10057038 Ga0307414_100570381 176
420 3300032004 Ga0307414_10072788 Ga0307414_100727882 176
421 3300032004 Ga0307414_10864553 Ga0307414_108645532 176
422 3300032004 Ga0307414_11476284 Ga0307414_114762841 176
423 3300032005 Ga0307411_10043126 Ga0307411_100431262 176
424 3300032126 Ga0307415_100022233 Ga0307415_1000222333 176
425 3300033179 Ga0307507_10000362 Ga0307507_1000036216 176
426 3300033180 Ga0307510_10002860 Ga0307510_100028604 176
427 3300035115 Ga0373941_0008478 Ga0373941_0008478_699_1238 176
428 3300037312 Ga0395899_0000002 Ga0395899_0000002_1036821_1037363 176
429 3300037312 Ga0395899_0000493 Ga0395899_0000493_13867_14400 176
430 3300037312 Ga0395899_0000629 Ga0395899_0000629_1417_1953 176
431 3300037312 Ga0395899_0121552 Ga0395899_0121552_1150_1689 176
432 3300037312 Ga0395899_0388527 Ga0395899_0388527_259_801 176
433 3300037418 Ga0395900_0000480 Ga0395900_0000480_46974_47510 176
434 3300037418 Ga0395900_0000506 Ga0395900_0000506_46716_47255 176
435 3300037418 Ga0395900_0095707 Ga0395900_0095707_1382_1921 176
436 3300037418 Ga0395900_0191559 Ga0395900_0191559_1328_1861 176
437 3300037466 Ga0395898_0012125 Ga0395898_0012125_4046_4582 176
438 3300037471 Ga0395905_0001166 Ga0395905_0001166_9410_9949 176
439 3300037471 Ga0395905_0004696 Ga0395905_0004696_9582_10118 176
440 3300038443 Ga0395901_0000853 Ga0395901_0000853_24652_25188 176
441 3300038443 Ga0395901_0002096 Ga0395901_0002096_1759_2298 176
442 3300039447 Ga0436361_1016771 Ga0436361_1016771_2913_3455 176
443 3300041491 Ga0451833_1402693 Ga0451833_1402693_129_659 176
444 3300042005 Ga0439448_0172325 Ga0439448_0172325_144_677 176
445 3300042876 Ga0451577_0042134 Ga0451577_0042134_25_558 176
446 3300042876 Ga0451577_0060228 Ga0451577_0060228_838_1374 176
447 3300044673 Ga0453683_0040722 Ga0453683_0040722_330_866 176
448 3300044684 Ga0466966_0028917 Ga0466966_0028917_1572_2105 176
449 3300044693 Ga0466961_0060846 Ga0466961_0060846_207_740 176
450 3300044706 Ga0466964_0013762 Ga0466964_0013762_2103_2636 176
451 3300044712 Ga0453684_0001421 Ga0453684_0001421_49936_50472 176
452 3300044712 Ga0453684_0013194 Ga0453684_0013194_6538_7113 176
453 3300044712 Ga0453684_0018082 Ga0453684_0018082_7032_7568 176
454 3300044712 Ga0453684_0536959 Ga0453684_0536959_482_1018 176
455 3300044712 Ga0453684_0555366 Ga0453684_0555366_205_735 176
456 3300044712 Ga0453684_0702570 Ga0453684_0702570_473_1006 176
457 3300044712 Ga0453684_1225681 Ga0453684_1225681_28_558 176
458 3300045049 Ga0466959_0036343 Ga0466959_0036343_742_1275 176
459 3300045051 Ga0451576_0051858 Ga0451576_0051858_2792_3322 176
460 3300045051 Ga0451576_0062486 Ga0451576_0062486_1645_2181 176
461 3300045051 Ga0451576_0237784 Ga0451576_0237784_28_558 176
462 3300045051 Ga0451576_0310393 Ga0451576_0310393_317_853 176
463 3300045836 Ga0466958_0281339 Ga0466958_0281339_184_717 176
464 3300046462 Ga0495651_0074069 Ga0495651_0074069_790_1326 176
465 3300046471 Ga0495650_0000132 Ga0495650_0000132_173548_174078 176
466 3300046471 Ga0495650_0032725 Ga0495650_0032725_1277_1819 176
467 3300046471 Ga0495650_0055942 Ga0495650_0055942_1041_1574 176
468 3300046492 Ga0495585_0007009 Ga0495585_0007009_4059_4589 176
469 3300046492 Ga0495585_0018872 Ga0495585_0018872_3276_3842 176
470 3300046506 Ga0495583_0024265 Ga0495583_0024265_278_823 176
471 3300046506 Ga0495583_0111811 Ga0495583_0111811_270_803 176
472 3300046507 Ga0495606_0000052 Ga0495606_0000052_193794_194327 176
473 3300046507 Ga0495606_0039595 Ga0495606_0039595_1298_1831 176
474 3300046507 Ga0495606_0055333 Ga0495606_0055333_355_885 176
