F463309

General Info

Members Datasets Scaffolds Average Seq Length
557 309 534 155

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10006522|Ga0157371_1000652211
Length 181
Sequence MPSLCPVAVALAIGAVIAMFRVMSVAFTREEDLEATAADLADRPISPHPNLVTPEGLAAIEAELASARAAYTAAQVQGSIESDRTAMARATRDLRYWSARRASAQLVAPTEDDGVVRFGGSVSIERDDGRAQTWRIVGEDEADPAAGSVSHVSPLARAVIGKRVGDEVTVAGQSAEIVAVG

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
4 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
5 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
6 2643221584 Caulobacter sp. Root656 Isolate Unclassified
7 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
8 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
9 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
10 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
11 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
12 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
13 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
14 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
15 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
20 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
21 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
22 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
196 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
217 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
253 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
285 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
286 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
289 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
290 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
293 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
294 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
295 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
301 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
304 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0.54
Isolates 4.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.82
Nodule 0.36
Rhizoplane 4.85
Rhizosphere 75.04
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10051182 3300003215 Bacteria 1184
2 rootL2_10077638 3300003322 Bacteria 2241
3 rootL2_10077639 3300003322 Bacteria 1312
4 Ga0006562J51391_1091438 3300003578 Bacteria 12093
5 Ga0006562J51391_1091439 3300003578 Bacteria 11750
6 Ga0055524_1008397 3300003775 Bacteria 4294
7 Ga0055536_1001525 3300003781 Bacteria 13899
8 Ga0055536_1019991 3300003781 Bacteria 2085
9 Ga0055536_1053718 3300003781 Bacteria 870
10 Ga0055530_10000148 3300003791 Bacteria 63227
11 Ga0055531_10008457 3300003794 Bacteria 5419
12 Ga0055531_10022227 3300003794 Bacteria 2425
13 Ga0055531_10073438 3300003794 Bacteria 779
14 Ga0065165_1001734 3300005262 Bacteria 21806
15 Ga0065165_1021762 3300005262 Bacteria 2217
16 Ga0070658_10182545 3300005327 Bacteria 1766
17 Ga0070658_11167315 3300005327 Bacteria 670
18 Ga0070683_100280840 3300005329 Bacteria 1584
19 Ga0070683_101265911 3300005329 Unclassified 709
20 Ga0070670_100065510 3300005331 Bacteria 3117
21 Ga0070670_101815265 3300005331 Unclassified 561
22 Ga0070666_10057739 3300005335 Bacteria 2623
23 Ga0070680_100029103 3300005336 Bacteria 4436
24 Ga0070680_100271719 3300005336 Bacteria 1435
25 Ga0070682_100184566 3300005337 Bacteria 1460
26 Ga0070660_100008830 3300005339 Bacteria 7065
27 Ga0070660_100053765 3300005339 Bacteria 3107
28 Ga0070660_100290864 3300005339 Unclassified 1338
29 Ga0070660_100329941 3300005339 Unclassified 1254
30 Ga0070660_100458878 3300005339 Bacteria 1058
31 Ga0070691_10000826 3300005341 Bacteria 12446
32 Ga0070691_10098329 3300005341 Bacteria 1451
33 Ga0070661_100572328 3300005344 Bacteria 911
34 Ga0070661_100664694 3300005344 Bacteria 847
35 Ga0070668_100000232 3300005347 Bacteria 36360
36 Ga0070668_100000734 3300005347 Bacteria 22404
37 Ga0070668_100003407 3300005347 Bacteria 11738
38 Ga0070668_100011657 3300005347 Bacteria 6543
39 Ga0070668_100103145 3300005347 Bacteria 2263
40 Ga0070668_100116099 3300005347 Unclassified 2134
41 Ga0070669_100357328 3300005353 Bacteria 1187
42 Ga0070669_100748027 3300005353 Bacteria 828
43 Ga0070675_100411185 3300005354 Unclassified 1208
44 Ga0070671_100023883 3300005355 Bacteria 5003
45 Ga0070671_100285054 3300005355 Bacteria 1405
46 Ga0070673_100564532 3300005364 Bacteria 1035
47 Ga0070659_100000010 3300005366 Bacteria 188277
48 Ga0070659_100000700 3300005366 Bacteria 24395
49 Ga0070667_100000118 3300005367 Bacteria 100395
50 Ga0070667_100006285 3300005367 Bacteria 9873
51 Ga0070667_100007513 3300005367 Bacteria 9039
52 Ga0070703_10153815 3300005406 Bacteria 866
53 Ga0070709_10262413 3300005434 Bacteria 1248
54 Ga0070713_100153140 3300005436 Bacteria 2053
55 Ga0070663_100440190 3300005455 Unclassified 1072
56 Ga0070678_100816857 3300005456 Unclassified 847
57 Ga0070678_100845985 3300005456 Bacteria 833
58 Ga0070662_100139956 3300005457 Bacteria 1874
59 Ga0070681_10019859 3300005458 Bacteria 6731
60 Ga0070681_10049985 3300005458 Bacteria 4173
61 Ga0070706_100258368 3300005467 Bacteria 1626
62 Ga0070707_100972997 3300005468 Bacteria 814
63 Ga0070679_100014486 3300005530 Bacteria 7574
64 Ga0070679_100085752 3300005530 Bacteria 3136
65 Ga0070679_100884699 3300005530 Bacteria 836
66 Ga0070684_101534509 3300005535 Bacteria 628
67 Ga0068853_100000534 3300005539 Bacteria 25841
68 Ga0068853_100194853 3300005539 Bacteria 1842
69 Ga0068853_100257291 3300005539 Bacteria 1604
70 Ga0068853_101132536 3300005539 Bacteria 755
71 Ga0070696_101129388 3300005546 Unclassified 660
72 Ga0070665_100000451 3300005548 Bacteria 59861
73 Ga0070665_100000713 3300005548 Bacteria 44311
74 Ga0070665_100015124 3300005548 Bacteria 7746
75 Ga0070665_100070014 3300005548 Bacteria 3515
76 Ga0070665_100631768 3300005548 Bacteria 1084
77 Ga0070665_101378309 3300005548 Unclassified 714
78 Ga0068855_100056463 3300005563 Bacteria 4607
79 Ga0068855_100243222 3300005563 Bacteria 2010
80 Ga0068855_100835390 3300005563 Bacteria 977
81 Ga0070664_100121654 3300005564 Bacteria 2286
82 Ga0068857_100094168 3300005577 Bacteria 2682
83 Ga0068857_101083390 3300005577 Bacteria 773
84 Ga0068856_100485167 3300005614 Unclassified 1257
85 Ga0068856_100522709 3300005614 Bacteria 1208
86 Ga0068856_101274522 3300005614 Bacteria 750
87 Ga0068852_100323993 3300005616 Bacteria 1497
88 Ga0068859_100059997 3300005617 Bacteria 3833
89 Ga0068859_100061095 3300005617 Bacteria 3797
90 Ga0068864_100000038 3300005618 Bacteria 181005
91 Ga0068864_100000206 3300005618 Bacteria 53509
92 Ga0068864_100025449 3300005618 Bacteria 4983
93 Ga0068864_100098545 3300005618 Bacteria 2589
94 Ga0068864_100105225 3300005618 Bacteria 2508
95 Ga0068864_101309816 3300005618 Bacteria 725
96 Ga0068866_10664714 3300005718 Bacteria 711
97 Ga0068861_100119367 3300005719 Bacteria 2125
98 Ga0068863_100000026 3300005841 Bacteria 185590
99 Ga0068863_100000071 3300005841 Bacteria 115525
100 Ga0068863_100027342 3300005841 Bacteria 5440
101 Ga0068863_100041347 3300005841 Bacteria 4383
102 Ga0068863_100149956 3300005841 Bacteria 2231
103 Ga0068863_100181944 3300005841 Bacteria 2018
104 Ga0068858_100000061 3300005842 Bacteria 113998
105 Ga0068858_100006858 3300005842 Bacteria 11070
106 Ga0068860_100000205 3300005843 Bacteria 93929
107 Ga0068860_100000265 3300005843 Bacteria 76672
108 Ga0068860_100153126 3300005843 Bacteria 2221
109 Ga0068860_100169550 3300005843 Bacteria 2108
110 Ga0068862_100000057 3300005844 Bacteria 140795
111 Ga0068862_100051334 3300005844 Bacteria 3527
112 Ga0068862_100067787 3300005844 Bacteria 3077
113 Ga0068862_100077176 3300005844 Bacteria 2884
114 Ga0068862_100127035 3300005844 Bacteria 2252
115 Ga0068862_100454520 3300005844 Bacteria 1208
116 Ga0068862_100648143 3300005844 Bacteria 1018
117 Ga0070717_10908624 3300006028 Bacteria 802
118 Ga0070717_11128762 3300006028 Bacteria 714
119 Ga0075365_10085818 3300006038 Unclassified 2138
