F463351

General Info

Members Datasets Scaffolds Average Seq Length
557 284 1114 138

Family's Representative Sequence

Representative Sequence 3300047673|Ga0495593_0043547|Ga0495593_0043547_1960_2394
Length 144
Sequence MAKKKVAAIVKIQIPAGAATPAPPVGTALGPHGVAIMDFCKAYNAQTESQRGTIVPVEITVFEDRSFTFILKTPPTPVLLRQAAGLEKGSTTPGKAIVGSVSEDQIEEIAKIKMPDLTAADLDAAVRTIAGSARSMGVTVEGMK

Samples

Sample ID Description Type Environment
1 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
167 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
168 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
169 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
178 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
179 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
180 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 2.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.59
Nodule 0
Rhizoplane 12.03
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495593_0043547 3300047673 Bacteria 2405
2 Ga0058862_12609327 3300004803 Bacteria 800
3 Ga0070676_10063472 3300005328 Bacteria 2200
4 Ga0070683_100406266 3300005329 Bacteria 1299
5 Ga0070690_100042513 3300005330 Bacteria 2879
6 Ga0070690_100308944 3300005330 Bacteria 1136
7 Ga0068869_100373152 3300005334 Bacteria 1168
8 Ga0070666_10277609 3300005335 Bacteria 1190
9 Ga0070666_10639337 3300005335 Bacteria 778
10 Ga0068868_100270152 3300005338 Bacteria 1436
11 Ga0070660_100996509 3300005339 Bacteria 708
12 Ga0070689_100909826 3300005340 Bacteria 779
13 Ga0070687_100023870 3300005343 Bacteria 2911
14 Ga0070668_100908021 3300005347 Bacteria 788
15 Ga0070669_100098544 3300005353 Bacteria 2202
16 Ga0070675_100835654 3300005354 Bacteria 842
17 Ga0070671_100016903 3300005355 Bacteria 5900
18 Ga0070671_100434002 3300005355 Bacteria 1126
19 Ga0070671_100657482 3300005355 Bacteria 908
20 Ga0070671_101141168 3300005355 Bacteria 685
21 Ga0070674_100081905 3300005356 Bacteria 2307
22 Ga0070674_100311306 3300005356 Bacteria 1259
23 Ga0070674_100639603 3300005356 Bacteria 903
24 Ga0070673_100094857 3300005364 Bacteria 2446
25 Ga0070673_100364797 3300005364 Bacteria 1285
26 Ga0070659_100654684 3300005366 Bacteria 906
27 Ga0070659_101690686 3300005366 Bacteria 566
28 Ga0070667_100204274 3300005367 Bacteria 1754
29 Ga0070667_100351926 3300005367 Bacteria 1334
30 Ga0070667_101521361 3300005367 Bacteria 629
31 Ga0070713_102202816 3300005436 Bacteria 534
32 Ga0070710_10486005 3300005437 Bacteria 843
33 Ga0070705_100604694 3300005440 Bacteria 849
34 Ga0070700_100320276 3300005441 Bacteria 1139
35 Ga0070700_100351518 3300005441 Bacteria 1093
36 Ga0070678_100316314 3300005456 Bacteria 1332
37 Ga0070678_100423695 3300005456 Bacteria 1161
38 Ga0070678_101242751 3300005456 Bacteria 692
39 Ga0070662_100058308 3300005457 Bacteria 2809
40 Ga0068867_100297881 3300005459 Bacteria 1329
41 Ga0070706_100172787 3300005467 Bacteria 2018
42 Ga0070706_100778823 3300005467 Bacteria 886
43 Ga0070699_102171910 3300005518 Bacteria 507
44 Ga0070697_100700099 3300005536 Bacteria 894
45 Ga0070672_100164985 3300005543 Bacteria 1840
46 Ga0070672_100283687 3300005543 Bacteria 1401
47 Ga0070686_100098253 3300005544 Bacteria 1972
48 Ga0070665_101066427 3300005548 Bacteria 820
49 Ga0070664_101987208 3300005564 Bacteria 552
50 Ga0068857_100971074 3300005577 Bacteria 817
51 Ga0068854_100476030 3300005578 Bacteria 1048
52 Ga0070702_100153242 3300005615 Bacteria 1482
53 Ga0070702_100259849 3300005615 Bacteria 1182
54 Ga0068852_100763192 3300005616 Bacteria 980
55 Ga0068859_100159050 3300005617 Bacteria 2338
56 Ga0068859_100360105 3300005617 Bacteria 1550
57 Ga0068859_100506204 3300005617 Bacteria 1303
58 Ga0068866_10024707 3300005718 Bacteria 2815
59 Ga0068866_10496434 3300005718 Bacteria 807
60 Ga0068861_100075232 3300005719 Bacteria 2628
61 Ga0068870_10238195 3300005840 Bacteria 1122
62 Ga0068870_10937516 3300005840 Bacteria 614
63 Ga0068858_100198862 3300005842 Bacteria 1895
64 Ga0068858_101166702 3300005842 Bacteria 757
65 Ga0068860_100008087 3300005843 Bacteria 10473
66 Ga0068860_100235520 3300005843 Bacteria 1780
67 Ga0068860_100342142 3300005843 Bacteria 1471
68 Ga0068860_100796021 3300005843 Bacteria 958
69 Ga0068860_102117595 3300005843 Bacteria 584
70 Ga0068862_100568115 3300005844 Bacteria 1085
71 Ga0068862_100649420 3300005844 Bacteria 1017
72 Ga0070717_10595711 3300006028 Bacteria 1003
73 Ga0075365_10079862 3300006038 Bacteria 2214
74 Ga0075365_10218676 3300006038 Bacteria 1336
75 Ga0075365_10234341 3300006038 Bacteria 1289
76 Ga0075365_10790757 3300006038 Bacteria 670
77 Ga0075368_10103014 3300006042 Bacteria 1173
78 Ga0075368_10484382 3300006042 Bacteria 551
79 Ga0075363_100117882 3300006048 Bacteria 1480
80 Ga0075363_100246334 3300006048 Bacteria 1028
81 Ga0075363_100388905 3300006048 Bacteria 818
82 Ga0075364_10049356 3300006051 Bacteria 2744
83 Ga0075364_10075620 3300006051 Bacteria 2222
84 Ga0075364_10090097 3300006051 Bacteria 2034
85 Ga0075364_10111152 3300006051 Bacteria 1829
86 Ga0075364_10250209 3300006051 Bacteria 1204
87 Ga0075364_10443821 3300006051 Bacteria 886
88 Ga0075362_10032900 3300006177 Bacteria 2253
89 Ga0075362_10036829 3300006177 Bacteria 2142
90 Ga0075362_10201514 3300006177 Bacteria 969
91 Ga0075367_10184110 3300006178 Bacteria 1302
