F463309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 309 | 534 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10006522|Ga0157371_1000652211 |
| Length | 181 |
| Sequence | MPSLCPVAVALAIGAVIAMFRVMSVAFTREEDLEATAADLADRPISPHPNLVTPEGLAAIEAELASARAAYTAAQVQGSIESDRTAMARATRDLRYWSARRASAQLVAPTEDDGVVRFGGSVSIERDDGRAQTWRIVGEDEADPAAGSVSHVSPLARAVIGKRVGDEVTVAGQSAEIVAVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 2 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 3 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 4 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 5 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 6 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 7 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 8 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 9 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 10 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 11 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 12 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 13 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 14 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 15 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 16 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 17 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 18 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 19 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 20 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 21 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 22 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 196 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 197 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 285 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 287 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 288 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 289 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 290 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 291 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 292 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 294 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 295 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 296 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 298 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 301 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 302 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 304 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 305 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.33 |
| Metatranscriptomes | 0.54 |
| Isolates | 4.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.82 |
| Nodule | 0.36 |
| Rhizoplane | 4.85 |
| Rhizosphere | 75.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10051182 | 3300003215 | Bacteria | 1184 |
| 2 | rootL2_10077638 | 3300003322 | Bacteria | 2241 |
| 3 | rootL2_10077639 | 3300003322 | Bacteria | 1312 |
| 4 | Ga0006562J51391_1091438 | 3300003578 | Bacteria | 12093 |
| 5 | Ga0006562J51391_1091439 | 3300003578 | Bacteria | 11750 |
| 6 | Ga0055524_1008397 | 3300003775 | Bacteria | 4294 |
| 7 | Ga0055536_1001525 | 3300003781 | Bacteria | 13899 |
| 8 | Ga0055536_1019991 | 3300003781 | Bacteria | 2085 |
| 9 | Ga0055536_1053718 | 3300003781 | Bacteria | 870 |
| 10 | Ga0055530_10000148 | 3300003791 | Bacteria | 63227 |
| 11 | Ga0055531_10008457 | 3300003794 | Bacteria | 5419 |
| 12 | Ga0055531_10022227 | 3300003794 | Bacteria | 2425 |
| 13 | Ga0055531_10073438 | 3300003794 | Bacteria | 779 |
| 14 | Ga0065165_1001734 | 3300005262 | Bacteria | 21806 |
| 15 | Ga0065165_1021762 | 3300005262 | Bacteria | 2217 |
| 16 | Ga0070658_10182545 | 3300005327 | Bacteria | 1766 |
| 17 | Ga0070658_11167315 | 3300005327 | Bacteria | 670 |
| 18 | Ga0070683_100280840 | 3300005329 | Bacteria | 1584 |
| 19 | Ga0070683_101265911 | 3300005329 | Unclassified | 709 |
| 20 | Ga0070670_100065510 | 3300005331 | Bacteria | 3117 |
| 21 | Ga0070670_101815265 | 3300005331 | Unclassified | 561 |
| 22 | Ga0070666_10057739 | 3300005335 | Bacteria | 2623 |
| 23 | Ga0070680_100029103 | 3300005336 | Bacteria | 4436 |
| 24 | Ga0070680_100271719 | 3300005336 | Bacteria | 1435 |
| 25 | Ga0070682_100184566 | 3300005337 | Bacteria | 1460 |
| 26 | Ga0070660_100008830 | 3300005339 | Bacteria | 7065 |
| 27 | Ga0070660_100053765 | 3300005339 | Bacteria | 3107 |
| 28 | Ga0070660_100290864 | 3300005339 | Unclassified | 1338 |
| 29 | Ga0070660_100329941 | 3300005339 | Unclassified | 1254 |
| 30 | Ga0070660_100458878 | 3300005339 | Bacteria | 1058 |
| 31 | Ga0070691_10000826 | 3300005341 | Bacteria | 12446 |