120 Ga0075365_10214432 3300006038 Bacteria 1350
121 Ga0075365_10440209 3300006038 Unclassified 920
122 Ga0075368_10045417 3300006042 Bacteria 1735
123 Ga0075363_100191868 3300006048 Bacteria 1165
124 Ga0075364_10001888 3300006051 Bacteria 11635
125 Ga0075364_10412619 3300006051 Unclassified 922
126 Ga0075362_10138819 3300006177 Bacteria 1161
127 Ga0075367_10013041 3300006178 Bacteria 4454
128 Ga0075367_10114707 3300006178 Bacteria 1656
129 Ga0075366_10119854 3300006195 Bacteria 1585
130 Ga0097621_100989994 3300006237 Bacteria 786
131 Ga0075370_10035551 3300006353 Bacteria 2796
132 Ga0075370_10296399 3300006353 Bacteria 961
133 Ga0075428_100008355 3300006844 Bacteria 11479
134 Ga0075428_100111928 3300006844 Bacteria 2974
135 Ga0075430_100015743 3300006846 Bacteria 6441
136 Ga0075430_100535707 3300006846 Bacteria 966
137 Ga0075431_100002242 3300006847 Bacteria 18532
138 Ga0075431_100410919 3300006847 Bacteria 1353
139 Ga0075434_100960548 3300006871 Unclassified 869
140 Ga0075429_100008008 3300006880 Bacteria 9178
141 Ga0075429_100156015 3300006880 Bacteria 1999
142 Ga0068865_100000449 3300006881 Bacteria 22886
143 Ga0075436_100033596 3300006914 Bacteria 3536
144 Ga0097620_100059998 3300006931 Bacteria 3833
145 Ga0097620_100061095 3300006931 Bacteria 3797
146 Ga0105250_10077955 3300009092 Bacteria 1341
147 Ga0111539_10000200 3300009094 Bacteria 70531
148 Ga0111539_10894783 3300009094 Bacteria 1032
149 Ga0105245_10094769 3300009098 Bacteria 2752
150 Ga0105247_10049867 3300009101 Bacteria 2575
151 Ga0114129_10000205 3300009147 Bacteria 65770
152 Ga0105241_12173908 3300009174 Bacteria 550
153 Ga0105242_10312626 3300009176 Bacteria 1438
154 Ga0105248_10001337 3300009177 Bacteria 27446
155 Ga0105248_10003125 3300009177 Bacteria 18322
156 Ga0105248_10005661 3300009177 Bacteria 13725
157 Ga0105248_10131795 3300009177 Unclassified 2820
158 Ga0105248_10382830 3300009177 Bacteria 1584
159 Ga0105248_10422353 3300009177 Bacteria 1502
160 Ga0105248_11186065 3300009177 Bacteria 863
161 Ga0105237_10327637 3300009545 Unclassified 1535
162 Ga0105238_10019180 3300009551 Bacteria 6968
163 Ga0105238_10020446 3300009551 Bacteria 6739
164 Ga0105238_11074745 3300009551 Bacteria 827
165 Ga0105249_10082294 3300009553 Bacteria 2995
166 Ga0105249_10109792 3300009553 Bacteria 2605
167 Ga0105249_10326058 3300009553 Unclassified 1548
168 Ga0157373_10001950 3300013100 Bacteria 15645
169 Ga0157373_10002460 3300013100 Bacteria 14114
170 Ga0157371_10006522 3300013102 Bacteria 9603
171 Ga0157370_10017214 3300013104 Bacteria 7295
172 Ga0157370_10033772 3300013104 Bacteria 4986
173 Ga0157370_10284188 3300013104 Bacteria 1528
174 Ga0157369_10014296 3300013105 Bacteria 8966
175 Ga0157369_10025502 3300013105 Bacteria 6563
176 Ga0157369_10041248 3300013105 Bacteria 5038
177 Ga0157369_10763220 3300013105 Bacteria 994
178 Ga0157369_10813879 3300013105 Unclassified 959
179 Ga0157374_10117104 3300013296 Bacteria 2568
180 Ga0163162_10041067 3300013306 Bacteria 4628
181 Ga0163162_10058506 3300013306 Bacteria 3883
182 Ga0157372_11116299 3300013307 Bacteria 912
183 Ga0157375_10388298 3300013308 Bacteria 1563
184 Ga0163163_10017368 3300014325 Bacteria 6709
185 Ga0163163_10021156 3300014325 Bacteria 6137
186 Ga0163163_10079552 3300014325 Bacteria 3276
187 Ga0163163_10127132 3300014325 Bacteria 2587
188 Ga0163163_10214952 3300014325 Bacteria 1972
189 Ga0163163_11263488 3300014325 Bacteria 801
190 Ga0157377_10223414 3300014745 Bacteria 1207
191 Ga0157377_10243372 3300014745 Unclassified 1162
192 Ga0157379_10025233 3300014968 Bacteria 5278
193 Ga0157379_10053177 3300014968 Bacteria 3618
194 Ga0157379_11177657 3300014968 Bacteria 736
195 Ga0157376_10903565 3300014969 Bacteria 901
196 Ga0206354_10645515 3300020081 Bacteria 1189
197 Ga0213876_10068386 3300021384 Bacteria 1876
198 Ga0209676_1000140 3300025292 Bacteria 176735
199 Ga0209676_1001867 3300025292 Bacteria 17330
200 Ga0209758_1000733 3300025297 Bacteria 47932
201 Ga0209758_1000923 3300025297 Bacteria 39720
202 Ga0209050_1000029 3300025298 Bacteria 465801
203 Ga0209050_1009395 3300025298 Bacteria 5012
204 Ga0209050_1091769 3300025298 Bacteria 620
205 Ga0209256_1000535 3300025299 Bacteria 55077
206 Ga0209257_1000630 3300025304 Bacteria 56658
207 Ga0209257_1000714 3300025304 Bacteria 51177
208 Ga0209257_1002598 3300025304 Bacteria 17521
209 Ga0207710_10210631 3300025900 Bacteria 962
210 Ga0207680_10151584 3300025903 Bacteria 1546
211 Ga0207645_10640502 3300025907 Bacteria 722
212 Ga0207643_10960936 3300025908 Bacteria 553
213 Ga0207705_10003940 3300025909 Bacteria 11287
214 Ga0207707_10023363 3300025912 Bacteria 5409
215 Ga0207707_10037163 3300025912 Bacteria 4254
216 Ga0207707_10104910 3300025912 Bacteria 2470
217 Ga0207671_10275971 3300025914 Unclassified 1325
218 Ga0207660_10002074 3300025917 Bacteria 13290
219 Ga0207660_10025550 3300025917 Bacteria 4010
220 Ga0207660_10199121 3300025917 Bacteria 1564
221 Ga0207657_10010291 3300025919 Bacteria 9339
222 Ga0207657_10023114 3300025919 Bacteria 5797
223 Ga0207657_10023860 3300025919 Bacteria 5683
224 Ga0207657_10191817 3300025919 Bacteria 1648
225 Ga0207657_10346208 3300025919 Bacteria 1173
226 Ga0207649_10324682 3300025920 Bacteria 1132
227 Ga0207649_10441367 3300025920 Bacteria 981
228 Ga0207649_10958900 3300025920 Bacteria 672
229 Ga0207652_10243497 3300025921 Bacteria 1621
230 Ga0207652_10403421 3300025921 Bacteria 1233
231 Ga0207652_10450870 3300025921 Bacteria 1160
232 Ga0207646_10772307 3300025922 Bacteria 857
233 Ga0207681_10289510 3300025923 Bacteria 1292
234 Ga0207694_10013457 3300025924 Bacteria 6163
235 Ga0207694_10208618 3300025924 Bacteria 1591
236 Ga0207650_10000032 3300025925 Bacteria 229538
237 Ga0207650_10054701 3300025925 Bacteria 2962
238 Ga0207644_10018698 3300025931 Bacteria 4690
239 Ga0207644_10447886 3300025931 Bacteria 1060
240 Ga0207690_10000020 3300025932 Bacteria 218439
241 Ga0207690_10000220 3300025932 Bacteria 43152
242 Ga0207690_10038293 3300025932 Bacteria 3119
243 Ga0207690_11164069 3300025932 Bacteria 643
244 Ga0207706_10098290 3300025933 Bacteria 2575
245 Ga0207704_10002118 3300025938 Bacteria 8896
246 Ga0207711_10000882 3300025941 Bacteria 28942
247 Ga0207711_10013999 3300025941 Bacteria 6662
248 Ga0207711_10080747 3300025941 Bacteria 2841
249 Ga0207711_10274752 3300025941 Bacteria 1551
250 Ga0207679_10110204 3300025945 Bacteria 2171
251 Ga0207679_10491486 3300025945 Bacteria 1094
252 Ga0207667_10006965 3300025949 Bacteria 13667
253 Ga0207667_10007379 3300025949 Bacteria 13229
254 Ga0207667_10017722 3300025949 Bacteria 8010
255 Ga0207667_10119203 3300025949 Bacteria 2720
256 Ga0207651_10378353 3300025960 Bacteria 1199
257 Ga0207712_10002979 3300025961 Bacteria 10809
258 Ga0207712_10227088 3300025961 Bacteria 1496
259 Ga0207668_10000015 3300025972 Bacteria 162011
260 Ga0207668_10000097 3300025972 Bacteria 62270
261 Ga0207668_10015373 3300025972 Bacteria 4754
262 Ga0207668_10030919 3300025972 Bacteria 3522
263 Ga0207668_10103597 3300025972 Bacteria 2119
264 Ga0207668_10454670 3300025972 Unclassified 1094
265 Ga0207640_10574285 3300025981 Unclassified 951
266 Ga0207658_10000116 3300025986 Bacteria 88456
267 Ga0207658_10002733 3300025986 Bacteria 12743
268 Ga0207658_10037217 3300025986 Bacteria 3494
269 Ga0207677_10000131 3300026023 Bacteria 61645
270 Ga0207677_10081513 3300026023 Bacteria 2322
271 Ga0207703_10000149 3300026035 Bacteria 80168
272 Ga0207703_10006513 3300026035 Bacteria 9318
273 Ga0207703_10080296 3300026035 Bacteria 2716
274 Ga0207639_10001443 3300026041 Bacteria 16009
275 Ga0207639_10047578 3300026041 Bacteria 3242
276 Ga0207639_10101388 3300026041 Bacteria 2328
277 Ga0207639_10112969 3300026041 Bacteria 2218
278 Ga0207639_10590407 3300026041 Bacteria 1023
279 Ga0207639_11153864 3300026041 Bacteria 727
280 Ga0207678_10224694 3300026067 Bacteria 1607
281 Ga0207678_10486210 3300026067 Unclassified 1075
282 Ga0207708_10302129 3300026075 Bacteria 1302