92 Ga0075367_10233708 3300006178 Bacteria 1151
93 Ga0075367_10281069 3300006178 Bacteria 1046
94 Ga0075367_10312149 3300006178 Bacteria 990
95 Ga0075366_10126790 3300006195 Bacteria 1539
96 Ga0097621_100612076 3300006237 Bacteria 996
97 Ga0075370_10287228 3300006353 Bacteria 977
98 Ga0068871_100122540 3300006358 Bacteria 2198
99 Ga0075428_101601263 3300006844 Bacteria 681
100 Ga0075430_101405034 3300006846 Bacteria 574
101 Ga0075434_101386408 3300006871 Bacteria 713
102 Ga0068865_100341148 3300006881 Bacteria 1211
103 Ga0068865_100747166 3300006881 Bacteria 840
104 Ga0097620_100159039 3300006931 Bacteria 2338
105 Ga0097620_100360105 3300006931 Bacteria 1550
106 Ga0097620_100506191 3300006931 Bacteria 1303
107 Ga0075435_101741099 3300007076 Bacteria 547
108 Ga0111539_10773940 3300009094 Bacteria 1117
109 Ga0111539_12346503 3300009094 Bacteria 619
110 Ga0111539_12675076 3300009094 Bacteria 578
111 Ga0105245_10006900 3300009098 Bacteria 9956
112 Ga0105245_10017684 3300009098 Bacteria 6223
113 Ga0105245_10325376 3300009098 Bacteria 1516
114 Ga0105245_10568256 3300009098 Bacteria 1157
115 Ga0105245_10637057 3300009098 Bacteria 1095
116 Ga0105247_10391022 3300009101 Bacteria 988
117 Ga0105247_10594146 3300009101 Bacteria 820
118 Ga0114129_10421166 3300009147 Bacteria 1756
119 Ga0114129_10908411 3300009147 Bacteria 1115
120 Ga0105243_10352089 3300009148 Bacteria 1353
121 Ga0105243_10503767 3300009148 Bacteria 1148
122 Ga0105241_10088992 3300009174 Bacteria 2432
123 Ga0105242_10081898 3300009176 Bacteria 2700
124 Ga0105242_10182883 3300009176 Bacteria 1850
125 Ga0105242_10691310 3300009176 Bacteria 997
126 Ga0105242_11871770 3300009176 Bacteria 640
127 Ga0105248_10484821 3300009177 Bacteria 1394
128 Ga0105237_11977084 3300009545 Bacteria 591
129 Ga0105238_10709497 3300009551 Bacteria 1018
130 Ga0105238_11144515 3300009551 Bacteria 802
131 Ga0105249_10064898 3300009553 Bacteria 3357
132 Ga0105249_10544909 3300009553 Bacteria 1210
133 Ga0105249_10858567 3300009553 Bacteria 973
134 Ga0105239_10689186 3300010375 Bacteria 1168
135 Ga0105246_10319657 3300011119 Bacteria 1261
136 Ga0157374_10977800 3300013296 Bacteria 865
137 Ga0157378_10043171 3300013297 Bacteria 4003
138 Ga0157378_10384829 3300013297 Bacteria 1378
139 Ga0157378_10454150 3300013297 Bacteria 1272
140 Ga0157378_10541047 3300013297 Bacteria 1169
141 Ga0157378_10734619 3300013297 Bacteria 1009
142 Ga0157378_10893009 3300013297 Bacteria 919
143 Ga0157378_12435476 3300013297 Bacteria 575
144 Ga0163162_10139209 3300013306 Bacteria 2539
145 Ga0163162_10591202 3300013306 Bacteria 1236
146 Ga0163162_11014965 3300013306 Bacteria 938
147 Ga0157375_10278867 3300013308 Bacteria 1834
148 Ga0157375_10440964 3300013308 Bacteria 1468
149 Ga0157375_11290512 3300013308 Bacteria 858
150 Ga0157375_11372932 3300013308 Bacteria 832
151 Ga0157375_12269051 3300013308 Bacteria 647
152 Ga0163163_10039385 3300014325 Bacteria 4612
153 Ga0163163_13234139 3300014325 Bacteria 508
154 Ga0157380_10370459 3300014326 Bacteria 1348
155 Ga0157380_10435713 3300014326 Bacteria 1254
156 Ga0157380_10496494 3300014326 Bacteria 1184
157 Ga0157380_10866022 3300014326 Bacteria 926
158 Ga0157377_10070241 3300014745 Bacteria 2022
159 Ga0157377_10282784 3300014745 Bacteria 1088
160 Ga0157379_10128243 3300014968 Bacteria 2283
161 Ga0157376_10715582 3300014969 Bacteria 1008
162 Ga0163161_10376649 3300017792 Bacteria 1133
163 Ga0163161_11901983 3300017792 Bacteria 529
164 Ga0206356_10629910 3300020070 Bacteria 1798
165 Ga0206356_11813653 3300020070 Bacteria 758
166 Ga0206351_10344480 3300020077 Bacteria 962
167 Ga0206352_10865557 3300020078 Bacteria 1330
168 Ga0206353_10271050 3300020082 Bacteria 789
169 Ga0206353_11764579 3300020082 Bacteria 669
170 Ga0213872_10304001 3300021361 Bacteria 662
171 Ga0213874_10459687 3300021377 Bacteria 504
172 Ga0213876_10055616 3300021384 Bacteria 2089
173 Ga0224712_10011825 3300022467 Bacteria 2722
174 Ga0207666_1001834 3300025271 Bacteria 2526
175 Ga0207697_10013185 3300025315 Bacteria 3451
176 Ga0207642_10166230 3300025899 Bacteria 1189
177 Ga0207710_10038980 3300025900 Bacteria 2102
178 Ga0207680_10389452 3300025903 Bacteria 984
179 Ga0207645_10086736 3300025907 Bacteria 2011
180 Ga0207643_10889078 3300025908 Bacteria 577
181 Ga0207684_10097313 3300025910 Bacteria 2512
182 Ga0207684_11746663 3300025910 Bacteria 500
183 Ga0207654_11029744 3300025911 Bacteria 599
184 Ga0207662_10044199 3300025918 Bacteria 2629
185 Ga0207662_10414421 3300025918 Bacteria 916
186 Ga0207662_10776419 3300025918 Bacteria 674
187 Ga0207681_10305937 3300025923 Bacteria 1259
188 Ga0207681_10484204 3300025923 Bacteria 1011
189 Ga0207694_10402880 3300025924 Bacteria 1138
190 Ga0207650_10803153 3300025925 Bacteria 797
191 Ga0207659_10519903 3300025926 Bacteria 1009
192 Ga0207687_10001228 3300025927 Bacteria 17549
193 Ga0207687_10006698 3300025927 Bacteria 7599
194 Ga0207687_10488666 3300025927 Bacteria 1026
195 Ga0207687_10710616 3300025927 Bacteria 853
196 Ga0207687_11153246 3300025927 Bacteria 666
197 Ga0207644_10356507 3300025931 Bacteria 1189
198 Ga0207644_11478775 3300025931 Bacteria 570
199 Ga0207690_10250986 3300025932 Bacteria 1367
200 Ga0207690_10414478 3300025932 Bacteria 1077
201 Ga0207690_10514116 3300025932 Bacteria 970