| 32 | Ga0070691_10098329 | 3300005341 | Bacteria | 1451 |
| 33 | Ga0070661_100572328 | 3300005344 | Bacteria | 911 |
| 34 | Ga0070661_100664694 | 3300005344 | Bacteria | 847 |
| 35 | Ga0070668_100000232 | 3300005347 | Bacteria | 36360 |
| 36 | Ga0070668_100000734 | 3300005347 | Bacteria | 22404 |
| 37 | Ga0070668_100003407 | 3300005347 | Bacteria | 11738 |
| 38 | Ga0070668_100011657 | 3300005347 | Bacteria | 6543 |
| 39 | Ga0070668_100103145 | 3300005347 | Bacteria | 2263 |
| 40 | Ga0070668_100116099 | 3300005347 | Unclassified | 2134 |
| 41 | Ga0070669_100357328 | 3300005353 | Bacteria | 1187 |
| 42 | Ga0070669_100748027 | 3300005353 | Bacteria | 828 |
| 43 | Ga0070675_100411185 | 3300005354 | Unclassified | 1208 |
| 44 | Ga0070671_100023883 | 3300005355 | Bacteria | 5003 |
| 45 | Ga0070671_100285054 | 3300005355 | Bacteria | 1405 |
| 46 | Ga0070673_100564532 | 3300005364 | Bacteria | 1035 |
| 47 | Ga0070659_100000010 | 3300005366 | Bacteria | 188277 |
| 48 | Ga0070659_100000700 | 3300005366 | Bacteria | 24395 |
| 49 | Ga0070667_100000118 | 3300005367 | Bacteria | 100395 |
| 50 | Ga0070667_100006285 | 3300005367 | Bacteria | 9873 |
| 51 | Ga0070667_100007513 | 3300005367 | Bacteria | 9039 |
| 52 | Ga0070703_10153815 | 3300005406 | Bacteria | 866 |
| 53 | Ga0070709_10262413 | 3300005434 | Bacteria | 1248 |
| 54 | Ga0070713_100153140 | 3300005436 | Bacteria | 2053 |
| 55 | Ga0070663_100440190 | 3300005455 | Unclassified | 1072 |
| 56 | Ga0070678_100816857 | 3300005456 | Unclassified | 847 |
| 57 | Ga0070678_100845985 | 3300005456 | Bacteria | 833 |
| 58 | Ga0070662_100139956 | 3300005457 | Bacteria | 1874 |
| 59 | Ga0070681_10019859 | 3300005458 | Bacteria | 6731 |
| 60 | Ga0070681_10049985 | 3300005458 | Bacteria | 4173 |
| 61 | Ga0070706_100258368 | 3300005467 | Bacteria | 1626 |
| 62 | Ga0070707_100972997 | 3300005468 | Bacteria | 814 |
| 63 | Ga0070679_100014486 | 3300005530 | Bacteria | 7574 |
| 64 | Ga0070679_100085752 | 3300005530 | Bacteria | 3136 |
| 65 | Ga0070679_100884699 | 3300005530 | Bacteria | 836 |
| 66 | Ga0070684_101534509 | 3300005535 | Bacteria | 628 |
| 67 | Ga0068853_100000534 | 3300005539 | Bacteria | 25841 |
| 68 | Ga0068853_100194853 | 3300005539 | Bacteria | 1842 |
| 69 | Ga0068853_100257291 | 3300005539 | Bacteria | 1604 |
| 70 | Ga0068853_101132536 | 3300005539 | Bacteria | 755 |
| 71 | Ga0070696_101129388 | 3300005546 | Unclassified | 660 |
| 72 | Ga0070665_100000451 | 3300005548 | Bacteria | 59861 |
| 73 | Ga0070665_100000713 | 3300005548 | Bacteria | 44311 |
| 74 | Ga0070665_100015124 | 3300005548 | Bacteria | 7746 |
| 75 | Ga0070665_100070014 | 3300005548 | Bacteria | 3515 |
| 76 | Ga0070665_100631768 | 3300005548 | Bacteria | 1084 |
| 77 | Ga0070665_101378309 | 3300005548 | Unclassified | 714 |
| 78 | Ga0068855_100056463 | 3300005563 | Bacteria | 4607 |
| 79 | Ga0068855_100243222 | 3300005563 | Bacteria | 2010 |
| 80 | Ga0068855_100835390 | 3300005563 | Bacteria | 977 |
| 81 | Ga0070664_100121654 | 3300005564 | Bacteria | 2286 |
| 82 | Ga0068857_100094168 | 3300005577 | Bacteria | 2682 |
| 83 | Ga0068857_101083390 | 3300005577 | Bacteria | 773 |
| 84 | Ga0068856_100485167 | 3300005614 | Unclassified | 1257 |
| 85 | Ga0068856_100522709 | 3300005614 | Bacteria | 1208 |
| 86 | Ga0068856_101274522 | 3300005614 | Bacteria | 750 |
| 87 | Ga0068852_100323993 | 3300005616 | Bacteria | 1497 |
| 88 | Ga0068859_100059997 | 3300005617 | Bacteria | 3833 |
| 89 | Ga0068859_100061095 | 3300005617 | Bacteria | 3797 |
| 90 | Ga0068864_100000038 | 3300005618 | Bacteria | 181005 |
| 91 | Ga0068864_100000206 | 3300005618 | Bacteria | 53509 |
| 92 | Ga0068864_100025449 | 3300005618 | Bacteria | 4983 |
| 93 | Ga0068864_100098545 | 3300005618 | Bacteria | 2589 |
| 94 | Ga0068864_100105225 | 3300005618 | Bacteria | 2508 |
| 95 | Ga0068864_101309816 | 3300005618 | Bacteria | 725 |
| 96 | Ga0068866_10664714 | 3300005718 | Bacteria | 711 |
| 97 | Ga0068861_100119367 | 3300005719 | Bacteria | 2125 |
| 98 | Ga0068863_100000026 | 3300005841 | Bacteria | 185590 |
| 99 | Ga0068863_100000071 | 3300005841 | Bacteria | 115525 |
| 100 | Ga0068863_100027342 | 3300005841 | Bacteria | 5440 |
| 101 | Ga0068863_100041347 | 3300005841 | Bacteria | 4383 |
| 102 | Ga0068863_100149956 | 3300005841 | Bacteria | 2231 |
| 103 | Ga0068863_100181944 | 3300005841 | Bacteria | 2018 |
| 104 | Ga0068858_100000061 | 3300005842 | Bacteria | 113998 |
| 105 | Ga0068858_100006858 | 3300005842 | Bacteria | 11070 |
| 106 | Ga0068860_100000205 | 3300005843 | Bacteria | 93929 |
| 107 | Ga0068860_100000265 | 3300005843 | Bacteria | 76672 |
| 108 | Ga0068860_100153126 | 3300005843 | Bacteria | 2221 |
| 109 | Ga0068860_100169550 | 3300005843 | Bacteria | 2108 |