283 Ga0207708_11432003 3300026075 Unclassified 607
284 Ga0207702_10565760 3300026078 Unclassified 1113
285 Ga0207641_10000005 3300026088 Bacteria 470841
286 Ga0207641_10010502 3300026088 Bacteria 7600
287 Ga0207641_10017443 3300026088 Bacteria 5878
288 Ga0207641_10049420 3300026088 Bacteria 3554
289 Ga0207641_10274444 3300026088 Bacteria 1583
290 Ga0207641_11009256 3300026088 Bacteria 829
291 Ga0207676_10000085 3300026095 Bacteria 90147
292 Ga0207676_10000237 3300026095 Bacteria 48354
293 Ga0207676_10162893 3300026095 Bacteria 1934
294 Ga0207674_11712788 3300026116 Bacteria 597
295 Ga0207675_100063497 3300026118 Bacteria 3450
296 Ga0207675_101223857 3300026118 Unclassified 771
297 Ga0207683_10342524 3300026121 Bacteria 1371
298 Ga0207683_10409218 3300026121 Bacteria 1248
299 Ga0207683_11107549 3300026121 Bacteria 735
300 Ga0207698_10262997 3300026142 Bacteria 1586
301 Ga0209983_1003823 3300027665 Bacteria 3190
302 Ga0207428_10025712 3300027907 Bacteria 4924
303 Ga0268266_10000273 3300028379 Bacteria 85325
304 Ga0268266_10292041 3300028379 Bacteria 1518
305 Ga0268266_10325611 3300028379 Bacteria 1439
306 Ga0268266_11793544 3300028379 Unclassified 588
307 Ga0268265_10004161 3300028380 Bacteria 10139
308 Ga0268265_10048299 3300028380 Bacteria 3194
309 Ga0268265_10106666 3300028380 Bacteria 2276
310 Ga0268265_10644756 3300028380 Bacteria 1017
311 Ga0268264_10000202 3300028381 Bacteria 121481
312 Ga0268264_10000318 3300028381 Bacteria 76687
313 Ga0268264_10026808 3300028381 Bacteria 4708
314 Ga0265338_10002913 3300028800 Bacteria 24860
315 Ga0265338_10087299 3300028800 Bacteria 2592
316 Ga0307511_10023924 3300030521 Bacteria 5679
317 Ga0265325_10000004 3300031241 Bacteria 347347
318 Ga0265327_10001787 3300031251 Bacteria 25269
319 Ga0265327_10012400 3300031251 Bacteria 5756
320 Ga0307508_10370166 3300031616 Bacteria 1024
321 Ga0265314_10048417 3300031711 Bacteria 2984
322 Ga0307405_10201817 3300031731 Bacteria 1445
323 Ga0307413_10085276 3300031824 Bacteria 2039
324 Ga0307413_11039356 3300031824 Bacteria 704
325 Ga0307406_10001802 3300031901 Bacteria 11708
326 Ga0307412_10007240 3300031911 Bacteria 6292
327 Ga0307414_10008170 3300032004 Bacteria 5917
328 Ga0307414_10038833 3300032004 Bacteria 3201
329 Ga0307414_10052082 3300032004 Bacteria 2846
330 Ga0307414_10117827 3300032004 Bacteria 2035
331 Ga0307414_10168472 3300032004 Bacteria 1748
332 Ga0307414_10393750 3300032004 Bacteria 1201
333 Ga0307414_10426620 3300032004 Bacteria 1157
334 Ga0307414_10431324 3300032004 Bacteria 1151
335 Ga0307414_10522788 3300032004 Bacteria 1053
336 Ga0307414_10924964 3300032004 Bacteria 800
337 Ga0307414_11096352 3300032004 Bacteria 735
338 Ga0307510_10298923 3300033180 Bacteria 1073
339 Ga0373926_0353601 3300035083 Bacteria 577
340 Ga0373926_0405616 3300035083 Unclassified 538
341 Ga0373944_0030079 3300035089 Bacteria 1627
342 Ga0373949_0207747 3300035090 Bacteria 590
343 Ga0373945_0016317 3300035116 Bacteria 2503
344 Ga0373943_0441655 3300035170 Bacteria 755
345 Ga0373946_0155074 3300035171 Bacteria 1071
346 Ga0373931_0580329 3300035691 Unclassified 731
347 Ga0373935_0157263 3300035692 Bacteria 1547
348 Ga0373927_0000530 3300035695 Bacteria 28952
349 Ga0373925_0000089 3300037068 Bacteria 98449
350 Ga0395899_0000018 3300037312 Bacteria 423194
351 Ga0395899_0001557 3300037312 Bacteria 19328
352 Ga0395899_0005180 3300037312 Bacteria 10143
353 Ga0395899_0415563 3300037312 Bacteria 887
354 Ga0395899_0731061 3300037312 Bacteria 618
355 Ga0395900_0000004 3300037418 Bacteria 564908
356 Ga0395900_0106571 3300037418 Bacteria 2879
357 Ga0395900_0593906 3300037418 Bacteria 1048
358 Ga0395898_0004167 3300037466 Bacteria 15841
359 Ga0395898_0113459 3300037466 Bacteria 2597
360 Ga0395898_0559061 3300037466 Bacteria 1086
361 Ga0395898_0627220 3300037466 Bacteria 1017
362 Ga0395898_0698249 3300037466 Bacteria 956
363 Ga0395905_0003519 3300037471 Bacteria 16701
364 Ga0395905_0032986 3300037471 Bacteria 4868
365 Ga0395905_0095786 3300037471 Bacteria 2786
366 Ga0395905_0234957 3300037471 Bacteria 1714
367 Ga0395905_0400040 3300037471 Bacteria 1268
368 Ga0395901_0000005 3300038443 Bacteria 544998
369 Ga0395901_0107245 3300038443 Bacteria 2932
370 Ga0395901_0256316 3300038443 Bacteria 1822
371 Ga0436365_0773082 3300039437 Bacteria 5259
372 Ga0436361_0343753 3300039447 Bacteria 627
373 Ga0436361_0377648 3300039447 Bacteria 1049
374 Ga0450890_055412 3300042127 Bacteria 612
375 Ga0450892_012043 3300042130 Bacteria 774
376 Ga0439435_0003710 3300042436 Bacteria 3207
377 Ga0451577_1349090 3300042876 Unclassified 633
378 Ga0466959_0471781 3300045049 Bacteria 850
379 Ga0451576_0264627 3300045051 Bacteria 1797
380 Ga0451576_1356987 3300045051 Bacteria 740
381 Ga0495592_0227448 3300046454 Bacteria 1244
382 Ga0495629_0019898 3300046459 Bacteria 4790
383 Ga0495629_0566272 3300046459 Bacteria 762
384 Ga0495638_0266067 3300046460 Bacteria 938
385 Ga0495582_0344432 3300046473 Bacteria 858
386 Ga0495584_0025227 3300046491 Bacteria 3014
387 Ga0495594_0095541 3300046499 Bacteria 1669
388 Ga0495606_0336293 3300046507 Bacteria 806
389 Ga0495628_0649503 3300046516 Bacteria 749
390 Ga0495628_0869866 3300046516 Bacteria 627
391 Ga0495637_0021394 3300046520 Bacteria 2967
392 Ga0495643_0103843 3300046522 Bacteria 1453
393 Ga0495643_0140087 3300046522 Bacteria 1207
394 Ga0495642_0001865 3300046528 Bacteria 8995
395 Ga0495642_0090232 3300046528 Bacteria 1297
396 Ga0495640_0162735 3300046533 Unclassified 1429
397 Ga0495598_0001261 3300046537 Bacteria 4934
398 Ga0495598_0149142 3300046537 Bacteria 815
399 Ga0495609_0404572 3300046538 Bacteria 546
400 Ga0495597_0008223 3300046542 Bacteria 5243
401 Ga0495622_0002683 3300046557 Bacteria 8535
402 Ga0495633_0000400 3300046558 Bacteria 45378
403 Ga0495633_0009773 3300046558 Bacteria 5272
404 Ga0495633_0185986 3300046558 Bacteria 956
405 Ga0495668_0161801 3300046616 Bacteria 1226
406 Ga0495668_0208207 3300046616 Bacteria 1071
407 Ga0495668_0393780 3300046616 Bacteria 761
408 Ga0495625_0000165 3300046660 Bacteria 102988
409 Ga0495625_0004667 3300046660 Bacteria 12868
410 Ga0495625_0136368 3300046660 Bacteria 1658
411 Ga0495625_0195375 3300046660 Bacteria 1338
412 Ga0495625_0323331 3300046660 Bacteria 982
413 Ga0495658_0607258 3300046683 Unclassified 701
414 Ga0495669_0000008 3300046684 Bacteria 177295
415 Ga0495669_0023949 3300046684 Bacteria 2660
416 Ga0495649_0001927 3300046694 Bacteria 15131
417 Ga0495600_0397619 3300046809 Unclassified 858
418 Ga0495674_0461864 3300047319 Bacteria 1019
419 Ga0495672_0014805 3300047320 Bacteria 5320
420 Ga0495680_0049658 3300047322 Bacteria 3285
421 Ga0495686_0010444 3300047472 Bacteria 6605
422 Ga0495686_0171079 3300047472 Bacteria 1263
423 Ga0495686_0274947 3300047472 Bacteria 938
424 Ga0495686_0325616 3300047472 Bacteria 841
425 Ga0495593_0224050 3300047673 Bacteria 943
426 Ga0495602_0454887 3300048088 Bacteria 903
427 Ga0495615_0080535 3300048090 Bacteria 892
428 Ga0496101_0082262 3300048904 Bacteria 2383
429 Ga0496101_0462785 3300048904 Bacteria 1001
430 Ga0496101_0787398 3300048904 Bacteria 750
431 Ga0496101_0910362 3300048904 Bacteria 692
432 Ga0496102_0065025 3300048905 Bacteria 3342
433 Ga0496102_0161842 3300048905 Bacteria 2105
434 Ga0496104_0089238 3300048907 Bacteria 2945
435 Ga0496105_0262866 3300048908 Unclassified 1395
436 Ga0496106_0146022 3300048909 Unclassified 1863
437 Ga0496107_0040746 3300048910 Bacteria 3335
438 Ga0496107_0208392 3300048910 Bacteria 1453
439 Ga0496107_0783812 3300048910 Bacteria 698
440 Ga0496109_0017491 3300048912 Bacteria 6286
441 Ga0496110_0068829 3300048913 Bacteria 3134
442 Ga0496110_0097061 3300048913 Bacteria 2641
443 Ga0496111_0051787 3300048914 Bacteria 2964
444 Ga0496112_0019675 3300048915 Bacteria 6378
445 Ga0496112_0111799 3300048915 Bacteria 2701
446 Ga0496113_0017247 3300048916 Bacteria 5008
447 Ga0496113_1323468 3300048916 Bacteria 560
448 Ga0496114_0170083 3300048917 Bacteria 1899