202 Ga0207706_10084135 3300025933 Bacteria 2797
203 Ga0207686_10073689 3300025934 Bacteria 2203
204 Ga0207686_10218545 3300025934 Bacteria 1374
205 Ga0207686_10423584 3300025934 Bacteria 1019
206 Ga0207686_10471222 3300025934 Bacteria 969
207 Ga0207709_10192669 3300025935 Bacteria 1449
208 Ga0207709_10605784 3300025935 Bacteria 868
209 Ga0207670_10093054 3300025936 Bacteria 2135
210 Ga0207670_10446115 3300025936 Bacteria 1042
211 Ga0207670_10553698 3300025936 Bacteria 940
212 Ga0207669_10154669 3300025937 Bacteria 1611
213 Ga0207669_10204240 3300025937 Bacteria 1437
214 Ga0207665_10378043 3300025939 Bacteria 1074
215 Ga0207665_10680238 3300025939 Bacteria 808
216 Ga0207691_10351373 3300025940 Bacteria 1261
217 Ga0207691_10705410 3300025940 Bacteria 851
218 Ga0207711_10186278 3300025941 Bacteria 1890
219 Ga0207689_10272311 3300025942 Bacteria 1402
220 Ga0207661_10651415 3300025944 Bacteria 968
221 Ga0207679_10415683 3300025945 Bacteria 1186
222 Ga0207651_10157544 3300025960 Bacteria 1776
223 Ga0207651_10436339 3300025960 Bacteria 1121
224 Ga0207712_10316140 3300025961 Bacteria 1287
225 Ga0207658_10252915 3300025986 Bacteria 1498
226 Ga0207658_10511144 3300025986 Bacteria 1071
227 Ga0207677_10673459 3300026023 Bacteria 915
228 Ga0207703_10036418 3300026035 Bacteria 3916
229 Ga0207703_10110985 3300026035 Bacteria 2340
230 Ga0207703_10174963 3300026035 Bacteria 1891
231 Ga0207703_10375023 3300026035 Bacteria 1315
232 Ga0207703_10571947 3300026035 Bacteria 1067
233 Ga0207703_10637021 3300026035 Bacteria 1010
234 Ga0207639_10986838 3300026041 Bacteria 789
235 Ga0207708_10150254 3300026075 Bacteria 1833
236 Ga0207708_10282650 3300026075 Bacteria 1345
237 Ga0207641_10086747 3300026088 Bacteria 2730
238 Ga0207641_11562403 3300026088 Bacteria 662
239 Ga0207648_10054354 3300026089 Bacteria 3498
240 Ga0207676_10442165 3300026095 Bacteria 1224
241 Ga0207676_10645845 3300026095 Bacteria 1021
242 Ga0207674_10495498 3300026116 Bacteria 1180
243 Ga0207675_100082167 3300026118 Bacteria 3021
244 Ga0207675_100137677 3300026118 Bacteria 2318
245 Ga0207683_10119842 3300026121 Bacteria 2361
246 Ga0207683_10232687 3300026121 Bacteria 1681
247 Ga0207683_10612647 3300026121 Bacteria 1008
248 Ga0207683_11305621 3300026121 Bacteria 672
249 Ga0207698_10073974 3300026142 Bacteria 2715
250 Ga0207698_10377964 3300026142 Bacteria 1347
251 Ga0209813_10039978 3300027866 Bacteria 1423
252 Ga0209813_10231955 3300027866 Bacteria 695
253 Ga0209974_10042900 3300027876 Bacteria 1507
254 Ga0268266_10244637 3300028379 Bacteria 1657
255 Ga0268266_10330922 3300028379 Bacteria 1428
256 Ga0268266_10601017 3300028379 Bacteria 1057
257 Ga0268266_10826081 3300028379 Bacteria 895
258 Ga0268266_11200016 3300028379 Bacteria 734
259 Ga0268265_10277225 3300028380 Bacteria 1499
260 Ga0268265_10492240 3300028380 Bacteria 1154
261 Ga0268265_10853473 3300028380 Bacteria 891
262 Ga0268264_10010875 3300028381 Bacteria 7518
263 Ga0268264_10141490 3300028381 Bacteria 2146
264 Ga0268264_10387436 3300028381 Bacteria 1340
265 Ga0268264_11420347 3300028381 Bacteria 705
266 Ga0307517_10529932 3300028786 Bacteria 593
267 Ga0265338_10353118 3300028800 Bacteria 1057
268 Ga0316576_10371447 3300031727 Bacteria 1063
269 Ga0307405_10321490 3300031731 Bacteria 1182
270 Ga0307405_10754431 3300031731 Bacteria 811
271 Ga0307413_10299362 3300031824 Bacteria 1219
272 Ga0307410_10595794 3300031852 Bacteria 921
273 Ga0307406_10331152 3300031901 Bacteria 1182
274 Ga0307406_11326603 3300031901 Bacteria 629
275 Ga0307407_10115534 3300031903 Bacteria 1692
276 Ga0307407_10951761 3300031903 Bacteria 661
277 Ga0307409_100025613 3300031995 Bacteria 4141
278 Ga0307409_101679882 3300031995 Bacteria 664
279 Ga0307416_100009228 3300032002 Bacteria 6439
280 Ga0307416_100476717 3300032002 Bacteria 1307
281 Ga0307414_10270384 3300032004 Bacteria 1423
282 Ga0307415_100431197 3300032126 Bacteria 1134
283 Ga0307415_101068365 3300032126 Bacteria 754
284 Ga0307415_101806950 3300032126 Bacteria 591
285 Ga0373948_0015086 3300034817 Bacteria 1415
286 Ga0373928_0001367 3300035084 Bacteria 4783
287 Ga0373929_0000604 3300035085 Bacteria 6942
288 Ga0373929_0041426 3300035085 Bacteria 1024
289 Ga0373932_0003739 3300035112 Bacteria 3633
290 Ga0373939_0160157 3300035114 Bacteria 826
291 Ga0373954_0222421 3300035118 Bacteria 929
292 Ga0373956_0298883 3300035119 Bacteria 767
293 Ga0373960_0322650 3300035121 Bacteria 579
294 Ga0316574_0133124 3300035398 Bacteria 1600
295 Ga0316574_0341551 3300035398 Bacteria 948
296 Ga0373931_0000003 3300035691 Bacteria 560286
297 Ga0373931_0001947 3300035691 Bacteria 9058
298 Ga0373931_0414111 3300035691 Bacteria 856
299 Ga0373937_0073895 3300036401 Bacteria 3145
300 Ga0316584_0126949 3300036712 Bacteria 1905
301 Ga0400483_202180 3300039062 Bacteria 2969
302 Ga0436365_1137434 3300039437 Bacteria 5368
303 Ga0436361_0178404 3300039447 Bacteria 868
304 Ga0436362_0693949 3300039453 Bacteria 3199
305 Ga0436362_0932145 3300039453 Bacteria 1090
306 Ga0439453_0018945 3300041408 Bacteria 1222
307 Ga0439465_0079038 3300041413 Bacteria 1113
308 Ga0451791_0639629 3300041451 Bacteria 586
309 Ga0451791_0865680 3300041451 Bacteria 754
310 Ga0451791_0868306 3300041451 Bacteria 629
311 Ga0451793_0417597 3300041452 Bacteria 970