475 3300046507 Ga0495606_0150390 Ga0495606_0150390_421_966 176
476 3300046511 Ga0495608_0657234 Ga0495608_0657234_59_595 176
477 3300046512 Ga0495610_0000028 Ga0495610_0000028_154568_155098 176
478 3300046512 Ga0495610_0002790 Ga0495610_0002790_2584_3114 176
479 3300046512 Ga0495610_0007329 Ga0495610_0007329_2027_2560 176
480 3300046513 Ga0495616_0002258 Ga0495616_0002258_10744_11277 176
481 3300046518 Ga0495631_0008558 Ga0495631_0008558_780_1313 176
482 3300046519 Ga0495632_0213220 Ga0495632_0213220_316_846 176
483 3300046520 Ga0495637_0078135 Ga0495637_0078135_700_1230 176
484 3300046523 Ga0495644_0013045 Ga0495644_0013045_728_1261 176
485 3300046524 Ga0495648_0005421 Ga0495648_0005421_1306_1872 176
486 3300046524 Ga0495648_0111319 Ga0495648_0111319_623_1189 176
487 3300046529 Ga0495652_0176037 Ga0495652_0176037_447_983 176
488 3300046529 Ga0495652_0259897 Ga0495652_0259897_514_1050 176
489 3300046529 Ga0495652_0324472 Ga0495652_0324472_442_975 176
490 3300046530 Ga0495654_0057738 Ga0495654_0057738_178_744 176
491 3300046538 Ga0495609_0008958 Ga0495609_0008958_3406_3939 176
492 3300046558 Ga0495633_0000015 Ga0495633_0000015_228436_228978 176
493 3300046558 Ga0495633_0017420 Ga0495633_0017420_859_1392 176
494 3300046616 Ga0495668_0000134 Ga0495668_0000134_100390_100956 176
495 3300046616 Ga0495668_0367189 Ga0495668_0367189_187_732 176
496 3300046648 Ga0495611_0145368 Ga0495611_0145368_307_852 176
497 3300046660 Ga0495625_0000036 Ga0495625_0000036_23749_24282 176
498 3300046660 Ga0495625_0000385 Ga0495625_0000385_52318_52860 176
499 3300046660 Ga0495625_0045319 Ga0495625_0045319_362_928 176
500 3300046660 Ga0495625_0068103 Ga0495625_0068103_1209_1742 176
501 3300046660 Ga0495625_0096836 Ga0495625_0096836_976_1536 176
502 3300046660 Ga0495625_0297104 Ga0495625_0297104_48_587 176
503 3300046660 Ga0495625_0373706 Ga0495625_0373706_330_866 176
504 3300046660 Ga0495625_0526560 Ga0495625_0526560_44_574 176
505 3300046660 Ga0495625_0655433 Ga0495625_0655433_28_570 176
506 3300046665 Ga0495661_0003481 Ga0495661_0003481_7014_7547 176
507 3300046665 Ga0495661_0013574 Ga0495661_0013574_2698_3228 176
508 3300046665 Ga0495661_0455480 Ga0495661_0455480_58_591 176
509 3300046683 Ga0495658_0137911 Ga0495658_0137911_475_1041 176
510 3300046694 Ga0495649_0000017 Ga0495649_0000017_197429_197962 176
511 3300046694 Ga0495649_0031446 Ga0495649_0031446_2196_2726 176
512 3300046809 Ga0495600_0278965 Ga0495600_0278965_380_946 176
513 3300046810 Ga0495660_0024577 Ga0495660_0024577_771_1301 176
514 3300047443 Ga0495687_006934 Ga0495687_006934_2613_3146 176
515 3300047443 Ga0495687_019030 Ga0495687_019030_832_1365 176
516 3300047443 Ga0495687_140429 Ga0495687_140429_157_690 176
517 3300047472 Ga0495686_0001016 Ga0495686_0001016_19379_19924 176
518 3300047472 Ga0495686_0004451 Ga0495686_0004451_6902_7432 176
519 3300047472 Ga0495686_0088508 Ga0495686_0088508_993_1526 176
520 3300047472 Ga0495686_0451054 Ga0495686_0451054_113_658 176
521 3300048089 Ga0495614_0007965 Ga0495614_0007965_2438_3004 176
522 3300048918 Ga0496115_0421152 Ga0496115_0421152_241_771 176
523 3300048918 Ga0496115_0928643 Ga0496115_0928643_73_606 176
524 3300048920 Ga0496117_0003502 Ga0496117_0003502_14580_15113 176
525 3300048921 Ga0496118_0034888 Ga0496118_0034888_1271_1804 176
526 3300048925 Ga0496122_0134452 Ga0496122_0134452_50_583 176
527 3300048926 Ga0496123_0012094 Ga0496123_0012094_4292_4825 176
528 3300048926 Ga0496123_0023603 Ga0496123_0023603_685_1215 176
529 3300048927 Ga0496124_0062742 Ga0496124_0062742_1605_2138 176