449 Ga0496114_0211275 3300048917 Bacteria 1702
450 Ga0496115_0001534 3300048918 Bacteria 16566
451 Ga0496115_0016352 3300048918 Bacteria 5648
452 Ga0496115_0017829 3300048918 Bacteria 5437
453 Ga0496115_0084360 3300048918 Bacteria 2590
454 Ga0496115_0235592 3300048918 Bacteria 1509
455 Ga0496116_0388068 3300048919 Bacteria 623
456 Ga0496117_0010947 3300048920 Bacteria 8175
457 Ga0496118_0017266 3300048921 Bacteria 6580
458 Ga0496119_0498977 3300048922 Bacteria 566
459 Ga0496121_0000059 3300048924 Bacteria 278177
460 Ga0496121_0379080 3300048924 Bacteria 933
461 Ga0496122_0026937 3300048925 Bacteria 4935
462 Ga0496125_0000334 3300048928 Bacteria 90058
463 Ga0496126_0448560 3300048929 Bacteria 1039
464 Ga0495682_0250132 3300049460 Bacteria 627
465 Ga0501031_0083481 3300049568 Bacteria 2082
466 Ga0501034_0035345 3300049571 Bacteria 5066
467 Ga0501034_0246687 3300049571 Bacteria 1731
468 Ga0501037_0021683 3300049573 Bacteria 4751
469 Ga0501040_0121472 3300049576 Bacteria 1833
470 Ga0501042_0393149 3300049578 Bacteria 1004
471 Ga0501043_0545232 3300049579 Bacteria 862
472 Ga0501071_0959591 3300049587 Bacteria 660
473 Ga0501075_0641427 3300049591 Bacteria 810
474 Ga0501077_0103061 3300049593 Bacteria 1808
475 Ga0501079_0353939 3300049741 Bacteria 1151
476 Ga0501080_0735942 3300049742 Bacteria 868
477 Ga0501081_0199505 3300049743 Bacteria 1451
478 Ga0501044_0737576 3300049823 Bacteria 868
479 nmdc:mga03n38_92295_c1 3300050490 Bacteria 1444
480 nmdc:mga0yw44_143073_c1 3300050492 Bacteria 1555
481 nmdc:mga0yw44_270630_c1 3300050492 Bacteria 1134
482 nmdc:mga0k408_478263_c1 3300050493 Bacteria 739
483 nmdc:mga06z11_435034_c1 3300050494 Unclassified 792
484 nmdc:mga07m45_4905_c1 3300050496 Bacteria 6593
485 nmdc:mga07m45_499398_c1 3300050496 Unclassified 704
486 nmdc:mga05p37_7561_c1 3300050507 Bacteria 12816
487 nmdc:mga09592_1356_c1 3300050508 Bacteria 19564
488 nmdc:mga0qj67_1066641_c1 3300050509 Unclassified 632
489 nmdc:mga0qj67_12317_c1 3300050509 Bacteria 6439
490 nmdc:mga06r32_347_c1 3300050510 Bacteria 38541
491 nmdc:mga06r32_56099_c1 3300050510 Bacteria 3780
492 nmdc:mga06r32_664936_c1 3300050510 Bacteria 1009
493 nmdc:mga08y16_2055_c1 3300050511 Bacteria 20613
494 nmdc:mga0n895_396388_c1 3300050512 Bacteria 1396
495 nmdc:mga08x19_26557_c1 3300050514 Bacteria 3614
496 Ga0500578_0213773 3300053086 Bacteria 1175
497 Ga0500643_014186 3300053087 Bacteria 2780
498 Ga0500643_026735 3300053087 Bacteria 1802
499 Ga0500643_089986 3300053087 Unclassified 837
500 Ga0500644_0003373 3300053088 Bacteria 3951
501 Ga0500647_0196311 3300053091 Bacteria 917
502 Ga0500583_0232578 3300053092 Bacteria 912
503 Ga0500651_0010034 3300053093 Bacteria 5659
504 Ga0500651_0032591 3300053093 Bacteria 3284
505 Ga0500566_0110003 3300053094 Bacteria 1499
506 Ga0500641_0085126 3300053096 Bacteria 1345
507 Ga0500554_000600 3300053102 Bacteria 7333
508 Ga0500562_000374 3300053108 Bacteria 10829
509 Ga0500562_015463 3300053108 Bacteria 1958
510 Ga0500562_034794 3300053108 Bacteria 1333
511 Ga0500569_004887 3300053109 Bacteria 2848
512 Ga0500572_000299 3300053111 Bacteria 17614
513 Ga0500593_236611 3300053117 Unclassified 629
514 Ga0500595_001544 3300053119 Bacteria 12195
515 Ga0500595_076786 3300053119 Bacteria 983
516 Ga0500597_070712 3300053120 Bacteria 1509
517 Ga0500607_268988 3300053121 Bacteria 660
518 Ga0500608_001622 3300053122 Bacteria 8084
519 Ga0500614_021544 3300053123 Bacteria 1496
520 Ga0500642_0046791 3300053130 Bacteria 1893
521 Ga0500559_0003514 3300053136 Bacteria 7676
522 Ga0500590_013063 3300053148 Bacteria 4252
523 Ga0500616_0187798 3300053153 Bacteria 925
524 Ga0500619_133924 3300053154 Bacteria 845
525 Ga0500638_169401 3300053162 Bacteria 953
526 Ga0500636_0094931 3300053177 Bacteria 1703
527 Ga0500637_0038670 3300053178 Bacteria 2689
528 Ga0500625_128133 3300053729 Bacteria 1004
529 Ga0500645_010341 3300053730 Bacteria 3091
530 Ga0500596_006623 3300053735 Bacteria 1947
531 Ga0501084_0150288 3300054114 Bacteria 1963
532 Ga0501082_0262361 3300060353 Bacteria 1503
533 Ga0530510_0062608 3300061734 Bacteria 2693
534 Ga0530510_0147430 3300061734 Bacteria 1736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005262 Ga0065165_1001734 Ga0065165_100173412 124
2 3300005329 Ga0070683_100280840 Ga0070683_1002808402 125
3 3300005336 Ga0070680_100029103 Ga0070680_1000291035 125
4 3300005341 Ga0070691_10000826 Ga0070691_1000082613 125
5 3300005530 Ga0070679_100014486 Ga0070679_1000144864 125
6 3300005563 Ga0068855_100056463 Ga0068855_1000564634 125
7 3300013104 Ga0157370_10284188 Ga0157370_102841882 125
8 3300025912 Ga0207707_10104910 Ga0207707_101049102 125
9 3300025917 Ga0207660_10025550 Ga0207660_100255502 125
10 3300025921 Ga0207652_10403421 Ga0207652_104034212 125
11 3300025949 Ga0207667_10017722 Ga0207667_100177223 125
12 3300026041 Ga0207639_10590407 Ga0207639_105904071 125
13 3300006178 Ga0075367_10114707 Ga0075367_101147073 137
14 3300032004 Ga0307414_10168472 Ga0307414_101684722 142
15 3300032004 Ga0307414_10117827 Ga0307414_101178274 143
16 3300003781 Ga0055536_1053718 Ga0055536_10537182 144
17 3300025292 Ga0209676_1001867 Ga0209676_100186711 144
18 3300003791 Ga0055530_10000148 Ga0055530_1000014842 145
19 3300003794 Ga0055531_10022227 Ga0055531_100222271 145
20 3300005331 Ga0070670_100065510 Ga0070670_1000655103 145
21 3300005347 Ga0070668_100003407 Ga0070668_1000034074 145
22 3300005353 Ga0070669_100357328 Ga0070669_1003573282 145
23 3300005355 Ga0070671_100285054 Ga0070671_1002850542 145
24 3300005367 Ga0070667_100006285 Ga0070667_1000062858 145
25 3300005618 Ga0068864_100098545 Ga0068864_1000985452 145
26 3300005719 Ga0068861_100119367 Ga0068861_1001193672 145
27 3300005841 Ga0068863_100027342 Ga0068863_1000273422 145
28 3300005844 Ga0068862_100067787 Ga0068862_1000677872 145
29 3300006028 Ga0070717_10908624 Ga0070717_109086242 145
30 3300009553 Ga0105249_10109792 Ga0105249_101097922 145
31 3300025297 Ga0209758_1000733 Ga0209758_100073327 145
32 3300025298 Ga0209050_1000029 Ga0209050_1000029348 145
33 3300025304 Ga0209257_1000714 Ga0209257_100071422 145
34 3300025923 Ga0207681_10289510 Ga0207681_102895102 145
35 3300025925 Ga0207650_10054701 Ga0207650_100547013 145
36 3300025931 Ga0207644_10447886 Ga0207644_104478862 145
37 3300025961 Ga0207712_10227088 Ga0207712_102270882 145
38 3300025972 Ga0207668_10030919 Ga0207668_100309193 145
39 3300025986 Ga0207658_10037217 Ga0207658_100372173 145
40 3300026088 Ga0207641_10049420 Ga0207641_100494203 145
41 3300026118 Ga0207675_100063497 Ga0207675_1000634974 145
42 3300028380 Ga0268265_10048299 Ga0268265_100482993 145
43 3300028381 Ga0268264_10026808 Ga0268264_100268082 145
44 3300031616 Ga0307508_10370166 Ga0307508_103701662 145
45 3300032004 Ga0307414_10924964 Ga0307414_109249642 145
46 3300032004 Ga0307414_11096352 Ga0307414_110963521 145
47 3300039447 Ga0436361_0343753 Ga0436361_0343753_95_583 145
48 3300046616 Ga0495668_0161801 Ga0495668_0161801_367_846 145
49 3300047472 Ga0495686_0325616 Ga0495686_0325616_264_743 145
50 3300005347 Ga0070668_100011657 Ga0070668_1000116573 146
51 3300005367 Ga0070667_100007513 Ga0070667_1000075132 146
52 3300005548 Ga0070665_100000451 Ga0070665_10000045151 146
53 3300005843 Ga0068860_100169550 Ga0068860_1001695502 146
54 3300005844 Ga0068862_100051334 Ga0068862_1000513342 146
55 3300006048 Ga0075363_100191868 Ga0075363_1001918682 146
56 3300006195 Ga0075366_10119854 Ga0075366_101198542 146
57 3300006353 Ga0075370_10035551 Ga0075370_100355515 146
58 3300009177 Ga0105248_10001337 Ga0105248_1000133717 146
59 3300014325 Ga0163163_10214952 Ga0163163_102149523 146
60 3300014968 Ga0157379_11177657 Ga0157379_111776572 146
61 3300025941 Ga0207711_10000882 Ga0207711_1000088219 146
62 3300025972 Ga0207668_10000015 Ga0207668_1000001573 146
63 3300025986 Ga0207658_10002733 Ga0207658_100027332 146
64 3300028379 Ga0268266_10000273 Ga0268266_1000027326 146