312 Ga0451804_1031380 3300041463 Bacteria 864
313 Ga0451807_0434820 3300041486 Bacteria 538
314 Ga0451807_2406453 3300041486 Bacteria 531
315 Ga0451807_2731120 3300041486 Bacteria 543
316 Ga0451839_0120088 3300041496 Bacteria 502
317 Ga0451851_0650377 3300041507 Bacteria 732
318 Ga0451853_2209806 3300041512 Bacteria 969
319 Ga0451853_2621366 3300041512 Bacteria 608
320 Ga0451853_3302951 3300041512 Bacteria 747
321 Ga0450921_021419 3300042123 Bacteria 617
322 Ga0450923_022982 3300042125 Bacteria 1227
323 Ga0450907_051728 3300042146 Bacteria 707
324 Ga0450910_042429 3300042147 Bacteria 737
325 Ga0439434_0120801 3300042435 Bacteria 854
326 Ga0451577_0042457 3300042876 Bacteria 4079
327 Ga0466966_0037552 3300044684 Bacteria 3123
328 Ga0466963_0273797 3300044694 Bacteria 1186
329 Ga0453684_0083932 3300044712 Bacteria 3963
330 Ga0466959_0990283 3300045049 Bacteria 560
331 Ga0466958_0263997 3300045836 Bacteria 1102
332 Ga0466967_0198997 3300045976 Bacteria 1897
333 Ga0495592_0095294 3300046454 Bacteria 2129
334 Ga0495603_0361638 3300046455 Bacteria 833
335 Ga0495603_0599074 3300046455 Bacteria 631
336 Ga0495629_0638032 3300046459 Bacteria 710
337 Ga0495641_0393627 3300046461 Bacteria 628
338 Ga0495651_0005682 3300046462 Bacteria 9506
339 Ga0495653_0024528 3300046463 Bacteria 4859
340 Ga0495653_0084133 3300046463 Bacteria 2344
341 Ga0495608_0065191 3300046511 Bacteria 2386
342 Ga0495618_0578735 3300046514 Bacteria 670
343 Ga0495630_0063945 3300046517 Bacteria 2764
344 Ga0495630_0805910 3300046517 Bacteria 717
345 Ga0495640_0102471 3300046533 Bacteria 1878
346 Ga0495645_0424619 3300046543 Bacteria 843
347 Ga0495667_0015268 3300046559 Bacteria 5186
348 Ga0495634_0021845 3300046642 Bacteria 4516
349 Ga0495635_0090592 3300046663 Bacteria 2092
350 Ga0495657_0017051 3300046675 Bacteria 5279
351 Ga0495623_0030026 3300046679 Bacteria 3498
352 Ga0495658_0509303 3300046683 Bacteria 770
353 Ga0495613_0001886 3300046689 Bacteria 15917
354 Ga0495613_0391112 3300046689 Bacteria 950
355 Ga0495624_0384862 3300046690 Bacteria 843
356 Ga0495600_0028453 3300046809 Bacteria 3616
357 Ga0495600_0327353 3300046809 Bacteria 963
358 Ga0495604_0580604 3300047317 Bacteria 720
359 Ga0495680_0005429 3300047322 Bacteria 12002
360 Ga0495675_0019093 3300047444 Bacteria 4355
361 Ga0495602_0090181 3300048088 Bacteria 2547
362 Ga0495614_0189396 3300048089 Bacteria 928
363 Ga0496100_0179991 3300048903 Bacteria 1528
364 Ga0496100_0299294 3300048903 Bacteria 1204
365 Ga0496101_0085477 3300048904 Bacteria 2338
366 Ga0496101_0211807 3300048904 Bacteria 1501
367 Ga0496102_0123792 3300048905 Bacteria 2416
368 Ga0496102_0172050 3300048905 Bacteria 2039
369 Ga0496102_0895323 3300048905 Bacteria 809
370 Ga0496102_0924163 3300048905 Bacteria 794
371 Ga0496103_0171817 3300048906 Bacteria 1392
372 Ga0496103_0809382 3300048906 Bacteria 591
373 Ga0496104_0033646 3300048907 Bacteria 4777
374 Ga0496104_0075790 3300048907 Bacteria 3203
375 Ga0496104_0750006 3300048907 Bacteria 883
376 Ga0496105_0042968 3300048908 Bacteria 3727
377 Ga0496105_0120878 3300048908 Bacteria 2160
378 Ga0496105_0277045 3300048908 Bacteria 1353
379 Ga0496105_0319837 3300048908 Bacteria 1244
380 Ga0496106_0417391 3300048909 Bacteria 1078
381 Ga0496106_0628808 3300048909 Bacteria 859
382 Ga0496107_0019988 3300048910 Bacteria 4729
383 Ga0496108_0131111 3300048911 Bacteria 2155
384 Ga0496108_0135592 3300048911 Bacteria 2118
385 Ga0496108_0304848 3300048911 Bacteria 1388
386 Ga0496108_0403239 3300048911 Bacteria 1194
387 Ga0496108_0433410 3300048911 Bacteria 1148
388 Ga0496108_1088341 3300048911 Bacteria 680
389 Ga0496109_0049518 3300048912 Bacteria 3825
390 Ga0496109_0086255 3300048912 Bacteria 2899
391 Ga0496109_0215136 3300048912 Bacteria 1807
392 Ga0496109_0264732 3300048912 Bacteria 1620
393 Ga0496109_0522944 3300048912 Bacteria 1120
394 Ga0496109_0972168 3300048912 Bacteria 787
395 Ga0496110_0059558 3300048913 Bacteria 3366
396 Ga0496110_0074267 3300048913 Bacteria 3019
397 Ga0496110_0108394 3300048913 Bacteria 2493
398 Ga0496110_0146370 3300048913 Bacteria 2137
399 Ga0496110_0386011 3300048913 Bacteria 1276
400 Ga0496110_0664676 3300048913 Bacteria 942
401 Ga0496110_0887311 3300048913 Bacteria 797
402 Ga0496110_1209300 3300048913 Bacteria 665
403 Ga0496110_1510717 3300048913 Bacteria 581
404 Ga0496111_0020571 3300048914 Bacteria 4595
405 Ga0496111_0040468 3300048914 Bacteria 3343
406 Ga0496111_0264988 3300048914 Bacteria 1275
407 Ga0496111_0426553 3300048914 Bacteria 979
408 Ga0496111_0428337 3300048914 Bacteria 977
409 Ga0496111_0695499 3300048914 Bacteria 740
410 Ga0496111_0780720 3300048914 Bacteria 692
411 Ga0496113_0595948 3300048916 Bacteria 885
412 Ga0496113_0648646 3300048916 Bacteria 844
413 Ga0496114_0003529 3300048917 Bacteria 12000
414 Ga0496114_0082581 3300048917 Bacteria 2716
415 Ga0496114_0114440 3300048917 Bacteria 2313
416 Ga0496114_0274504 3300048917 Bacteria 1486
417 Ga0496114_0396800 3300048917 Bacteria 1222
418 Ga0496114_0522511 3300048917 Bacteria 1050
419 Ga0496114_0987127 3300048917 Bacteria 725
420 Ga0496115_0057029 3300048918 Bacteria 3141
421 Ga0496115_1254958 3300048918 Bacteria 554
422 Ga0501307_081034 3300049162 Bacteria 530
423 Ga0501320_045000 3300049536 Bacteria 588