| 110 | Ga0068862_100000057 | 3300005844 | Bacteria | 140795 |
| 111 | Ga0068862_100051334 | 3300005844 | Bacteria | 3527 |
| 112 | Ga0068862_100067787 | 3300005844 | Bacteria | 3077 |
| 113 | Ga0068862_100077176 | 3300005844 | Bacteria | 2884 |
| 114 | Ga0068862_100127035 | 3300005844 | Bacteria | 2252 |
| 115 | Ga0068862_100454520 | 3300005844 | Bacteria | 1208 |
| 116 | Ga0068862_100648143 | 3300005844 | Bacteria | 1018 |
| 117 | Ga0070717_10908624 | 3300006028 | Bacteria | 802 |
| 118 | Ga0070717_11128762 | 3300006028 | Bacteria | 714 |
| 119 | Ga0075365_10085818 | 3300006038 | Unclassified | 2138 |
| 120 | Ga0075365_10214432 | 3300006038 | Bacteria | 1350 |
| 121 | Ga0075365_10440209 | 3300006038 | Unclassified | 920 |
| 122 | Ga0075368_10045417 | 3300006042 | Bacteria | 1735 |
| 123 | Ga0075363_100191868 | 3300006048 | Bacteria | 1165 |
| 124 | Ga0075364_10001888 | 3300006051 | Bacteria | 11635 |
| 125 | Ga0075364_10412619 | 3300006051 | Unclassified | 922 |
| 126 | Ga0075362_10138819 | 3300006177 | Bacteria | 1161 |
| 127 | Ga0075367_10013041 | 3300006178 | Bacteria | 4454 |
| 128 | Ga0075367_10114707 | 3300006178 | Bacteria | 1656 |
| 129 | Ga0075366_10119854 | 3300006195 | Bacteria | 1585 |
| 130 | Ga0097621_100989994 | 3300006237 | Bacteria | 786 |
| 131 | Ga0075370_10035551 | 3300006353 | Bacteria | 2796 |
| 132 | Ga0075370_10296399 | 3300006353 | Bacteria | 961 |
| 133 | Ga0075428_100008355 | 3300006844 | Bacteria | 11479 |
| 134 | Ga0075428_100111928 | 3300006844 | Bacteria | 2974 |
| 135 | Ga0075430_100015743 | 3300006846 | Bacteria | 6441 |
| 136 | Ga0075430_100535707 | 3300006846 | Bacteria | 966 |
| 137 | Ga0075431_100002242 | 3300006847 | Bacteria | 18532 |
| 138 | Ga0075431_100410919 | 3300006847 | Bacteria | 1353 |
| 139 | Ga0075434_100960548 | 3300006871 | Unclassified | 869 |
| 140 | Ga0075429_100008008 | 3300006880 | Bacteria | 9178 |
| 141 | Ga0075429_100156015 | 3300006880 | Bacteria | 1999 |
| 142 | Ga0068865_100000449 | 3300006881 | Bacteria | 22886 |
| 143 | Ga0075436_100033596 | 3300006914 | Bacteria | 3536 |
| 144 | Ga0097620_100059998 | 3300006931 | Bacteria | 3833 |
| 145 | Ga0097620_100061095 | 3300006931 | Bacteria | 3797 |
| 146 | Ga0105250_10077955 | 3300009092 | Bacteria | 1341 |
| 147 | Ga0111539_10000200 | 3300009094 | Bacteria | 70531 |
| 148 | Ga0111539_10894783 | 3300009094 | Bacteria | 1032 |
| 149 | Ga0105245_10094769 | 3300009098 | Bacteria | 2752 |
| 150 | Ga0105247_10049867 | 3300009101 | Bacteria | 2575 |
| 151 | Ga0114129_10000205 | 3300009147 | Bacteria | 65770 |
| 152 | Ga0105241_12173908 | 3300009174 | Bacteria | 550 |
| 153 | Ga0105242_10312626 | 3300009176 | Bacteria | 1438 |
| 154 | Ga0105248_10001337 | 3300009177 | Bacteria | 27446 |
| 155 | Ga0105248_10003125 | 3300009177 | Bacteria | 18322 |
| 156 | Ga0105248_10005661 | 3300009177 | Bacteria | 13725 |
| 157 | Ga0105248_10131795 | 3300009177 | Unclassified | 2820 |
| 158 | Ga0105248_10382830 | 3300009177 | Bacteria | 1584 |
| 159 | Ga0105248_10422353 | 3300009177 | Bacteria | 1502 |
| 160 | Ga0105248_11186065 | 3300009177 | Bacteria | 863 |
| 161 | Ga0105237_10327637 | 3300009545 | Unclassified | 1535 |
| 162 | Ga0105238_10019180 | 3300009551 | Bacteria | 6968 |
| 163 | Ga0105238_10020446 | 3300009551 | Bacteria | 6739 |
| 164 | Ga0105238_11074745 | 3300009551 | Bacteria | 827 |
| 165 | Ga0105249_10082294 | 3300009553 | Bacteria | 2995 |
| 166 | Ga0105249_10109792 | 3300009553 | Bacteria | 2605 |
| 167 | Ga0105249_10326058 | 3300009553 | Unclassified | 1548 |
| 168 | Ga0157373_10001950 | 3300013100 | Bacteria | 15645 |
| 169 | Ga0157373_10002460 | 3300013100 | Bacteria | 14114 |
| 170 | Ga0157371_10006522 | 3300013102 | Bacteria | 9603 |
| 171 | Ga0157370_10017214 | 3300013104 | Bacteria | 7295 |
| 172 | Ga0157370_10033772 | 3300013104 | Bacteria | 4986 |
| 173 | Ga0157370_10284188 | 3300013104 | Bacteria | 1528 |
| 174 | Ga0157369_10014296 | 3300013105 | Bacteria | 8966 |
| 175 | Ga0157369_10025502 | 3300013105 | Bacteria | 6563 |
| 176 | Ga0157369_10041248 | 3300013105 | Bacteria | 5038 |
| 177 | Ga0157369_10763220 | 3300013105 | Bacteria | 994 |
| 178 | Ga0157369_10813879 | 3300013105 | Unclassified | 959 |
| 179 | Ga0157374_10117104 | 3300013296 | Bacteria | 2568 |
| 180 | Ga0163162_10041067 | 3300013306 | Bacteria | 4628 |
| 181 | Ga0163162_10058506 | 3300013306 | Bacteria | 3883 |
| 182 | Ga0157372_11116299 | 3300013307 | Bacteria | 912 |
| 183 | Ga0157375_10388298 | 3300013308 | Bacteria | 1563 |
| 184 | Ga0163163_10017368 | 3300014325 | Bacteria | 6709 |
| 185 | Ga0163163_10021156 | 3300014325 | Bacteria | 6137 |
| 186 | Ga0163163_10079552 | 3300014325 | Bacteria | 3276 |