65 3300037312 Ga0395899_0000018 Ga0395899_0000018_6759_7238 146
66 3300045051 Ga0451576_1356987 Ga0451576_1356987_70_549 146
67 3300047472 Ga0495686_0010444 Ga0495686_0010444_2078_2557 146
68 3300048917 Ga0496114_0211275 Ga0496114_0211275_665_1141 146
69 3300048918 Ga0496115_0017829 Ga0496115_0017829_2327_2803 146
70 3300048929 Ga0496126_0448560 Ga0496126_0448560_345_821 146
71 3300050490 nmdc:mga03n38_92295_c1 nmdc:mga03n38_92295_c1_181_669 146
72 3300050493 nmdc:mga0k408_478263_c1 nmdc:mga0k408_478263_c1_109_597 146
73 3300050496 nmdc:mga07m45_4905_c1 nmdc:mga07m45_4905_c1_3753_4241 146
74 3300053087 Ga0500643_026735 Ga0500643_026735_390_869 146
75 3300005327 Ga0070658_11167315 Ga0070658_111673151 147
76 3300005339 Ga0070660_100053765 Ga0070660_1000537653 147
77 3300026121 Ga0207683_11107549 Ga0207683_111075491 147
78 3300046538 Ga0495609_0404572 Ga0495609_0404572_34_513 147
79 3300053730 Ga0500645_010341 Ga0500645_010341_436_942 147
80 3300005618 Ga0068864_100000038 Ga0068864_100000038104 148
81 3300005841 Ga0068863_100000026 Ga0068863_100000026103 148
82 3300009092 Ga0105250_10077955 Ga0105250_100779552 148
83 3300026088 Ga0207641_10000005 Ga0207641_10000005314 148
84 3300026095 Ga0207676_10000085 Ga0207676_1000008545 148
85 3300005339 Ga0070660_100290864 Ga0070660_1002908642 149
86 3300005339 Ga0070660_100458878 Ga0070660_1004588782 149
87 3300005366 Ga0070659_100000010 Ga0070659_100000010137 149
88 3300025919 Ga0207657_10191817 Ga0207657_101918172 149
89 3300025932 Ga0207690_10000020 Ga0207690_10000020226 149
90 3300032004 Ga0307414_10052082 Ga0307414_100520824 149
91 iso_pu_bacteria 2738541281 2738743770 149
92 iso_pu_bacteria 2738543032 2739352676 149
93 iso_pu_bacteria 2842698319 2842698557 149
94 3300005347 Ga0070668_100116099 Ga0070668_1001160992 150
95 3300005364 Ga0070673_100564532 Ga0070673_1005645322 150
96 3300005546 Ga0070696_101129388 Ga0070696_1011293881 150
97 3300005617 Ga0068859_100061095 Ga0068859_1000610953 150
98 3300005618 Ga0068864_100025449 Ga0068864_1000254493 150
99 3300005842 Ga0068858_100000061 Ga0068858_10000006159 150
100 3300005843 Ga0068860_100153126 Ga0068860_1001531263 150
101 3300005844 Ga0068862_100127035 Ga0068862_1001270353 150
102 3300006931 Ga0097620_100061095 Ga0097620_1000610953 150
103 3300009094 Ga0111539_10894783 Ga0111539_108947832 150
104 3300009177 Ga0105248_10131795 Ga0105248_101317952 150
105 3300009177 Ga0105248_10382830 Ga0105248_103828302 150
106 3300009553 Ga0105249_10082294 Ga0105249_100822943 150
107 3300013105 Ga0157369_10025502 Ga0157369_100255025 150
108 3300014968 Ga0157379_10053177 Ga0157379_100531772 150
109 3300014969 Ga0157376_10903565 Ga0157376_109035652 150
110 3300025907 Ga0207645_10640502 Ga0207645_106405022 150
111 3300025941 Ga0207711_10274752 Ga0207711_102747522 150
112 3300025960 Ga0207651_10378353 Ga0207651_103783533 150
113 3300026023 Ga0207677_10000131 Ga0207677_1000013120 150
114 3300026035 Ga0207703_10000149 Ga0207703_1000014914 150
115 3300026075 Ga0207708_10302129 Ga0207708_103021292 150
116 3300026121 Ga0207683_10342524 Ga0207683_103425242 150
117 3300028380 Ga0268265_10106666 Ga0268265_101066662 150
118 3300046533 Ga0495640_0162735 Ga0495640_0162735_613_1086 150
119 3300046683 Ga0495658_0607258 Ga0495658_0607258_212_685 150
120 3300046809 Ga0495600_0397619 Ga0495600_0397619_95_568 150
121 3300047322 Ga0495680_0049658 Ga0495680_0049658_2152_2625 150
122 3300048904 Ga0496101_0787398 Ga0496101_0787398_196_675 150
123 3300053119 Ga0500595_076786 Ga0500595_076786_432_911 150
124 3300014325 Ga0163163_10017368 Ga0163163_100173682 151
125 iso_pu_bacteria 2841911363 2841911653 151
126 iso_pu_bacteria 2841917233 2841917390 151
127 3300005329 Ga0070683_101265911 Ga0070683_1012659111 152
128 3300005331 Ga0070670_101815265 Ga0070670_1018152651 152
129 3300005336 Ga0070680_100271719 Ga0070680_1002717192 152
130 3300005337 Ga0070682_100184566 Ga0070682_1001845663 152
131 3300005339 Ga0070660_100008830 Ga0070660_1000088308 152
132 3300005339 Ga0070660_100329941 Ga0070660_1003299412 152
133 3300005341 Ga0070691_10098329 Ga0070691_100983292 152
134 3300005354 Ga0070675_100411185 Ga0070675_1004111851 152
135 3300005436 Ga0070713_100153140 Ga0070713_1001531402 152
136 3300005455 Ga0070663_100440190 Ga0070663_1004401902 152
137 3300005456 Ga0070678_100816857 Ga0070678_1008168572 152
138 3300005458 Ga0070681_10049985 Ga0070681_100499853 152
139 3300005548 Ga0070665_101378309 Ga0070665_1013783091 152
140 3300005564 Ga0070664_100121654 Ga0070664_1001216543 152
141 3300005614 Ga0068856_100485167 Ga0068856_1004851672 152
142 3300005841 Ga0068863_100181944 Ga0068863_1001819443 152
143 3300006028 Ga0070717_11128762 Ga0070717_111287621 152
144 3300006038 Ga0075365_10440209 Ga0075365_104402093 152
145 3300006844 Ga0075428_100111928 Ga0075428_1001119281 152
146 3300006871 Ga0075434_100960548 Ga0075434_1009605481 152
147 3300006880 Ga0075429_100156015 Ga0075429_1001560151 152
148 3300006914 Ga0075436_100033596 Ga0075436_1000335963 152
149 3300009098 Ga0105245_10094769 Ga0105245_100947695 152
150 3300009545 Ga0105237_10327637 Ga0105237_103276373 152
151 3300009551 Ga0105238_10020446 Ga0105238_100204467 152
152 3300009553 Ga0105249_10326058 Ga0105249_103260581 152
153 3300013104 Ga0157370_10033772 Ga0157370_100337725 152
154 3300013105 Ga0157369_10041248 Ga0157369_100412486 152
155 3300013105 Ga0157369_10813879 Ga0157369_108138792 152
156 3300013296 Ga0157374_10117104 Ga0157374_101171044 152
157 3300013306 Ga0163162_10041067 Ga0163162_100410674 152
158 3300013307 Ga0157372_11116299 Ga0157372_111162991 152
159 3300014325 Ga0163163_10021156 Ga0163163_100211562 152
160 3300014745 Ga0157377_10243372 Ga0157377_102433722 152
161 3300020081 Ga0206354_10645515 Ga0206354_106455152 152
162 3300025912 Ga0207707_10037163 Ga0207707_100371633 152
163 3300025914 Ga0207671_10275971 Ga0207671_102759712 152
164 3300025917 Ga0207660_10199121 Ga0207660_101991211 152
165 3300025945 Ga0207679_10110204 Ga0207679_101102042 152
166 3300025945 Ga0207679_10491486 Ga0207679_104914862 152
167 3300025949 Ga0207667_10006965 Ga0207667_100069659 152
168 3300025981 Ga0207640_10574285 Ga0207640_105742851 152
169 3300026067 Ga0207678_10486210 Ga0207678_104862102 152
170 3300026078 Ga0207702_10565760 Ga0207702_105657602 152
171 3300026088 Ga0207641_11009256 Ga0207641_110092562 152
172 3300028379 Ga0268266_11793544 Ga0268266_117935441 152
173 3300030521 Ga0307511_10023924 Ga0307511_100239248 152
174 3300035691 Ga0373931_0580329 Ga0373931_0580329_56_517 152
175 3300048904 Ga0496101_0082262 Ga0496101_0082262_496_957 152
176 3300048905 Ga0496102_0065025 Ga0496102_0065025_1086_1547 152
177 3300048907 Ga0496104_0089238 Ga0496104_0089238_867_1328 152
178 3300048908 Ga0496105_0262866 Ga0496105_0262866_486_947 152
179 3300048909 Ga0496106_0146022 Ga0496106_0146022_393_854 152
180 3300048910 Ga0496107_0040746 Ga0496107_0040746_2336_2797 152
181 3300048912 Ga0496109_0017491 Ga0496109_0017491_1869_2330 152
182 3300048913 Ga0496110_0068829 Ga0496110_0068829_2114_2575 152
183 3300048914 Ga0496111_0051787 Ga0496111_0051787_1888_2349 152
184 3300048915 Ga0496112_0019675 Ga0496112_0019675_1659_2120 152
185 3300048916 Ga0496113_0017247 Ga0496113_0017247_904_1365 152
186 3300048924 Ga0496121_0379080 Ga0496121_0379080_162_680 152
187 3300050492 nmdc:mga0yw44_143073_c1 nmdc:mga0yw44_143073_c1_668_1147 152
188 3300050512 nmdc:mga0n895_396388_c1 nmdc:mga0n895_396388_c1_884_1351 152
189 3300050514 nmdc:mga08x19_26557_c1 nmdc:mga08x19_26557_c1_1497_1964 152
190 3300053087 Ga0500643_014186 Ga0500643_014186_1490_1969 152
191 3300053087 Ga0500643_089986 Ga0500643_089986_205_702 152
192 3300053117 Ga0500593_236611 Ga0500593_236611_40_501 152
193 3300005335 Ga0070666_10057739 Ga0070666_100577393 153
194 3300005344 Ga0070661_100664694 Ga0070661_1006646941 153
195 3300005347 Ga0070668_100000232 Ga0070668_10000023219 153
196 3300005367 Ga0070667_100000118 Ga0070667_10000011875 153