424 Ga0501031_0071900 3300049568 Bacteria 2252
425 Ga0501031_0116166 3300049568 Bacteria 1748
426 Ga0501032_0040790 3300049569 Bacteria 3154
427 Ga0501032_0560228 3300049569 Bacteria 728
428 Ga0501033_0155044 3300049570 Bacteria 1651
429 Ga0501034_0117170 3300049571 Bacteria 2651
430 Ga0501034_0120395 3300049571 Bacteria 2611
431 Ga0501034_0716649 3300049571 Bacteria 898
432 Ga0501034_1484231 3300049571 Bacteria 552
433 Ga0501034_1609631 3300049571 Bacteria 522
434 Ga0501036_0044526 3300049572 Bacteria 3759
435 Ga0501036_0159567 3300049572 Bacteria 1902
436 Ga0501036_0213734 3300049572 Bacteria 1620
437 Ga0501036_0217401 3300049572 Bacteria 1605
438 Ga0501039_0242776 3300049575 Bacteria 1416
439 Ga0501039_0538678 3300049575 Bacteria 916
440 Ga0501039_0547436 3300049575 Bacteria 908
441 Ga0501039_0763524 3300049575 Bacteria 755
442 Ga0501040_0054999 3300049576 Bacteria 2729
443 Ga0501040_0206910 3300049576 Bacteria 1394
444 Ga0501041_0089424 3300049577 Bacteria 1901
445 Ga0501041_0186623 3300049577 Bacteria 1299
446 Ga0501041_0334350 3300049577 Bacteria 956
447 Ga0501042_0018333 3300049578 Bacteria 4844
448 Ga0501042_0055119 3300049578 Bacteria 2836
449 Ga0501042_0668728 3300049578 Bacteria 755
450 Ga0501043_0096088 3300049579 Bacteria 2329
451 Ga0501046_0218958 3300049580 Bacteria 1410
452 Ga0501048_0067526 3300049582 Bacteria 2527
453 Ga0501048_0134269 3300049582 Bacteria 1748
454 Ga0501048_0186037 3300049582 Bacteria 1472
455 Ga0501048_0323125 3300049582 Bacteria 1099
456 Ga0501067_0295999 3300049583 Bacteria 901
457 Ga0501068_0667333 3300049584 Bacteria 679
458 Ga0501069_0503478 3300049585 Bacteria 723
459 Ga0501070_0067856 3300049586 Bacteria 2953
460 Ga0501071_0093587 3300049587 Bacteria 2210
461 Ga0501071_0218403 3300049587 Bacteria 1434
462 Ga0501071_0252874 3300049587 Bacteria 1330
463 Ga0501071_0397556 3300049587 Bacteria 1052
464 Ga0501071_1187300 3300049587 Bacteria 589
465 Ga0501072_0105946 3300049588 Bacteria 2236
466 Ga0501072_0106525 3300049588 Bacteria 2230
467 Ga0501072_0156941 3300049588 Bacteria 1814
468 Ga0501072_0611306 3300049588 Bacteria 859
469 Ga0501072_0827551 3300049588 Bacteria 724
470 Ga0501073_0281365 3300049589 Bacteria 1148
471 Ga0501073_0361325 3300049589 Bacteria 1003
472 Ga0501073_0612779 3300049589 Bacteria 752
473 Ga0501074_0267645 3300049590 Bacteria 1215
474 Ga0501074_0360205 3300049590 Bacteria 1032
475 Ga0501074_0456644 3300049590 Bacteria 906
476 Ga0501074_0809560 3300049590 Bacteria 660
477 Ga0501075_0137819 3300049591 Bacteria 1859
478 Ga0501075_0298937 3300049591 Bacteria 1226
479 Ga0501075_0847324 3300049591 Bacteria 695
480 Ga0501076_0158366 3300049592 Bacteria 1844
481 Ga0501076_0824086 3300049592 Bacteria 765
482 Ga0501079_0625412 3300049741 Bacteria 847
483 Ga0501079_0929976 3300049741 Bacteria 685
484 Ga0501080_0054028 3300049742 Bacteria 3741
485 Ga0501080_0513278 3300049742 Bacteria 1070
486 Ga0501080_0987471 3300049742 Bacteria 731
487 Ga0501080_1010708 3300049742 Bacteria 721
488 Ga0501080_1103096 3300049742 Bacteria 685
489 Ga0501081_0109092 3300049743 Bacteria 1963
490 Ga0501081_0565763 3300049743 Bacteria 850
491 Ga0501083_0173948 3300049744 Bacteria 1407
492 Ga0501083_0779588 3300049744 Bacteria 622
493 Ga0501083_0829541 3300049744 Bacteria 602
494 Ga0501035_0071951 3300049822 Bacteria 3061
495 Ga0501035_0521570 3300049822 Bacteria 976
496 Ga0501044_0005604 3300049823 Bacteria 13944
497 Ga0501044_0071524 3300049823 Bacteria 3527
498 Ga0501044_0753309 3300049823 Bacteria 856
499 Ga0501044_0806647 3300049823 Bacteria 818
500 Ga0501045_0093020 3300049824 Bacteria 2230
501 Ga0501045_0196933 3300049824 Bacteria 1501
502 Ga0501045_0239207 3300049824 Bacteria 1352
503 Ga0501045_0448728 3300049824 Bacteria 959
504 nmdc:mga03683_169397_c1 3300050489 Bacteria 992
505 nmdc:mga03683_52793_c1 3300050489 Bacteria 1700
506 nmdc:mga03683_560230_c1 3300050489 Bacteria 557
507 nmdc:mga03n38_106830_c1 3300050490 Bacteria 1358
508 nmdc:mga03n38_260161_c1 3300050490 Bacteria 920
509 nmdc:mga03n38_73169_c1 3300050490 Bacteria 1591
510 nmdc:mga00v17_13821_c1 3300050491 Bacteria 4490
511 nmdc:mga00v17_183393_c1 3300050491 Bacteria 1351
512 nmdc:mga00v17_18935_c1 3300050491 Bacteria 3920
513 nmdc:mga00v17_305938_c1 3300050491 Bacteria 1033
514 nmdc:mga00v17_39368_c1 3300050491 Bacteria 2831
515 nmdc:mga00v17_51873_c1 3300050491 Bacteria 2494
516 nmdc:mga00v17_78388_c1 3300050491 Bacteria 2059
517 nmdc:mga00v17_786620_c1 3300050491 Bacteria 607
518 nmdc:mga0yw44_137476_c1 3300050492 Bacteria 1586
519 nmdc:mga0yw44_197757_c1 3300050492 Bacteria 1327
520 nmdc:mga0yw44_246374_c1 3300050492 Bacteria 963
521 nmdc:mga0yw44_307165_c1 3300050492 Bacteria 1063
522 nmdc:mga0yw44_49721_c1 3300050492 Bacteria 2532
523 nmdc:mga0yw44_87203_c1 3300050492 Bacteria 1967
524 nmdc:mga0k408_205590_c1 3300050493 Bacteria 1175
525 nmdc:mga06z11_234223_c1 3300050494 Bacteria 1077
526 nmdc:mga06z11_257312_c1 3300050494 Bacteria 1029
527 nmdc:mga06z11_286417_c1 3300050494 Bacteria 977
528 nmdc:mga06z11_59886_c1 3300050494 Bacteria 1980
529 nmdc:mga06z11_66401_c1 3300050494 Bacteria 1896
530 nmdc:mga06z11_725037_c1 3300050494 Bacteria 606
531 nmdc:mga04h51_212655_c1 3300050495 Bacteria 764
532 nmdc:mga07m45_57398_c1 3300050496 Bacteria 2201