530 3300048928 Ga0496125_0093490 Ga0496125_0093490_361_894 176
531 3300048929 Ga0496126_0187828 Ga0496126_0187828_10_543 176
532 3300049459 Ga0495678_011416 Ga0495678_011416_1921_2484 176
533 3300049460 Ga0495682_0068128 Ga0495682_0068128_658_1224 176
534 3300049523 Ga0501300_000801 Ga0501300_000801_1250_1783 176
535 3300049571 Ga0501034_0032078 Ga0501034_0032078_766_1317 176
536 3300049661 Ga0501217_002500 Ga0501217_002500_1537_2070 176
537 3300049663 Ga0501223_000717 Ga0501223_000717_3583_4116 176
538 3300049677 Ga0501247_001377 Ga0501247_001377_1741_2274 176
539 3300049686 Ga0501257_032119 Ga0501257_032119_646_1176 176
540 3300049705 Ga0501225_0157620 Ga0501225_0157620_26_559 176
541 3300049758 Ga0501241_020478 Ga0501241_020478_141_671 176
542 3300049760 Ga0501263_047563 Ga0501263_047563_43_588 176
543 3300049775 Ga0501279_003985 Ga0501279_003985_660_1190 176
544 3300050493 nmdc:mga0k408_1182_c2 nmdc:mga0k408_1182_c2_1302_1844 176
545 3300050493 nmdc:mga0k408_164047_c1 nmdc:mga0k408_164047_c1_586_1119 176
546 3300050493 nmdc:mga0k408_21723_c1 nmdc:mga0k408_21723_c1_329_859 176
547 3300050493 nmdc:mga0k408_824_c1 nmdc:mga0k408_824_c1_12125_12658 176
548 3300050511 nmdc:mga08y16_117080_c1 nmdc:mga08y16_117080_c1_1009_1548 176
549 3300053080 Ga0500635_0055047 Ga0500635_0055047_530_1072 176
550 3300053093 Ga0500651_0020646 Ga0500651_0020646_1850_2380 176
551 3300053122 Ga0500608_005499 Ga0500608_005499_4118_4648 176
552 3300053125 Ga0500618_000013 Ga0500618_000013_131712_132242 176
553 3300053153 Ga0500616_0000015 Ga0500616_0000015_552361_552891 176
554 3300053153 Ga0500616_0169303 Ga0500616_0169303_244_783 176
555 3300053156 Ga0500622_0000768 Ga0500622_0000768_13215_13748 176
556 3300053157 Ga0500624_000504 Ga0500624_000504_9025_9558 176
557 iso_pu_bacteria 2928078545 2928080596 176
558 iso_pu_bacteria 2932082852 2932083022 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

54

198

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qiu-assembly1.cif.gz_B ysga 23s rna methyltransferase from bacillus subtilis 0.9344 26 171
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.925 25 173
2i6d-assembly1.cif.gz_A the structure of a putative rna methyltransferase of the trmh family from porphyromonas gingivalis. 0.9055 25 170
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.8978 25 174
1v2x-assembly1.cif.gz_A-2 trmh 0.8944 14 173
ID Description Score Start End Superfamily
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9463 24 174 3.40.1280.10
af_Q2FZE0_99_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9368 26 171 3.40.1280.10
af_Q54XF8_1505_1680_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9226 19 173 3.40.1280.10
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9224 25 176 3.40.1280.10
af_A0A0G2JYA7_1418_1569_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9197 26 173 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A519W263-F1-model_v4 TrmH family RNA methyltransferase 0.9949 1 176 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1Q5ZZ49-F1-model_v4 tRNA/rRNA methyltransferase SpoU type domain-containing protein 0.9945 1 175 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A3B9FR95-F1-model_v4 RNA methyltransferase 0.9945 1 175 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7X9D5R9-F1-model_v4 RNA methyltransferase 0.9942 1 174 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A6E8P1-F1-model_v4 Putative SpoU rRNA methylase family protein 0.994 1 176 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.18 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map