197 3300005406 Ga0070703_10153815 Ga0070703_101538151 153
198 3300005434 Ga0070709_10262413 Ga0070709_102624132 153
199 3300005467 Ga0070706_100258368 Ga0070706_1002583683 153
200 3300005468 Ga0070707_100972997 Ga0070707_1009729971 153
201 3300005548 Ga0070665_100000713 Ga0070665_10000071330 153
202 3300005617 Ga0068859_100059997 Ga0068859_1000599972 153
203 3300005618 Ga0068864_100000206 Ga0068864_10000020636 153
204 3300005841 Ga0068863_100000071 Ga0068863_10000007177 153
205 3300005842 Ga0068858_100006858 Ga0068858_1000068588 153
206 3300005843 Ga0068860_100000205 Ga0068860_10000020563 153
207 3300005844 Ga0068862_100000057 Ga0068862_100000057115 153
208 3300006038 Ga0075365_10085818 Ga0075365_100858183 153
209 3300006051 Ga0075364_10412619 Ga0075364_104126192 153
210 3300006844 Ga0075428_100008355 Ga0075428_1000083557 153
211 3300006846 Ga0075430_100015743 Ga0075430_1000157434 153
212 3300006847 Ga0075431_100002242 Ga0075431_10000224217 153
213 3300006880 Ga0075429_100008008 Ga0075429_10000800812 153
214 3300006931 Ga0097620_100059998 Ga0097620_1000599982 153
215 3300009094 Ga0111539_10000200 Ga0111539_1000020060 153
216 3300009101 Ga0105247_10049867 Ga0105247_100498672 153
217 3300009147 Ga0114129_10000205 Ga0114129_1000020518 153
218 3300014325 Ga0163163_11263488 Ga0163163_112634882 153
219 3300014968 Ga0157379_10025233 Ga0157379_100252332 153
220 3300025900 Ga0207710_10210631 Ga0207710_102106311 153
221 3300025920 Ga0207649_10441367 Ga0207649_104413671 153
222 3300025922 Ga0207646_10772307 Ga0207646_107723071 153
223 3300025925 Ga0207650_10000032 Ga0207650_1000003272 153
224 3300025961 Ga0207712_10002979 Ga0207712_100029792 153
225 3300025972 Ga0207668_10000097 Ga0207668_1000009749 153
226 3300025972 Ga0207668_10454670 Ga0207668_104546702 153
227 3300025986 Ga0207658_10000116 Ga0207658_1000011631 153
228 3300026035 Ga0207703_10006513 Ga0207703_100065136 153
229 3300026041 Ga0207639_10101388 Ga0207639_101013881 153
230 3300026075 Ga0207708_11432003 Ga0207708_114320031 153
231 3300026088 Ga0207641_10010502 Ga0207641_100105022 153
232 3300026095 Ga0207676_10000237 Ga0207676_1000023711 153
233 3300026118 Ga0207675_101223857 Ga0207675_1012238571 153
234 3300027907 Ga0207428_10025712 Ga0207428_100257125 153
235 3300028379 Ga0268266_10292041 Ga0268266_102920412 153
236 3300028381 Ga0268264_10000202 Ga0268264_1000020251 153
237 3300037466 Ga0395898_0113459 Ga0395898_0113459_2031_2540 153
238 3300048904 Ga0496101_0462785 Ga0496101_0462785_475_954 153
239 3300048916 Ga0496113_1323468 Ga0496113_1323468_66_527 153
240 3300050492 nmdc:mga0yw44_270630_c1 nmdc:mga0yw44_270630_c1_654_1115 153
241 3300050494 nmdc:mga06z11_435034_c1 nmdc:mga06z11_435034_c1_236_697 153
242 3300050496 nmdc:mga07m45_499398_c1 nmdc:mga07m45_499398_c1_62_523 153
243 3300050507 nmdc:mga05p37_7561_c1 nmdc:mga05p37_7561_c1_11719_12180 153
244 3300050508 nmdc:mga09592_1356_c1 nmdc:mga09592_1356_c1_17813_18274 153
245 3300050509 nmdc:mga0qj67_12317_c1 nmdc:mga0qj67_12317_c1_2607_3068 153
246 3300050510 nmdc:mga06r32_347_c1 nmdc:mga06r32_347_c1_7559_8020 153
247 3300050511 nmdc:mga08y16_2055_c1 nmdc:mga08y16_2055_c1_1537_1998 153
248 3300005614 Ga0068856_100522709 Ga0068856_1005227092 154
249 3300006038 Ga0075365_10214432 Ga0075365_102144323 154
250 3300006042 Ga0075368_10045417 Ga0075368_100454173 154
251 3300006177 Ga0075362_10138819 Ga0075362_101388193 154
252 3300006846 Ga0075430_100535707 Ga0075430_1005357073 154
253 3300006847 Ga0075431_100410919 Ga0075431_1004109192 154
254 3300031241 Ga0265325_10000004 Ga0265325_10000004234 154
255 3300035090 Ga0373949_0207747 Ga0373949_0207747_67_564 154
256 3300035170 Ga0373943_0441655 Ga0373943_0441655_281_745 154
257 3300035171 Ga0373946_0155074 Ga0373946_0155074_137_601 154
258 3300035692 Ga0373935_0157263 Ga0373935_0157263_1026_1490 154
259 3300050509 nmdc:mga0qj67_1066641_c1 nmdc:mga0qj67_1066641_c1_73_537 154
260 3300050510 nmdc:mga06r32_56099_c1 nmdc:mga06r32_56099_c1_1983_2447 154
261 3300050510 nmdc:mga06r32_664936_c1 nmdc:mga06r32_664936_c1_292_774 154
262 3300061734 Ga0530510_0147430 Ga0530510_0147430_702_1166 154
263 iso_pu_bacteria 2643221574 2643882294 154
264 iso_pu_bacteria 2643221663 2644354637 154
265 iso_pu_bacteria 2643221699 2644549270 154
266 iso_pu_bacteria 2643221699 2644552408 154
267 iso_pu_bacteria 2941485952 2941487997 154
268 3300035083 Ga0373926_0405616 Ga0373926_0405616_60_527 155
269 3300035116 Ga0373945_0016317 Ga0373945_0016317_1878_2345 155
270 3300046460 Ga0495638_0266067 Ga0495638_0266067_44_511 155
271 3300046491 Ga0495584_0025227 Ga0495584_0025227_715_1182 155
272 3300046520 Ga0495637_0021394 Ga0495637_0021394_1056_1523 155
273 3300046537 Ga0495598_0001261 Ga0495598_0001261_584_1051 155
274 3300046558 Ga0495633_0009773 Ga0495633_0009773_1580_2047 155
275 3300048917 Ga0496114_0170083 Ga0496114_0170083_1058_1525 155
276 3300049568 Ga0501031_0083481 Ga0501031_0083481_654_1124 155
277 3300049571 Ga0501034_0035345 Ga0501034_0035345_4444_4914 155
278 3300049573 Ga0501037_0021683 Ga0501037_0021683_2811_3281 155
279 3300049576 Ga0501040_0121472 Ga0501040_0121472_611_1078 155
280 3300049578 Ga0501042_0393149 Ga0501042_0393149_71_538 155
281 3300049579 Ga0501043_0545232 Ga0501043_0545232_77_547 155
282 3300049587 Ga0501071_0959591 Ga0501071_0959591_141_608 155
283 3300049591 Ga0501075_0641427 Ga0501075_0641427_41_508 155
284 3300049593 Ga0501077_0103061 Ga0501077_0103061_1245_1712 155
285 3300049741 Ga0501079_0353939 Ga0501079_0353939_358_825 155
286 3300049743 Ga0501081_0199505 Ga0501081_0199505_846_1313 155
287 3300049823 Ga0501044_0737576 Ga0501044_0737576_355_825 155
288 3300054114 Ga0501084_0150288 Ga0501084_0150288_480_947 155
289 3300060353 Ga0501082_0262361 Ga0501082_0262361_193_660 155
290 3300061734 Ga0530510_0062608 Ga0530510_0062608_1404_1871 155
291 iso_pu_bacteria 2582581280 2585150496 155
292 iso_pu_bacteria 2582581293 2585197686 155
293 iso_pu_bacteria 2643221545 2643750952 155
294 iso_pu_bacteria 2643221552 2643780799 155
295 iso_pu_bacteria 2643221584 2643931437 155
296 iso_pu_bacteria 2643221691 2644510025 155
297 iso_pu_bacteria 2791355048 2792462763 155
298 iso_pu_bacteria 2843744320 2843749509 155
299 iso_pu_bacteria 2849560528 2849562473 155
300 iso_pu_bacteria 2849573788 2849574936 155
301 iso_pu_bacteria 2898329390 2898332271 155
302 iso_pu_bacteria 2928972540 2928973444 155
303 3300047320 Ga0495672_0014805 Ga0495672_0014805_235_777 156
304 3300049571 Ga0501034_0246687 Ga0501034_0246687_1208_1687 157
305 3300003781 Ga0055536_1001525 Ga0055536_100152517 158
306 3300003781 Ga0055536_1019991 Ga0055536_10199915 158
307 3300003794 Ga0055531_10008457 Ga0055531_100084575 158
308 3300025292 Ga0209676_1000140 Ga0209676_1000140131 158
309 3300025298 Ga0209050_1009395 Ga0209050_10093956 158
310 3300025304 Ga0209257_1000630 Ga0209257_100063043 158
311 3300031824 Ga0307413_10085276 Ga0307413_100852763 158
312 3300031824 Ga0307413_11039356 Ga0307413_110393561 158
313 3300031901 Ga0307406_10001802 Ga0307406_100018028 158
314 3300031911 Ga0307412_10007240 Ga0307412_100072402 158
315 3300032004 Ga0307414_10008170 Ga0307414_100081703 158
316 3300032004 Ga0307414_10038833 Ga0307414_100388332 158
317 3300032004 Ga0307414_10393750 Ga0307414_103937501 158
318 3300032004 Ga0307414_10426620 Ga0307414_104266202 158
319 3300032004 Ga0307414_10431324 Ga0307414_104313242 158
320 3300042876 Ga0451577_1349090 Ga0451577_1349090_77_559 158
321 3300046522 Ga0495643_0140087 Ga0495643_0140087_162_638 158
322 3300046694 Ga0495649_0001927 Ga0495649_0001927_4803_5279 158
323 3300048928 Ga0496125_0000334 Ga0496125_0000334_65580_66056 158
324 3300053088 Ga0500644_0003373 Ga0500644_0003373_469_945 158
325 3300053093 Ga0500651_0032591 Ga0500651_0032591_2729_3205 158
326 3300053153 Ga0500616_0187798 Ga0500616_0187798_90_566 158
327 3300003215 JGI25153J46596_10051182 JGI25153J46596_100511822 159