533 nmdc:mga07m45_83567_c1 3300050496 Bacteria 1825
534 nmdc:mga05p37_2005815_c1 3300050507 Bacteria 547
535 nmdc:mga05p37_573617_c1 3300050507 Bacteria 1279
536 nmdc:mga09592_285000_c1 3300050508 Bacteria 1432
537 nmdc:mga06r32_674825_c1 3300050510 Bacteria 1000
538 nmdc:mga0n895_1364393_c1 3300050512 Bacteria 678
539 nmdc:mga0a205_350209_c1 3300050515 Bacteria 1344
540 Ga0495601_0254913 3300053077 Bacteria 1146
541 Ga0495595_0100564 3300053084 Bacteria 1395
542 Ga0495619_0017532 3300053085 Bacteria 4535
543 Ga0495619_0715513 3300053085 Bacteria 680
544 Ga0500566_0000081 3300053094 Bacteria 47157
545 Ga0500568_0022504 3300053139 Bacteria 2694
546 Ga0500616_0000171 3300053153 Bacteria 108118
547 Ga0501084_0806524 3300054114 Bacteria 790
548 Ga0587084_108287 3300059477 Bacteria 571
549 Ga0587080_085527 3300059503 Bacteria 654
550 Ga0587082_109585 3300059504 Bacteria 612
551 Ga0501082_0371591 3300060353 Bacteria 1247
552 Ga0501082_0414292 3300060353 Bacteria 1176
553 Ga0501082_0945407 3300060353 Bacteria 754
554 Ga0501082_0991395 3300060353 Bacteria 735
555 Ga0501082_1277593 3300060353 Bacteria 641
556 Ga0530510_0138372 3300061734 Bacteria 1793
557 Ga0530510_0738077 3300061734 Bacteria 751
558 Ga0495593_0043547
559 Ga0058862_12609327
560 Ga0070676_10063472
561 Ga0070683_100406266
562 Ga0070690_100042513
563 Ga0070690_100308944
564 Ga0068869_100373152
565 Ga0070666_10277609
566 Ga0070666_10639337
567 Ga0068868_100270152
568 Ga0070660_100996509
569 Ga0070689_100909826
570 Ga0070687_100023870
571 Ga0070668_100908021
572 Ga0070669_100098544
573 Ga0070675_100835654
574 Ga0070671_100016903
575 Ga0070671_100434002
576 Ga0070671_100657482
577 Ga0070671_101141168
578 Ga0070674_100081905
579 Ga0070674_100311306
580 Ga0070674_100639603
581 Ga0070673_100094857
582 Ga0070673_100364797
583 Ga0070659_100654684
584 Ga0070659_101690686
585 Ga0070667_100204274
586 Ga0070667_100351926
587 Ga0070667_101521361
588 Ga0070713_102202816
589 Ga0070710_10486005
590 Ga0070705_100604694
591 Ga0070700_100320276
592 Ga0070700_100351518
593 Ga0070678_100316314
594 Ga0070678_100423695
595 Ga0070678_101242751
596 Ga0070662_100058308
597 Ga0068867_100297881
598 Ga0070706_100172787
599 Ga0070706_100778823
600 Ga0070699_102171910
601 Ga0070697_100700099
602 Ga0070672_100164985
603 Ga0070672_100283687
604 Ga0070686_100098253
605 Ga0070665_101066427
606 Ga0070664_101987208
607 Ga0068857_100971074
608 Ga0068854_100476030
609 Ga0070702_100153242
610 Ga0070702_100259849
611 Ga0068852_100763192
612 Ga0068859_100159050
613 Ga0068859_100360105
614 Ga0068859_100506204
615 Ga0068866_10024707
616 Ga0068866_10496434
617 Ga0068861_100075232
618 Ga0068870_10238195
619 Ga0068870_10937516
620 Ga0068858_100198862
621 Ga0068858_101166702
622 Ga0068860_100008087
623 Ga0068860_100235520
624 Ga0068860_100342142
625 Ga0068860_100796021
626 Ga0068860_102117595
627 Ga0068862_100568115
628 Ga0068862_100649420
629 Ga0070717_10595711
630 Ga0075365_10079862
631 Ga0075365_10218676
632 Ga0075365_10234341
633 Ga0075365_10790757
634 Ga0075368_10103014
635 Ga0075368_10484382
636 Ga0075363_100117882
637 Ga0075363_100246334
638 Ga0075363_100388905
639 Ga0075364_10049356
640 Ga0075364_10075620
641 Ga0075364_10090097
642 Ga0075364_10111152
643 Ga0075364_10250209
644 Ga0075364_10443821
645 Ga0075362_10032900
646 Ga0075362_10036829
647 Ga0075362_10201514
648 Ga0075367_10184110
649 Ga0075367_10233708
650 Ga0075367_10281069
651 Ga0075367_10312149
652 Ga0075366_10126790
653 Ga0097621_100612076
654 Ga0075370_10287228
655 Ga0068871_100122540
656 Ga0075428_101601263
657 Ga0075430_101405034
658 Ga0075434_101386408
659 Ga0068865_100341148
660 Ga0068865_100747166
661 Ga0097620_100159039
662 Ga0097620_100360105
663 Ga0097620_100506191
664 Ga0075435_101741099
665 Ga0111539_10773940
666 Ga0111539_12346503
667 Ga0111539_12675076
668 Ga0105245_10006900
669 Ga0105245_10017684
670 Ga0105245_10325376
671 Ga0105245_10568256
672 Ga0105245_10637057
673 Ga0105247_10391022
674 Ga0105247_10594146
675 Ga0114129_10421166
676 Ga0114129_10908411
677 Ga0105243_10352089
678 Ga0105243_10503767
679 Ga0105241_10088992
680 Ga0105242_10081898
681 Ga0105242_10182883
682 Ga0105242_10691310
683 Ga0105242_11871770
684 Ga0105248_10484821
685 Ga0105237_11977084
686 Ga0105238_10709497
687 Ga0105238_11144515
688 Ga0105249_10064898
689 Ga0105249_10544909
690 Ga0105249_10858567
691 Ga0105239_10689186
692 Ga0105246_10319657
693 Ga0157374_10977800
694 Ga0157378_10043171
695 Ga0157378_10384829
696 Ga0157378_10454150
697 Ga0157378_10541047
698 Ga0157378_10734619
699 Ga0157378_10893009
700 Ga0157378_12435476
701 Ga0163162_10139209
702 Ga0163162_10591202
703 Ga0163162_11014965
704 Ga0157375_10278867
705 Ga0157375_10440964
706 Ga0157375_11290512
707 Ga0157375_11372932
708 Ga0157375_12269051
709 Ga0163163_10039385
710 Ga0163163_13234139
711 Ga0157380_10370459
712 Ga0157380_10435713
713 Ga0157380_10496494
714 Ga0157380_10866022
715 Ga0157377_10070241
716 Ga0157377_10282784
717 Ga0157379_10128243
718 Ga0157376_10715582
719 Ga0163161_10376649
720 Ga0163161_11901983
721 Ga0206356_10629910
722 Ga0206356_11813653
723 Ga0206351_10344480
724 Ga0206352_10865557
725 Ga0206353_10271050
726 Ga0206353_11764579
727 Ga0213872_10304001
728 Ga0213874_10459687
729 Ga0213876_10055616