| 187 | Ga0163163_10127132 | 3300014325 | Bacteria | 2587 |
| 188 | Ga0163163_10214952 | 3300014325 | Bacteria | 1972 |
| 189 | Ga0163163_11263488 | 3300014325 | Bacteria | 801 |
| 190 | Ga0157377_10223414 | 3300014745 | Bacteria | 1207 |
| 191 | Ga0157377_10243372 | 3300014745 | Unclassified | 1162 |
| 192 | Ga0157379_10025233 | 3300014968 | Bacteria | 5278 |
| 193 | Ga0157379_10053177 | 3300014968 | Bacteria | 3618 |
| 194 | Ga0157379_11177657 | 3300014968 | Bacteria | 736 |
| 195 | Ga0157376_10903565 | 3300014969 | Bacteria | 901 |
| 196 | Ga0206354_10645515 | 3300020081 | Bacteria | 1189 |
| 197 | Ga0213876_10068386 | 3300021384 | Bacteria | 1876 |
| 198 | Ga0209676_1000140 | 3300025292 | Bacteria | 176735 |
| 199 | Ga0209676_1001867 | 3300025292 | Bacteria | 17330 |
| 200 | Ga0209758_1000733 | 3300025297 | Bacteria | 47932 |
| 201 | Ga0209758_1000923 | 3300025297 | Bacteria | 39720 |
| 202 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 203 | Ga0209050_1009395 | 3300025298 | Bacteria | 5012 |
| 204 | Ga0209050_1091769 | 3300025298 | Bacteria | 620 |
| 205 | Ga0209256_1000535 | 3300025299 | Bacteria | 55077 |
| 206 | Ga0209257_1000630 | 3300025304 | Bacteria | 56658 |
| 207 | Ga0209257_1000714 | 3300025304 | Bacteria | 51177 |
| 208 | Ga0209257_1002598 | 3300025304 | Bacteria | 17521 |
| 209 | Ga0207710_10210631 | 3300025900 | Bacteria | 962 |
| 210 | Ga0207680_10151584 | 3300025903 | Bacteria | 1546 |
| 211 | Ga0207645_10640502 | 3300025907 | Bacteria | 722 |
| 212 | Ga0207643_10960936 | 3300025908 | Bacteria | 553 |
| 213 | Ga0207705_10003940 | 3300025909 | Bacteria | 11287 |
| 214 | Ga0207707_10023363 | 3300025912 | Bacteria | 5409 |
| 215 | Ga0207707_10037163 | 3300025912 | Bacteria | 4254 |
| 216 | Ga0207707_10104910 | 3300025912 | Bacteria | 2470 |
| 217 | Ga0207671_10275971 | 3300025914 | Unclassified | 1325 |
| 218 | Ga0207660_10002074 | 3300025917 | Bacteria | 13290 |
| 219 | Ga0207660_10025550 | 3300025917 | Bacteria | 4010 |
| 220 | Ga0207660_10199121 | 3300025917 | Bacteria | 1564 |
| 221 | Ga0207657_10010291 | 3300025919 | Bacteria | 9339 |
| 222 | Ga0207657_10023114 | 3300025919 | Bacteria | 5797 |
| 223 | Ga0207657_10023860 | 3300025919 | Bacteria | 5683 |
| 224 | Ga0207657_10191817 | 3300025919 | Bacteria | 1648 |
| 225 | Ga0207657_10346208 | 3300025919 | Bacteria | 1173 |
| 226 | Ga0207649_10324682 | 3300025920 | Bacteria | 1132 |
| 227 | Ga0207649_10441367 | 3300025920 | Bacteria | 981 |
| 228 | Ga0207649_10958900 | 3300025920 | Bacteria | 672 |
| 229 | Ga0207652_10243497 | 3300025921 | Bacteria | 1621 |
| 230 | Ga0207652_10403421 | 3300025921 | Bacteria | 1233 |
| 231 | Ga0207652_10450870 | 3300025921 | Bacteria | 1160 |
| 232 | Ga0207646_10772307 | 3300025922 | Bacteria | 857 |
| 233 | Ga0207681_10289510 | 3300025923 | Bacteria | 1292 |
| 234 | Ga0207694_10013457 | 3300025924 | Bacteria | 6163 |
| 235 | Ga0207694_10208618 | 3300025924 | Bacteria | 1591 |
| 236 | Ga0207650_10000032 | 3300025925 | Bacteria | 229538 |
| 237 | Ga0207650_10054701 | 3300025925 | Bacteria | 2962 |
| 238 | Ga0207644_10018698 | 3300025931 | Bacteria | 4690 |
| 239 | Ga0207644_10447886 | 3300025931 | Bacteria | 1060 |
| 240 | Ga0207690_10000020 | 3300025932 | Bacteria | 218439 |
| 241 | Ga0207690_10000220 | 3300025932 | Bacteria | 43152 |
| 242 | Ga0207690_10038293 | 3300025932 | Bacteria | 3119 |
| 243 | Ga0207690_11164069 | 3300025932 | Bacteria | 643 |
| 244 | Ga0207706_10098290 | 3300025933 | Bacteria | 2575 |
| 245 | Ga0207704_10002118 | 3300025938 | Bacteria | 8896 |
| 246 | Ga0207711_10000882 | 3300025941 | Bacteria | 28942 |
| 247 | Ga0207711_10013999 | 3300025941 | Bacteria | 6662 |
| 248 | Ga0207711_10080747 | 3300025941 | Bacteria | 2841 |
| 249 | Ga0207711_10274752 | 3300025941 | Bacteria | 1551 |
| 250 | Ga0207679_10110204 | 3300025945 | Bacteria | 2171 |
| 251 | Ga0207679_10491486 | 3300025945 | Bacteria | 1094 |
| 252 | Ga0207667_10006965 | 3300025949 | Bacteria | 13667 |
| 253 | Ga0207667_10007379 | 3300025949 | Bacteria | 13229 |
| 254 | Ga0207667_10017722 | 3300025949 | Bacteria | 8010 |
| 255 | Ga0207667_10119203 | 3300025949 | Bacteria | 2720 |
| 256 | Ga0207651_10378353 | 3300025960 | Bacteria | 1199 |
| 257 | Ga0207712_10002979 | 3300025961 | Bacteria | 10809 |
| 258 | Ga0207712_10227088 | 3300025961 | Bacteria | 1496 |
| 259 | Ga0207668_10000015 | 3300025972 | Bacteria | 162011 |
| 260 | Ga0207668_10000097 | 3300025972 | Bacteria | 62270 |
| 261 | Ga0207668_10015373 | 3300025972 | Bacteria | 4754 |
| 262 | Ga0207668_10030919 | 3300025972 | Bacteria | 3522 |
| 263 | Ga0207668_10103597 | 3300025972 | Bacteria | 2119 |