328 3300003322 rootL2_10077638 rootL2_100776382 159
329 3300003322 rootL2_10077639 rootL2_100776393 159
330 3300003578 Ga0006562J51391_1091438 Ga0006562J51391_10914385 159
331 3300003578 Ga0006562J51391_1091439 Ga0006562J51391_10914398 159
332 3300003775 Ga0055524_1008397 Ga0055524_10083974 159
333 3300003794 Ga0055531_10073438 Ga0055531_100734381 159
334 3300005262 Ga0065165_1021762 Ga0065165_10217622 159
335 3300005327 Ga0070658_10182545 Ga0070658_101825452 159
336 3300005344 Ga0070661_100572328 Ga0070661_1005723281 159
337 3300005347 Ga0070668_100000734 Ga0070668_10000073416 159
338 3300005347 Ga0070668_100103145 Ga0070668_1001031452 159
339 3300005353 Ga0070669_100748027 Ga0070669_1007480272 159
340 3300005355 Ga0070671_100023883 Ga0070671_1000238835 159
341 3300005366 Ga0070659_100000700 Ga0070659_10000070012 159
342 3300005456 Ga0070678_100845985 Ga0070678_1008459851 159
343 3300005457 Ga0070662_100139956 Ga0070662_1001399562 159
344 3300005458 Ga0070681_10019859 Ga0070681_1001985912 159
345 3300005530 Ga0070679_100085752 Ga0070679_1000857522 159
346 3300005530 Ga0070679_100884699 Ga0070679_1008846992 159
347 3300005535 Ga0070684_101534509 Ga0070684_1015345091 159
348 3300005539 Ga0068853_100000534 Ga0068853_10000053422 159
349 3300005539 Ga0068853_100194853 Ga0068853_1001948532 159
350 3300005539 Ga0068853_100257291 Ga0068853_1002572912 159
351 3300005539 Ga0068853_101132536 Ga0068853_1011325361 159
352 3300005548 Ga0070665_100015124 Ga0070665_1000151242 159
353 3300005548 Ga0070665_100070014 Ga0070665_1000700144 159
354 3300005548 Ga0070665_100631768 Ga0070665_1006317681 159
355 3300005563 Ga0068855_100243222 Ga0068855_1002432222 159
356 3300005563 Ga0068855_100835390 Ga0068855_1008353902 159
357 3300005577 Ga0068857_100094168 Ga0068857_1000941682 159
358 3300005577 Ga0068857_101083390 Ga0068857_1010833902 159
359 3300005614 Ga0068856_101274522 Ga0068856_1012745222 159
360 3300005616 Ga0068852_100323993 Ga0068852_1003239932 159
361 3300005618 Ga0068864_100105225 Ga0068864_1001052254 159
362 3300005618 Ga0068864_101309816 Ga0068864_1013098161 159
363 3300005718 Ga0068866_10664714 Ga0068866_106647141 159
364 3300005841 Ga0068863_100041347 Ga0068863_1000413473 159
365 3300005841 Ga0068863_100149956 Ga0068863_1001499562 159
366 3300005843 Ga0068860_100000265 Ga0068860_10000026539 159
367 3300005844 Ga0068862_100077176 Ga0068862_1000771764 159
368 3300005844 Ga0068862_100454520 Ga0068862_1004545202 159
369 3300005844 Ga0068862_100648143 Ga0068862_1006481432 159
370 3300006051 Ga0075364_10001888 Ga0075364_100018889 159
371 3300006178 Ga0075367_10013041 Ga0075367_100130413 159
372 3300006237 Ga0097621_100989994 Ga0097621_1009899942 159
373 3300006353 Ga0075370_10296399 Ga0075370_102963991 159
374 3300006881 Ga0068865_100000449 Ga0068865_10000044917 159
375 3300009174 Ga0105241_12173908 Ga0105241_121739081 159
376 3300009176 Ga0105242_10312626 Ga0105242_103126262 159
377 3300009177 Ga0105248_10003125 Ga0105248_100031251 159
378 3300009177 Ga0105248_10005661 Ga0105248_100056613 159
379 3300009177 Ga0105248_10422353 Ga0105248_104223532 159
380 3300009177 Ga0105248_11186065 Ga0105248_111860652 159
381 3300009551 Ga0105238_10019180 Ga0105238_100191804 159
382 3300009551 Ga0105238_11074745 Ga0105238_110747452 159
383 3300013100 Ga0157373_10001950 Ga0157373_1000195010 159
384 3300013100 Ga0157373_10002460 Ga0157373_100024605 159
385 3300013102 Ga0157371_10006522 Ga0157371_1000652211 159
386 3300013104 Ga0157370_10017214 Ga0157370_100172146 159
387 3300013105 Ga0157369_10014296 Ga0157369_100142964 159
388 3300013105 Ga0157369_10763220 Ga0157369_107632202 159
389 3300013306 Ga0163162_10058506 Ga0163162_100585063 159
390 3300013308 Ga0157375_10388298 Ga0157375_103882982 159
391 3300014325 Ga0163163_10079552 Ga0163163_100795522 159
392 3300014325 Ga0163163_10127132 Ga0163163_101271323 159
393 3300014745 Ga0157377_10223414 Ga0157377_102234142 159
394 3300021384 Ga0213876_10068386 Ga0213876_100683862 159
395 3300025297 Ga0209758_1000923 Ga0209758_100092323 159
396 3300025298 Ga0209050_1091769 Ga0209050_10917691 159
397 3300025299 Ga0209256_1000535 Ga0209256_100053552 159
398 3300025304 Ga0209257_1002598 Ga0209257_100259816 159
399 3300025903 Ga0207680_10151584 Ga0207680_101515842 159
400 3300025908 Ga0207643_10960936 Ga0207643_109609361 159
401 3300025909 Ga0207705_10003940 Ga0207705_100039402 159
402 3300025912 Ga0207707_10023363 Ga0207707_100233635 159
403 3300025917 Ga0207660_10002074 Ga0207660_100020744 159
404 3300025919 Ga0207657_10010291 Ga0207657_100102912 159
405 3300025919 Ga0207657_10023114 Ga0207657_100231142 159
406 3300025919 Ga0207657_10023860 Ga0207657_100238606 159
407 3300025919 Ga0207657_10346208 Ga0207657_103462082 159
408 3300025920 Ga0207649_10324682 Ga0207649_103246822 159
409 3300025920 Ga0207649_10958900 Ga0207649_109589001 159
410 3300025921 Ga0207652_10243497 Ga0207652_102434972 159
411 3300025921 Ga0207652_10450870 Ga0207652_104508702 159
412 3300025924 Ga0207694_10013457 Ga0207694_100134575 159
413 3300025924 Ga0207694_10208618 Ga0207694_102086182 159
414 3300025931 Ga0207644_10018698 Ga0207644_100186982 159
415 3300025932 Ga0207690_10000220 Ga0207690_1000022038 159
416 3300025932 Ga0207690_10038293 Ga0207690_100382933 159
417 3300025932 Ga0207690_11164069 Ga0207690_111640692 159
418 3300025933 Ga0207706_10098290 Ga0207706_100982902 159
419 3300025938 Ga0207704_10002118 Ga0207704_100021188 159
420 3300025941 Ga0207711_10013999 Ga0207711_100139993 159
421 3300025941 Ga0207711_10080747 Ga0207711_100807471 159
422 3300025949 Ga0207667_10007379 Ga0207667_1000737918 159
423 3300025949 Ga0207667_10119203 Ga0207667_101192033 159
424 3300025972 Ga0207668_10015373 Ga0207668_100153736 159
425 3300025972 Ga0207668_10103597 Ga0207668_101035972 159
426 3300026023 Ga0207677_10081513 Ga0207677_100815132 159
427 3300026035 Ga0207703_10080296 Ga0207703_100802962 159
428 3300026041 Ga0207639_10001443 Ga0207639_100014438 159
429 3300026041 Ga0207639_10047578 Ga0207639_100475783 159
430 3300026041 Ga0207639_10112969 Ga0207639_101129692 159
431 3300026041 Ga0207639_11153864 Ga0207639_111538642 159
432 3300026067 Ga0207678_10224694 Ga0207678_102246942 159
433 3300026088 Ga0207641_10017443 Ga0207641_100174435 159
434 3300026088 Ga0207641_10274444 Ga0207641_102744442 159
435 3300026095 Ga0207676_10162893 Ga0207676_101628932 159
436 3300026116 Ga0207674_11712788 Ga0207674_117127882 159
437 3300026121 Ga0207683_10409218 Ga0207683_104092182 159
438 3300026142 Ga0207698_10262997 Ga0207698_102629972 159
439 3300027665 Ga0209983_1003823 Ga0209983_10038237 159
440 3300028379 Ga0268266_10325611 Ga0268266_103256112 159
441 3300028380 Ga0268265_10004161 Ga0268265_100041612 159
442 3300028380 Ga0268265_10644756 Ga0268265_106447562 159
443 3300028381 Ga0268264_10000318 Ga0268264_1000031829 159
444 3300028800 Ga0265338_10002913 Ga0265338_1000291312 159
445 3300028800 Ga0265338_10087299 Ga0265338_100872994 159
446 3300031251 Ga0265327_10001787 Ga0265327_100017876 159
447 3300031251 Ga0265327_10012400 Ga0265327_100124004 159
448 3300031711 Ga0265314_10048417 Ga0265314_100484175 159
449 3300031731 Ga0307405_10201817 Ga0307405_102018173 159
450 3300032004 Ga0307414_10522788 Ga0307414_105227882 159
451 3300033180 Ga0307510_10298923 Ga0307510_102989232 159
452 3300035083 Ga0373926_0353601 Ga0373926_0353601_60_539 159
453 3300035089 Ga0373944_0030079 Ga0373944_0030079_156_635 159
454 3300035695 Ga0373927_0000530 Ga0373927_0000530_17143_17622 159
455 3300037068 Ga0373925_0000089 Ga0373925_0000089_50347_50826 159
456 3300037312 Ga0395899_0001557 Ga0395899_0001557_6361_6840 159
457 3300037312 Ga0395899_0005180 Ga0395899_0005180_1674_2153 159
458 3300037312 Ga0395899_0415563 Ga0395899_0415563_284_763 159
459 3300037312 Ga0395899_0731061 Ga0395899_0731061_57_536 159
460 3300037418 Ga0395900_0000004 Ga0395900_0000004_225347_225826 159
461 3300037418 Ga0395900_0106571 Ga0395900_0106571_1453_1932 159