730 Ga0224712_10011825
731 Ga0207666_1001834
732 Ga0207697_10013185
733 Ga0207642_10166230
734 Ga0207710_10038980
735 Ga0207680_10389452
736 Ga0207645_10086736
737 Ga0207643_10889078
738 Ga0207684_10097313
739 Ga0207684_11746663
740 Ga0207654_11029744
741 Ga0207662_10044199
742 Ga0207662_10414421
743 Ga0207662_10776419
744 Ga0207681_10305937
745 Ga0207681_10484204
746 Ga0207694_10402880
747 Ga0207650_10803153
748 Ga0207659_10519903
749 Ga0207687_10001228
750 Ga0207687_10006698
751 Ga0207687_10488666
752 Ga0207687_10710616
753 Ga0207687_11153246
754 Ga0207644_10356507
755 Ga0207644_11478775
756 Ga0207690_10250986
757 Ga0207690_10414478
758 Ga0207690_10514116
759 Ga0207706_10084135
760 Ga0207686_10073689
761 Ga0207686_10218545
762 Ga0207686_10423584
763 Ga0207686_10471222
764 Ga0207709_10192669
765 Ga0207709_10605784
766 Ga0207670_10093054
767 Ga0207670_10446115
768 Ga0207670_10553698
769 Ga0207669_10154669
770 Ga0207669_10204240
771 Ga0207665_10378043
772 Ga0207665_10680238
773 Ga0207691_10351373
774 Ga0207691_10705410
775 Ga0207711_10186278
776 Ga0207689_10272311
777 Ga0207661_10651415
778 Ga0207679_10415683
779 Ga0207651_10157544
780 Ga0207651_10436339
781 Ga0207712_10316140
782 Ga0207658_10252915
783 Ga0207658_10511144
784 Ga0207677_10673459
785 Ga0207703_10036418
786 Ga0207703_10110985
787 Ga0207703_10174963
788 Ga0207703_10375023
789 Ga0207703_10571947
790 Ga0207703_10637021
791 Ga0207639_10986838
792 Ga0207708_10150254
793 Ga0207708_10282650
794 Ga0207641_10086747
795 Ga0207641_11562403
796 Ga0207648_10054354
797 Ga0207676_10442165
798 Ga0207676_10645845
799 Ga0207674_10495498
800 Ga0207675_100082167
801 Ga0207675_100137677
802 Ga0207683_10119842
803 Ga0207683_10232687
804 Ga0207683_10612647
805 Ga0207683_11305621
806 Ga0207698_10073974
807 Ga0207698_10377964
808 Ga0209813_10039978
809 Ga0209813_10231955
810 Ga0209974_10042900
811 Ga0268266_10244637
812 Ga0268266_10330922
813 Ga0268266_10601017
814 Ga0268266_10826081
815 Ga0268266_11200016
816 Ga0268265_10277225
817 Ga0268265_10492240
818 Ga0268265_10853473
819 Ga0268264_10010875
820 Ga0268264_10141490
821 Ga0268264_10387436
822 Ga0268264_11420347
823 Ga0307517_10529932
824 Ga0265338_10353118
825 Ga0316576_10371447
826 Ga0307405_10321490
827 Ga0307405_10754431
828 Ga0307413_10299362
829 Ga0307410_10595794
830 Ga0307406_10331152
831 Ga0307406_11326603
832 Ga0307407_10115534
833 Ga0307407_10951761
834 Ga0307409_100025613
835 Ga0307409_101679882
836 Ga0307416_100009228
837 Ga0307416_100476717
838 Ga0307414_10270384
839 Ga0307415_100431197
840 Ga0307415_101068365
841 Ga0307415_101806950
842 Ga0373948_0015086
843 Ga0373928_0001367
844 Ga0373929_0000604
845 Ga0373929_0041426
846 Ga0373932_0003739
847 Ga0373939_0160157
848 Ga0373954_0222421
849 Ga0373956_0298883
850 Ga0373960_0322650
851 Ga0316574_0133124
852 Ga0316574_0341551
853 Ga0373931_0000003
854 Ga0373931_0001947
855 Ga0373931_0414111
856 Ga0373937_0073895
857 Ga0316584_0126949
858 Ga0400483_202180
859 Ga0436365_1137434
860 Ga0436361_0178404
861 Ga0436362_0693949
862 Ga0436362_0932145
863 Ga0439453_0018945
864 Ga0439465_0079038
865 Ga0451791_0639629
866 Ga0451791_0865680
867 Ga0451791_0868306
868 Ga0451793_0417597
869 Ga0451804_1031380
870 Ga0451807_0434820
871 Ga0451807_2406453
872 Ga0451807_2731120
873 Ga0451839_0120088
874 Ga0451851_0650377
875 Ga0451853_2209806
876 Ga0451853_2621366
877 Ga0451853_3302951
878 Ga0450921_021419
879 Ga0450923_022982
880 Ga0450907_051728
881 Ga0450910_042429
882 Ga0439434_0120801
883 Ga0451577_0042457
884 Ga0466966_0037552
885 Ga0466963_0273797
886 Ga0453684_0083932
887 Ga0466959_0990283
888 Ga0466958_0263997
889 Ga0466967_0198997
890 Ga0495592_0095294
891 Ga0495603_0361638
892 Ga0495603_0599074
893 Ga0495629_0638032
894 Ga0495641_0393627
895 Ga0495651_0005682
896 Ga0495653_0024528
897 Ga0495653_0084133
898 Ga0495608_0065191
899 Ga0495618_0578735
900 Ga0495630_0063945
901 Ga0495630_0805910
902 Ga0495640_0102471
903 Ga0495645_0424619
904 Ga0495667_0015268
905 Ga0495634_0021845
906 Ga0495635_0090592
907 Ga0495657_0017051
908 Ga0495623_0030026
909 Ga0495658_0509303
910 Ga0495613_0001886
911 Ga0495613_0391112
912 Ga0495624_0384862
913 Ga0495600_0028453
914 Ga0495600_0327353
915 Ga0495604_0580604
916 Ga0495680_0005429
917 Ga0495675_0019093
918 Ga0495602_0090181
919 Ga0495614_0189396
920 Ga0496100_0179991
921 Ga0496100_0299294
922 Ga0496101_0085477
923 Ga0496101_0211807
924 Ga0496102_0123792
925 Ga0496102_0172050
926 Ga0496102_0895323
927 Ga0496102_0924163
928 Ga0496103_0171817
929 Ga0496103_0809382
930 Ga0496104_0033646
931 Ga0496104_0075790
932 Ga0496104_0750006
933 Ga0496105_0042968
934 Ga0496105_0120878
935 Ga0496105_0277045
936 Ga0496105_0319837
937 Ga0496106_0417391
938 Ga0496106_0628808
939 Ga0496107_0019988
940 Ga0496108_0131111
941 Ga0496108_0135592
942 Ga0496108_0304848
943 Ga0496108_0403239
944 Ga0496108_0433410
945 Ga0496108_1088341
946 Ga0496109_0049518
947 Ga0496109_0086255
948 Ga0496109_0215136
949 Ga0496109_0264732
950 Ga0496109_0522944
951 Ga0496109_0972168
952 Ga0496110_0059558
953 Ga0496110_0074267
954 Ga0496110_0108394
955 Ga0496110_0146370
956 Ga0496110_0386011
957 Ga0496110_0664676
958 Ga0496110_0887311
959 Ga0496110_1209300
960 Ga0496110_1510717
961 Ga0496111_0020571