| 264 | Ga0207668_10454670 | 3300025972 | Unclassified | 1094 |
| 265 | Ga0207640_10574285 | 3300025981 | Unclassified | 951 |
| 266 | Ga0207658_10000116 | 3300025986 | Bacteria | 88456 |
| 267 | Ga0207658_10002733 | 3300025986 | Bacteria | 12743 |
| 268 | Ga0207658_10037217 | 3300025986 | Bacteria | 3494 |
| 269 | Ga0207677_10000131 | 3300026023 | Bacteria | 61645 |
| 270 | Ga0207677_10081513 | 3300026023 | Bacteria | 2322 |
| 271 | Ga0207703_10000149 | 3300026035 | Bacteria | 80168 |
| 272 | Ga0207703_10006513 | 3300026035 | Bacteria | 9318 |
| 273 | Ga0207703_10080296 | 3300026035 | Bacteria | 2716 |
| 274 | Ga0207639_10001443 | 3300026041 | Bacteria | 16009 |
| 275 | Ga0207639_10047578 | 3300026041 | Bacteria | 3242 |
| 276 | Ga0207639_10101388 | 3300026041 | Bacteria | 2328 |
| 277 | Ga0207639_10112969 | 3300026041 | Bacteria | 2218 |
| 278 | Ga0207639_10590407 | 3300026041 | Bacteria | 1023 |
| 279 | Ga0207639_11153864 | 3300026041 | Bacteria | 727 |
| 280 | Ga0207678_10224694 | 3300026067 | Bacteria | 1607 |
| 281 | Ga0207678_10486210 | 3300026067 | Unclassified | 1075 |
| 282 | Ga0207708_10302129 | 3300026075 | Bacteria | 1302 |
| 283 | Ga0207708_11432003 | 3300026075 | Unclassified | 607 |
| 284 | Ga0207702_10565760 | 3300026078 | Unclassified | 1113 |
| 285 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 286 | Ga0207641_10010502 | 3300026088 | Bacteria | 7600 |
| 287 | Ga0207641_10017443 | 3300026088 | Bacteria | 5878 |
| 288 | Ga0207641_10049420 | 3300026088 | Bacteria | 3554 |
| 289 | Ga0207641_10274444 | 3300026088 | Bacteria | 1583 |
| 290 | Ga0207641_11009256 | 3300026088 | Bacteria | 829 |
| 291 | Ga0207676_10000085 | 3300026095 | Bacteria | 90147 |
| 292 | Ga0207676_10000237 | 3300026095 | Bacteria | 48354 |
| 293 | Ga0207676_10162893 | 3300026095 | Bacteria | 1934 |
| 294 | Ga0207674_11712788 | 3300026116 | Bacteria | 597 |
| 295 | Ga0207675_100063497 | 3300026118 | Bacteria | 3450 |
| 296 | Ga0207675_101223857 | 3300026118 | Unclassified | 771 |
| 297 | Ga0207683_10342524 | 3300026121 | Bacteria | 1371 |
| 298 | Ga0207683_10409218 | 3300026121 | Bacteria | 1248 |
| 299 | Ga0207683_11107549 | 3300026121 | Bacteria | 735 |
| 300 | Ga0207698_10262997 | 3300026142 | Bacteria | 1586 |
| 301 | Ga0209983_1003823 | 3300027665 | Bacteria | 3190 |
| 302 | Ga0207428_10025712 | 3300027907 | Bacteria | 4924 |
| 303 | Ga0268266_10000273 | 3300028379 | Bacteria | 85325 |
| 304 | Ga0268266_10292041 | 3300028379 | Bacteria | 1518 |
| 305 | Ga0268266_10325611 | 3300028379 | Bacteria | 1439 |
| 306 | Ga0268266_11793544 | 3300028379 | Unclassified | 588 |
| 307 | Ga0268265_10004161 | 3300028380 | Bacteria | 10139 |
| 308 | Ga0268265_10048299 | 3300028380 | Bacteria | 3194 |
| 309 | Ga0268265_10106666 | 3300028380 | Bacteria | 2276 |
| 310 | Ga0268265_10644756 | 3300028380 | Bacteria | 1017 |
| 311 | Ga0268264_10000202 | 3300028381 | Bacteria | 121481 |
| 312 | Ga0268264_10000318 | 3300028381 | Bacteria | 76687 |
| 313 | Ga0268264_10026808 | 3300028381 | Bacteria | 4708 |
| 314 | Ga0265338_10002913 | 3300028800 | Bacteria | 24860 |
| 315 | Ga0265338_10087299 | 3300028800 | Bacteria | 2592 |
| 316 | Ga0307511_10023924 | 3300030521 | Bacteria | 5679 |
| 317 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 318 | Ga0265327_10001787 | 3300031251 | Bacteria | 25269 |
| 319 | Ga0265327_10012400 | 3300031251 | Bacteria | 5756 |
| 320 | Ga0307508_10370166 | 3300031616 | Bacteria | 1024 |
| 321 | Ga0265314_10048417 | 3300031711 | Bacteria | 2984 |
| 322 | Ga0307405_10201817 | 3300031731 | Bacteria | 1445 |
| 323 | Ga0307413_10085276 | 3300031824 | Bacteria | 2039 |
| 324 | Ga0307413_11039356 | 3300031824 | Bacteria | 704 |
| 325 | Ga0307406_10001802 | 3300031901 | Bacteria | 11708 |
| 326 | Ga0307412_10007240 | 3300031911 | Bacteria | 6292 |
| 327 | Ga0307414_10008170 | 3300032004 | Bacteria | 5917 |
| 328 | Ga0307414_10038833 | 3300032004 | Bacteria | 3201 |
| 329 | Ga0307414_10052082 | 3300032004 | Bacteria | 2846 |
| 330 | Ga0307414_10117827 | 3300032004 | Bacteria | 2035 |
| 331 | Ga0307414_10168472 | 3300032004 | Bacteria | 1748 |
| 332 | Ga0307414_10393750 | 3300032004 | Bacteria | 1201 |
| 333 | Ga0307414_10426620 | 3300032004 | Bacteria | 1157 |
| 334 | Ga0307414_10431324 | 3300032004 | Bacteria | 1151 |
| 335 | Ga0307414_10522788 | 3300032004 | Bacteria | 1053 |
| 336 | Ga0307414_10924964 | 3300032004 | Bacteria | 800 |
| 337 | Ga0307414_11096352 | 3300032004 | Bacteria | 735 |
| 338 | Ga0307510_10298923 | 3300033180 | Bacteria | 1073 |
| 339 | Ga0373926_0353601 | 3300035083 | Bacteria | 577 |
| 340 | Ga0373926_0405616 | 3300035083 | Unclassified | 538 |
| 341 | Ga0373944_0030079 | 3300035089 | Bacteria | 1627 |