462 3300037418 Ga0395900_0593906 Ga0395900_0593906_459_938 159
463 3300037466 Ga0395898_0004167 Ga0395898_0004167_13471_13950 159
464 3300037466 Ga0395898_0559061 Ga0395898_0559061_155_634 159
465 3300037466 Ga0395898_0627220 Ga0395898_0627220_289_768 159
466 3300037466 Ga0395898_0698249 Ga0395898_0698249_170_649 159
467 3300037471 Ga0395905_0003519 Ga0395905_0003519_3925_4404 159
468 3300037471 Ga0395905_0032986 Ga0395905_0032986_426_905 159
469 3300037471 Ga0395905_0095786 Ga0395905_0095786_581_1060 159
470 3300037471 Ga0395905_0234957 Ga0395905_0234957_360_839 159
471 3300037471 Ga0395905_0400040 Ga0395905_0400040_176_655 159
472 3300038443 Ga0395901_0000005 Ga0395901_0000005_339740_340219 159
473 3300038443 Ga0395901_0107245 Ga0395901_0107245_1710_2189 159
474 3300038443 Ga0395901_0256316 Ga0395901_0256316_505_984 159
475 3300039437 Ga0436365_0773082 Ga0436365_0773082_3678_4157 159
476 3300039447 Ga0436361_0377648 Ga0436361_0377648_414_893 159
477 3300042127 Ga0450890_055412 Ga0450890_055412_62_568 159
478 3300042130 Ga0450892_012043 Ga0450892_012043_254_760 159
479 3300042436 Ga0439435_0003710 Ga0439435_0003710_418_897 159
480 3300045049 Ga0466959_0471781 Ga0466959_0471781_48_533 159
481 3300045051 Ga0451576_0264627 Ga0451576_0264627_380_859 159
482 3300046454 Ga0495592_0227448 Ga0495592_0227448_474_953 159
483 3300046459 Ga0495629_0019898 Ga0495629_0019898_3462_3941 159
484 3300046459 Ga0495629_0566272 Ga0495629_0566272_178_657 159
485 3300046473 Ga0495582_0344432 Ga0495582_0344432_219_698 159
486 3300046499 Ga0495594_0095541 Ga0495594_0095541_695_1174 159
487 3300046507 Ga0495606_0336293 Ga0495606_0336293_72_551 159
488 3300046516 Ga0495628_0649503 Ga0495628_0649503_192_671 159
489 3300046516 Ga0495628_0869866 Ga0495628_0869866_114_593 159
490 3300046522 Ga0495643_0103843 Ga0495643_0103843_426_905 159
491 3300046528 Ga0495642_0001865 Ga0495642_0001865_5613_6092 159
492 3300046528 Ga0495642_0090232 Ga0495642_0090232_726_1205 159
493 3300046537 Ga0495598_0149142 Ga0495598_0149142_196_675 159
494 3300046542 Ga0495597_0008223 Ga0495597_0008223_2115_2594 159
495 3300046557 Ga0495622_0002683 Ga0495622_0002683_4678_5157 159
496 3300046558 Ga0495633_0000400 Ga0495633_0000400_7624_8115 159
497 3300046558 Ga0495633_0185986 Ga0495633_0185986_388_867 159
498 3300046616 Ga0495668_0208207 Ga0495668_0208207_65_544 159
499 3300046616 Ga0495668_0393780 Ga0495668_0393780_206_685 159
500 3300046660 Ga0495625_0000165 Ga0495625_0000165_48716_49201 159
501 3300046660 Ga0495625_0004667 Ga0495625_0004667_4528_5007 159
502 3300046660 Ga0495625_0136368 Ga0495625_0136368_885_1364 159
503 3300046660 Ga0495625_0195375 Ga0495625_0195375_425_916 159
504 3300046660 Ga0495625_0323331 Ga0495625_0323331_443_922 159
505 3300046684 Ga0495669_0000008 Ga0495669_0000008_12072_12563 159
506 3300046684 Ga0495669_0023949 Ga0495669_0023949_1203_1682 159
507 3300047319 Ga0495674_0461864 Ga0495674_0461864_141_620 159
508 3300047472 Ga0495686_0171079 Ga0495686_0171079_691_1170 159
509 3300047472 Ga0495686_0274947 Ga0495686_0274947_271_753 159
510 3300047673 Ga0495593_0224050 Ga0495593_0224050_78_557 159
511 3300048088 Ga0495602_0454887 Ga0495602_0454887_232_711 159
512 3300048090 Ga0495615_0080535 Ga0495615_0080535_61_540 159
513 3300048904 Ga0496101_0910362 Ga0496101_0910362_20_499 159
514 3300048905 Ga0496102_0161842 Ga0496102_0161842_965_1444 159
515 3300048910 Ga0496107_0208392 Ga0496107_0208392_98_577 159
516 3300048910 Ga0496107_0783812 Ga0496107_0783812_157_636 159
517 3300048913 Ga0496110_0097061 Ga0496110_0097061_1143_1622 159
518 3300048915 Ga0496112_0111799 Ga0496112_0111799_1595_2074 159
519 3300048918 Ga0496115_0001534 Ga0496115_0001534_2761_3240 159
520 3300048918 Ga0496115_0016352 Ga0496115_0016352_1494_1973 159
521 3300048918 Ga0496115_0084360 Ga0496115_0084360_261_740 159
522 3300048918 Ga0496115_0235592 Ga0496115_0235592_767_1246 159
523 3300048919 Ga0496116_0388068 Ga0496116_0388068_61_540 159
524 3300048920 Ga0496117_0010947 Ga0496117_0010947_5507_5986 159
525 3300048921 Ga0496118_0017266 Ga0496118_0017266_360_839 159
526 3300048922 Ga0496119_0498977 Ga0496119_0498977_36_515 159
527 3300048924 Ga0496121_0000059 Ga0496121_0000059_19633_20112 159
528 3300048925 Ga0496122_0026937 Ga0496122_0026937_1091_1636 159
529 3300049460 Ga0495682_0250132 Ga0495682_0250132_104_583 159
530 3300049742 Ga0501080_0735942 Ga0501080_0735942_49_528 159
531 3300053086 Ga0500578_0213773 Ga0500578_0213773_163_642 159
532 3300053091 Ga0500647_0196311 Ga0500647_0196311_199_678 159
533 3300053092 Ga0500583_0232578 Ga0500583_0232578_342_821 159
534 3300053093 Ga0500651_0010034 Ga0500651_0010034_2035_2514 159
535 3300053094 Ga0500566_0110003 Ga0500566_0110003_890_1369 159
536 3300053096 Ga0500641_0085126 Ga0500641_0085126_580_1059 159
537 3300053102 Ga0500554_000600 Ga0500554_000600_5821_6300 159
538 3300053108 Ga0500562_000374 Ga0500562_000374_6010_6489 159
539 3300053108 Ga0500562_015463 Ga0500562_015463_1295_1774 159
540 3300053108 Ga0500562_034794 Ga0500562_034794_50_529 159
541 3300053109 Ga0500569_004887 Ga0500569_004887_160_639 159
542 3300053111 Ga0500572_000299 Ga0500572_000299_5019_5498 159
543 3300053119 Ga0500595_001544 Ga0500595_001544_9615_10094 159
544 3300053120 Ga0500597_070712 Ga0500597_070712_290_769 159
545 3300053121 Ga0500607_268988 Ga0500607_268988_160_639 159
546 3300053122 Ga0500608_001622 Ga0500608_001622_5239_5718 159
547 3300053123 Ga0500614_021544 Ga0500614_021544_431_910 159
548 3300053130 Ga0500642_0046791 Ga0500642_0046791_1229_1708 159
549 3300053136 Ga0500559_0003514 Ga0500559_0003514_3775_4260 159
550 3300053148 Ga0500590_013063 Ga0500590_013063_37_516 159
551 3300053154 Ga0500619_133924 Ga0500619_133924_193_672 159
552 3300053162 Ga0500638_169401 Ga0500638_169401_155_634 159
553 3300053177 Ga0500636_0094931 Ga0500636_0094931_621_1100 159
554 3300053178 Ga0500637_0038670 Ga0500637_0038670_1510_1989 159
555 3300053729 Ga0500625_128133 Ga0500625_128133_67_546 159
556 3300053735 Ga0500596_006623 Ga0500596_006623_955_1434 159
557 iso_pu_bacteria 2977240413 2977240578 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

110

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tt7-assembly1.cif.gz_H ovine atp synthase 1a state 0.8449 36 77
6ixg-assembly2.cif.gz_B crystal structure of native apo sh3bp5 (p41) 0.8152 35 77
6v7u-assembly1.cif.gz_B structure of a phage-encoded quorum sensing anti-activator, aqs1 0.8126 32 77
6v7v-assembly1.cif.gz_B structure of a phage-encoded quorum sensing anti-activator, aqs1 0.8083 32 77
8ap6-assembly1.cif.gz_H1 trypanosoma brucei mitochondrial f1fo atp synthase dimer 0.7804 35 77
ID Description Score Start End Superfamily
1grjA02 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.8875 83 156 3.10.50.30
af_Q2FXW7_79_158_3.10.50.30 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.8653 83 156 3.10.50.30
af_C6TGU6_233_320_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8479 33 78 1.20.58.160
af_Q20157_147_233_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8435 35 78 1.20.1280.290
2eulB02 Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain 0.8417 89 151 3.10.50.30
ID Description Score Start End GO Terms
AF-A0A519JJQ2-F1-model_v4 Transcription elongation factor 0.9911 91 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A519JJQ2-F1-model_v4 Transcription elongation factor 0.9765 91 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A0Q7F9H2-F1-model_v4 Transcription elongation factor 0.966 1 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A0Q7F9H2-F1-model_v4 Transcription elongation factor 0.96 1 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A4Q3UZ58-F1-model_v4 Transcription elongation factor 0.9578 64 156 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063

Feature Viewer

pLDDT pTM Quality
88.52 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map