962 Ga0496111_0040468
963 Ga0496111_0264988
964 Ga0496111_0426553
965 Ga0496111_0428337
966 Ga0496111_0695499
967 Ga0496111_0780720
968 Ga0496113_0595948
969 Ga0496113_0648646
970 Ga0496114_0003529
971 Ga0496114_0082581
972 Ga0496114_0114440
973 Ga0496114_0274504
974 Ga0496114_0396800
975 Ga0496114_0522511
976 Ga0496114_0987127
977 Ga0496115_0057029
978 Ga0496115_1254958
979 Ga0501307_081034
980 Ga0501320_045000
981 Ga0501031_0071900
982 Ga0501031_0116166
983 Ga0501032_0040790
984 Ga0501032_0560228
985 Ga0501033_0155044
986 Ga0501034_0117170
987 Ga0501034_0120395
988 Ga0501034_0716649
989 Ga0501034_1484231
990 Ga0501034_1609631
991 Ga0501036_0044526
992 Ga0501036_0159567
993 Ga0501036_0213734
994 Ga0501036_0217401
995 Ga0501039_0242776
996 Ga0501039_0538678
997 Ga0501039_0547436
998 Ga0501039_0763524
999 Ga0501040_0054999
1000 Ga0501040_0206910
1001 Ga0501041_0089424
1002 Ga0501041_0186623
1003 Ga0501041_0334350
1004 Ga0501042_0018333
1005 Ga0501042_0055119
1006 Ga0501042_0668728
1007 Ga0501043_0096088
1008 Ga0501046_0218958
1009 Ga0501048_0067526
1010 Ga0501048_0134269
1011 Ga0501048_0186037
1012 Ga0501048_0323125
1013 Ga0501067_0295999
1014 Ga0501068_0667333
1015 Ga0501069_0503478
1016 Ga0501070_0067856
1017 Ga0501071_0093587
1018 Ga0501071_0218403
1019 Ga0501071_0252874
1020 Ga0501071_0397556
1021 Ga0501071_1187300
1022 Ga0501072_0105946
1023 Ga0501072_0106525
1024 Ga0501072_0156941
1025 Ga0501072_0611306
1026 Ga0501072_0827551
1027 Ga0501073_0281365
1028 Ga0501073_0361325
1029 Ga0501073_0612779
1030 Ga0501074_0267645
1031 Ga0501074_0360205
1032 Ga0501074_0456644
1033 Ga0501074_0809560
1034 Ga0501075_0137819
1035 Ga0501075_0298937
1036 Ga0501075_0847324
1037 Ga0501076_0158366
1038 Ga0501076_0824086
1039 Ga0501079_0625412
1040 Ga0501079_0929976
1041 Ga0501080_0054028
1042 Ga0501080_0513278
1043 Ga0501080_0987471
1044 Ga0501080_1010708
1045 Ga0501080_1103096
1046 Ga0501081_0109092
1047 Ga0501081_0565763
1048 Ga0501083_0173948
1049 Ga0501083_0779588
1050 Ga0501083_0829541
1051 Ga0501035_0071951
1052 Ga0501035_0521570
1053 Ga0501044_0005604
1054 Ga0501044_0071524
1055 Ga0501044_0753309
1056 Ga0501044_0806647
1057 Ga0501045_0093020
1058 Ga0501045_0196933
1059 Ga0501045_0239207
1060 Ga0501045_0448728
1061 nmdc:mga03683_169397_c1
1062 nmdc:mga03683_52793_c1
1063 nmdc:mga03683_560230_c1
1064 nmdc:mga03n38_106830_c1
1065 nmdc:mga03n38_260161_c1
1066 nmdc:mga03n38_73169_c1
1067 nmdc:mga00v17_13821_c1
1068 nmdc:mga00v17_183393_c1
1069 nmdc:mga00v17_18935_c1
1070 nmdc:mga00v17_305938_c1
1071 nmdc:mga00v17_39368_c1
1072 nmdc:mga00v17_51873_c1
1073 nmdc:mga00v17_78388_c1
1074 nmdc:mga00v17_786620_c1
1075 nmdc:mga0yw44_137476_c1
1076 nmdc:mga0yw44_197757_c1
1077 nmdc:mga0yw44_246374_c1
1078 nmdc:mga0yw44_307165_c1
1079 nmdc:mga0yw44_49721_c1
1080 nmdc:mga0yw44_87203_c1
1081 nmdc:mga0k408_205590_c1
1082 nmdc:mga06z11_234223_c1
1083 nmdc:mga06z11_257312_c1
1084 nmdc:mga06z11_286417_c1
1085 nmdc:mga06z11_59886_c1
1086 nmdc:mga06z11_66401_c1
1087 nmdc:mga06z11_725037_c1
1088 nmdc:mga04h51_212655_c1
1089 nmdc:mga07m45_57398_c1
1090 nmdc:mga07m45_83567_c1
1091 nmdc:mga05p37_2005815_c1
1092 nmdc:mga05p37_573617_c1
1093 nmdc:mga09592_285000_c1
1094 nmdc:mga06r32_674825_c1
1095 nmdc:mga0n895_1364393_c1
1096 nmdc:mga0a205_350209_c1
1097 Ga0495601_0254913
1098 Ga0495595_0100564
1099 Ga0495619_0017532
1100 Ga0495619_0715513
1101 Ga0500566_0000081
1102 Ga0500568_0022504
1103 Ga0500616_0000171
1104 Ga0501084_0806524
1105 Ga0587084_108287
1106 Ga0587080_085527
1107 Ga0587082_109585
1108 Ga0501082_0371591
1109 Ga0501082_0414292
1110 Ga0501082_0945407
1111 Ga0501082_0991395
1112 Ga0501082_1277593
1113 Ga0530510_0138372
1114 Ga0530510_0738077

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

72

140

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

10

67

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.993 72 141
1y39-assembly2.cif.gz_B co-evolution of protein and rna structures within a highly conserved ribosomal domain 0.9923 72 141
1hc8-assembly2.cif.gz_B crystal structure of a conserved ribosomal protein-rna complex 0.9889 72 141
5gae-assembly1.cif.gz_J rnc in complex with a translocating secyeg 0.9807 72 141
1mms-assembly2.cif.gz_B crystal structure of the ribosomal protein l11-rna complex 0.9791 72 141
ID Description Score Start End Superfamily
af_I1J9L7_135_215_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9948 73 140 1.10.10.250
af_A0A0R0HHB6_82_164_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9719 99 140 1.10.10.250
1vq4I00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9716 73 141 1.10.10.250
af_P54030_78_161_1.10.10.250 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9713 82 140 1.10.10.250
2qa4I02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Ribosomal protein L11/L12, C-terminal domain 0.9642 74 134 1.10.10.250
ID Description Score Start End GO Terms
AF-A0A7C3NAE7-F1-model_v4 50S ribosomal protein L11 1.002 78 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A496M9P7-F1-model_v4 deleted 1 72 141
AF-A0A2S7TEL3-F1-model_v4 deleted 0.9984 74 141
AF-A0A356V906-F1-model_v4 50S ribosomal protein L11 0.9982 73 141 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-D6SXA2-F1-model_v4 deleted 0.9967 80 141

Map