| 342 | Ga0373949_0207747 | 3300035090 | Bacteria | 590 |
| 343 | Ga0373945_0016317 | 3300035116 | Bacteria | 2503 |
| 344 | Ga0373943_0441655 | 3300035170 | Bacteria | 755 |
| 345 | Ga0373946_0155074 | 3300035171 | Bacteria | 1071 |
| 346 | Ga0373931_0580329 | 3300035691 | Unclassified | 731 |
| 347 | Ga0373935_0157263 | 3300035692 | Bacteria | 1547 |
| 348 | Ga0373927_0000530 | 3300035695 | Bacteria | 28952 |
| 349 | Ga0373925_0000089 | 3300037068 | Bacteria | 98449 |
| 350 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 351 | Ga0395899_0001557 | 3300037312 | Bacteria | 19328 |
| 352 | Ga0395899_0005180 | 3300037312 | Bacteria | 10143 |
| 353 | Ga0395899_0415563 | 3300037312 | Bacteria | 887 |
| 354 | Ga0395899_0731061 | 3300037312 | Bacteria | 618 |
| 355 | Ga0395900_0000004 | 3300037418 | Bacteria | 564908 |
| 356 | Ga0395900_0106571 | 3300037418 | Bacteria | 2879 |
| 357 | Ga0395900_0593906 | 3300037418 | Bacteria | 1048 |
| 358 | Ga0395898_0004167 | 3300037466 | Bacteria | 15841 |
| 359 | Ga0395898_0113459 | 3300037466 | Bacteria | 2597 |
| 360 | Ga0395898_0559061 | 3300037466 | Bacteria | 1086 |
| 361 | Ga0395898_0627220 | 3300037466 | Bacteria | 1017 |
| 362 | Ga0395898_0698249 | 3300037466 | Bacteria | 956 |
| 363 | Ga0395905_0003519 | 3300037471 | Bacteria | 16701 |
| 364 | Ga0395905_0032986 | 3300037471 | Bacteria | 4868 |
| 365 | Ga0395905_0095786 | 3300037471 | Bacteria | 2786 |
| 366 | Ga0395905_0234957 | 3300037471 | Bacteria | 1714 |
| 367 | Ga0395905_0400040 | 3300037471 | Bacteria | 1268 |
| 368 | Ga0395901_0000005 | 3300038443 | Bacteria | 544998 |
| 369 | Ga0395901_0107245 | 3300038443 | Bacteria | 2932 |
| 370 | Ga0395901_0256316 | 3300038443 | Bacteria | 1822 |
| 371 | Ga0436365_0773082 | 3300039437 | Bacteria | 5259 |
| 372 | Ga0436361_0343753 | 3300039447 | Bacteria | 627 |
| 373 | Ga0436361_0377648 | 3300039447 | Bacteria | 1049 |
| 374 | Ga0450890_055412 | 3300042127 | Bacteria | 612 |
| 375 | Ga0450892_012043 | 3300042130 | Bacteria | 774 |
| 376 | Ga0439435_0003710 | 3300042436 | Bacteria | 3207 |
| 377 | Ga0451577_1349090 | 3300042876 | Unclassified | 633 |
| 378 | Ga0466959_0471781 | 3300045049 | Bacteria | 850 |
| 379 | Ga0451576_0264627 | 3300045051 | Bacteria | 1797 |
| 380 | Ga0451576_1356987 | 3300045051 | Bacteria | 740 |
| 381 | Ga0495592_0227448 | 3300046454 | Bacteria | 1244 |
| 382 | Ga0495629_0019898 | 3300046459 | Bacteria | 4790 |
| 383 | Ga0495629_0566272 | 3300046459 | Bacteria | 762 |
| 384 | Ga0495638_0266067 | 3300046460 | Bacteria | 938 |
| 385 | Ga0495582_0344432 | 3300046473 | Bacteria | 858 |
| 386 | Ga0495584_0025227 | 3300046491 | Bacteria | 3014 |
| 387 | Ga0495594_0095541 | 3300046499 | Bacteria | 1669 |
| 388 | Ga0495606_0336293 | 3300046507 | Bacteria | 806 |
| 389 | Ga0495628_0649503 | 3300046516 | Bacteria | 749 |
| 390 | Ga0495628_0869866 | 3300046516 | Bacteria | 627 |
| 391 | Ga0495637_0021394 | 3300046520 | Bacteria | 2967 |
| 392 | Ga0495643_0103843 | 3300046522 | Bacteria | 1453 |
| 393 | Ga0495643_0140087 | 3300046522 | Bacteria | 1207 |
| 394 | Ga0495642_0001865 | 3300046528 | Bacteria | 8995 |
| 395 | Ga0495642_0090232 | 3300046528 | Bacteria | 1297 |
| 396 | Ga0495640_0162735 | 3300046533 | Unclassified | 1429 |
| 397 | Ga0495598_0001261 | 3300046537 | Bacteria | 4934 |
| 398 | Ga0495598_0149142 | 3300046537 | Bacteria | 815 |
| 399 | Ga0495609_0404572 | 3300046538 | Bacteria | 546 |
| 400 | Ga0495597_0008223 | 3300046542 | Bacteria | 5243 |
| 401 | Ga0495622_0002683 | 3300046557 | Bacteria | 8535 |
| 402 | Ga0495633_0000400 | 3300046558 | Bacteria | 45378 |
| 403 | Ga0495633_0009773 | 3300046558 | Bacteria | 5272 |
| 404 | Ga0495633_0185986 | 3300046558 | Bacteria | 956 |
| 405 | Ga0495668_0161801 | 3300046616 | Bacteria | 1226 |
| 406 | Ga0495668_0208207 | 3300046616 | Bacteria | 1071 |
| 407 | Ga0495668_0393780 | 3300046616 | Bacteria | 761 |
| 408 | Ga0495625_0000165 | 3300046660 | Bacteria | 102988 |
| 409 | Ga0495625_0004667 | 3300046660 | Bacteria | 12868 |
| 410 | Ga0495625_0136368 | 3300046660 | Bacteria | 1658 |
| 411 | Ga0495625_0195375 | 3300046660 | Bacteria | 1338 |
| 412 | Ga0495625_0323331 | 3300046660 | Bacteria | 982 |
| 413 | Ga0495658_0607258 | 3300046683 | Unclassified | 701 |
| 414 | Ga0495669_0000008 | 3300046684 | Bacteria | 177295 |
| 415 | Ga0495669_0023949 | 3300046684 | Bacteria | 2660 |
| 416 | Ga0495649_0001927 | 3300046694 | Bacteria | 15131 |
| 417 | Ga0495600_0397619 | 3300046809 | Unclassified | 858 |
| 418 | Ga0495674_0461864 | 3300047319 | Bacteria | 1019 |
| 419 | Ga0495672_0014805 | 3300047320 | Bacteria | 5320 |
| 420 | Ga0495680_0049658 | 3300047322 | Bacteria | 3285 |
| 421 | Ga0495686_0010444 | 3300047472 | Bacteria | 6605 |
| 422 | Ga0495686_0171079 | 3300047472 | Bacteria | 1263 |
| 423 | Ga0495686_0274947 | 3300047472 | Bacteria | 938 |
| 424 | Ga0495686_0325616 | 3300047472 | Bacteria | 841 |
| 425 | Ga0495593_0224050 | 3300047673 | Bacteria | 943 |
| 426 | Ga0495602_0454887 | 3300048088 | Bacteria | 903 |
| 427 | Ga0495615_0080535 | 3300048090 | Bacteria | 892 |
| 428 | Ga0496101_0082262 | 3300048904 | Bacteria | 2383 |
| 429 | Ga0496101_0462785 | 3300048904 | Bacteria | 1001 |
| 430 | Ga0496101_0787398 | 3300048904 | Bacteria | 750 |
| 431 | Ga0496101_0910362 | 3300048904 | Bacteria | 692 |
| 432 | Ga0496102_0065025 | 3300048905 | Bacteria | 3342 |
| 433 | Ga0496102_0161842 | 3300048905 | Bacteria | 2105 |
| 434 | Ga0496104_0089238 | 3300048907 | Bacteria | 2945 |
| 435 | Ga0496105_0262866 | 3300048908 | Unclassified | 1395 |
| 436 | Ga0496106_0146022 | 3300048909 | Unclassified | 1863 |
| 437 | Ga0496107_0040746 | 3300048910 | Bacteria | 3335 |
| 438 | Ga0496107_0208392 | 3300048910 | Bacteria | 1453 |
| 439 | Ga0496107_0783812 | 3300048910 | Bacteria | 698 |
| 440 | Ga0496109_0017491 | 3300048912 | Bacteria | 6286 |
| 441 | Ga0496110_0068829 | 3300048913 | Bacteria | 3134 |
| 442 | Ga0496110_0097061 | 3300048913 | Bacteria | 2641 |
| 443 | Ga0496111_0051787 | 3300048914 | Bacteria | 2964 |
| 444 | Ga0496112_0019675 | 3300048915 | Bacteria | 6378 |
| 445 | Ga0496112_0111799 | 3300048915 | Bacteria | 2701 |
| 446 | Ga0496113_0017247 | 3300048916 | Bacteria | 5008 |
| 447 | Ga0496113_1323468 | 3300048916 | Bacteria | 560 |
| 448 | Ga0496114_0170083 | 3300048917 | Bacteria | 1899 |
| 449 | Ga0496114_0211275 | 3300048917 | Bacteria | 1702 |
| 450 | Ga0496115_0001534 | 3300048918 | Bacteria | 16566 |
| 451 | Ga0496115_0016352 | 3300048918 | Bacteria | 5648 |
| 452 | Ga0496115_0017829 | 3300048918 | Bacteria | 5437 |
| 453 | Ga0496115_0084360 | 3300048918 | Bacteria | 2590 |
| 454 | Ga0496115_0235592 | 3300048918 | Bacteria | 1509 |
| 455 | Ga0496116_0388068 | 3300048919 | Bacteria | 623 |
| 456 | Ga0496117_0010947 | 3300048920 | Bacteria | 8175 |
| 457 | Ga0496118_0017266 | 3300048921 | Bacteria | 6580 |
| 458 | Ga0496119_0498977 | 3300048922 | Bacteria | 566 |
| 459 | Ga0496121_0000059 | 3300048924 | Bacteria | 278177 |
| 460 | Ga0496121_0379080 | 3300048924 | Bacteria | 933 |
| 461 | Ga0496122_0026937 | 3300048925 | Bacteria | 4935 |
| 462 | Ga0496125_0000334 | 3300048928 | Bacteria | 90058 |
| 463 | Ga0496126_0448560 | 3300048929 | Bacteria | 1039 |
| 464 | Ga0495682_0250132 | 3300049460 | Bacteria | 627 |
| 465 | Ga0501031_0083481 | 3300049568 | Bacteria | 2082 |
| 466 | Ga0501034_0035345 | 3300049571 | Bacteria | 5066 |
| 467 | Ga0501034_0246687 | 3300049571 | Bacteria | 1731 |
| 468 | Ga0501037_0021683 | 3300049573 | Bacteria | 4751 |
| 469 | Ga0501040_0121472 | 3300049576 | Bacteria | 1833 |
| 470 | Ga0501042_0393149 | 3300049578 | Bacteria | 1004 |
| 471 | Ga0501043_0545232 | 3300049579 | Bacteria | 862 |
| 472 | Ga0501071_0959591 | 3300049587 | Bacteria | 660 |
| 473 | Ga0501075_0641427 | 3300049591 | Bacteria | 810 |
| 474 | Ga0501077_0103061 | 3300049593 | Bacteria | 1808 |
| 475 | Ga0501079_0353939 | 3300049741 | Bacteria | 1151 |
| 476 | Ga0501080_0735942 | 3300049742 | Bacteria | 868 |
| 477 | Ga0501081_0199505 | 3300049743 | Bacteria | 1451 |
| 478 | Ga0501044_0737576 | 3300049823 | Bacteria | 868 |
| 479 | nmdc:mga03n38_92295_c1 | 3300050490 | Bacteria | 1444 |
| 480 | nmdc:mga0yw44_143073_c1 | 3300050492 | Bacteria | 1555 |
| 481 | nmdc:mga0yw44_270630_c1 | 3300050492 | Bacteria | 1134 |
| 482 | nmdc:mga0k408_478263_c1 | 3300050493 | Bacteria | 739 |
| 483 | nmdc:mga06z11_435034_c1 | 3300050494 | Unclassified | 792 |
| 484 | nmdc:mga07m45_4905_c1 | 3300050496 | Bacteria | 6593 |
| 485 | nmdc:mga07m45_499398_c1 | 3300050496 | Unclassified | 704 |
| 486 | nmdc:mga05p37_7561_c1 | 3300050507 | Bacteria | 12816 |
| 487 | nmdc:mga09592_1356_c1 | 3300050508 | Bacteria | 19564 |
| 488 | nmdc:mga0qj67_1066641_c1 | 3300050509 | Unclassified | 632 |
| 489 | nmdc:mga0qj67_12317_c1 | 3300050509 | Bacteria | 6439 |
| 490 | nmdc:mga06r32_347_c1 | 3300050510 | Bacteria | 38541 |
| 491 | nmdc:mga06r32_56099_c1 | 3300050510 | Bacteria | 3780 |
| 492 | nmdc:mga06r32_664936_c1 | 3300050510 | Bacteria | 1009 |
| 493 | nmdc:mga08y16_2055_c1 | 3300050511 | Bacteria | 20613 |
| 494 | nmdc:mga0n895_396388_c1 | 3300050512 | Bacteria | 1396 |
| 495 | nmdc:mga08x19_26557_c1 | 3300050514 | Bacteria | 3614 |
| 496 | Ga0500578_0213773 | 3300053086 | Bacteria | 1175 |
| 497 | Ga0500643_014186 | 3300053087 | Bacteria | 2780 |
| 498 | Ga0500643_026735 | 3300053087 | Bacteria | 1802 |
| 499 | Ga0500643_089986 | 3300053087 | Unclassified | 837 |
| 500 | Ga0500644_0003373 | 3300053088 | Bacteria | 3951 |
| 501 | Ga0500647_0196311 | 3300053091 | Bacteria | 917 |
| 502 | Ga0500583_0232578 | 3300053092 | Bacteria | 912 |
| 503 | Ga0500651_0010034 | 3300053093 | Bacteria | 5659 |
| 504 | Ga0500651_0032591 | 3300053093 | Bacteria | 3284 |
| 505 | Ga0500566_0110003 | 3300053094 | Bacteria | 1499 |
| 506 | Ga0500641_0085126 | 3300053096 | Bacteria | 1345 |
| 507 | Ga0500554_000600 | 3300053102 | Bacteria | 7333 |
| 508 | Ga0500562_000374 | 3300053108 | Bacteria | 10829 |
| 509 | Ga0500562_015463 | 3300053108 | Bacteria | 1958 |
| 510 | Ga0500562_034794 | 3300053108 | Bacteria | 1333 |
| 511 | Ga0500569_004887 | 3300053109 | Bacteria | 2848 |
| 512 | Ga0500572_000299 | 3300053111 | Bacteria | 17614 |
| 513 | Ga0500593_236611 | 3300053117 | Unclassified | 629 |
| 514 | Ga0500595_001544 | 3300053119 | Bacteria | 12195 |
| 515 | Ga0500595_076786 | 3300053119 | Bacteria | 983 |
| 516 | Ga0500597_070712 | 3300053120 | Bacteria | 1509 |
| 517 | Ga0500607_268988 | 3300053121 | Bacteria | 660 |
| 518 | Ga0500608_001622 | 3300053122 | Bacteria | 8084 |
| 519 | Ga0500614_021544 | 3300053123 | Bacteria | 1496 |
| 520 | Ga0500642_0046791 | 3300053130 | Bacteria | 1893 |
| 521 | Ga0500559_0003514 | 3300053136 | Bacteria | 7676 |
| 522 | Ga0500590_013063 | 3300053148 | Bacteria | 4252 |
| 523 | Ga0500616_0187798 | 3300053153 | Bacteria | 925 |
| 524 | Ga0500619_133924 | 3300053154 | Bacteria | 845 |
| 525 | Ga0500638_169401 | 3300053162 | Bacteria | 953 |
| 526 | Ga0500636_0094931 | 3300053177 | Bacteria | 1703 |
| 527 | Ga0500637_0038670 | 3300053178 | Bacteria | 2689 |
| 528 | Ga0500625_128133 | 3300053729 | Bacteria | 1004 |
| 529 | Ga0500645_010341 | 3300053730 | Bacteria | 3091 |
| 530 | Ga0500596_006623 | 3300053735 | Bacteria | 1947 |
| 531 | Ga0501084_0150288 | 3300054114 | Bacteria | 1963 |
| 532 | Ga0501082_0262361 | 3300060353 | Bacteria | 1503 |
| 533 | Ga0530510_0062608 | 3300061734 | Bacteria | 2693 |
| 534 | Ga0530510_0147430 | 3300061734 | Bacteria | 1736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005262 | Ga0065165_1001734 | Ga0065165_100173412 | 124 |
| 2 | 3300005329 | Ga0070683_100280840 | Ga0070683_1002808402 | 125 |
| 3 | 3300005336 | Ga0070680_100029103 | Ga0070680_1000291035 | 125 |
| 4 | 3300005341 | Ga0070691_10000826 | Ga0070691_1000082613 | 125 |
| 5 | 3300005530 | Ga0070679_100014486 | Ga0070679_1000144864 | 125 |
| 6 | 3300005563 | Ga0068855_100056463 | Ga0068855_1000564634 | 125 |
| 7 | 3300013104 | Ga0157370_10284188 | Ga0157370_102841882 | 125 |
| 8 | 3300025912 | Ga0207707_10104910 | Ga0207707_101049102 | 125 |
| 9 | 3300025917 | Ga0207660_10025550 | Ga0207660_100255502 | 125 |
| 10 | 3300025921 | Ga0207652_10403421 | Ga0207652_104034212 | 125 |
| 11 | 3300025949 | Ga0207667_10017722 | Ga0207667_100177223 | 125 |
| 12 | 3300026041 | Ga0207639_10590407 | Ga0207639_105904071 | 125 |
| 13 | 3300006178 | Ga0075367_10114707 | Ga0075367_101147073 | 137 |
| 14 | 3300032004 | Ga0307414_10168472 | Ga0307414_101684722 | 142 |
| 15 | 3300032004 | Ga0307414_10117827 | Ga0307414_101178274 | 143 |
| 16 | 3300003781 | Ga0055536_1053718 | Ga0055536_10537182 | 144 |
| 17 | 3300025292 | Ga0209676_1001867 | Ga0209676_100186711 | 144 |
| 18 | 3300003791 | Ga0055530_10000148 | Ga0055530_1000014842 | 145 |
| 19 | 3300003794 | Ga0055531_10022227 | Ga0055531_100222271 | 145 |
| 20 | 3300005331 | Ga0070670_100065510 | Ga0070670_1000655103 | 145 |
| 21 | 3300005347 | Ga0070668_100003407 | Ga0070668_1000034074 | 145 |
| 22 | 3300005353 | Ga0070669_100357328 | Ga0070669_1003573282 | 145 |
| 23 | 3300005355 | Ga0070671_100285054 | Ga0070671_1002850542 | 145 |
| 24 | 3300005367 | Ga0070667_100006285 | Ga0070667_1000062858 | 145 |
| 25 | 3300005618 | Ga0068864_100098545 | Ga0068864_1000985452 | 145 |
| 26 | 3300005719 | Ga0068861_100119367 | Ga0068861_1001193672 | 145 |
| 27 | 3300005841 | Ga0068863_100027342 | Ga0068863_1000273422 | 145 |
| 28 | 3300005844 | Ga0068862_100067787 | Ga0068862_1000677872 | 145 |
| 29 | 3300006028 | Ga0070717_10908624 | Ga0070717_109086242 | 145 |
| 30 | 3300009553 | Ga0105249_10109792 | Ga0105249_101097922 | 145 |
| 31 | 3300025297 | Ga0209758_1000733 | Ga0209758_100073327 | 145 |
| 32 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029348 | 145 |
| 33 | 3300025304 | Ga0209257_1000714 | Ga0209257_100071422 | 145 |
| 34 | 3300025923 | Ga0207681_10289510 | Ga0207681_102895102 | 145 |
| 35 | 3300025925 | Ga0207650_10054701 | Ga0207650_100547013 | 145 |
| 36 | 3300025931 | Ga0207644_10447886 | Ga0207644_104478862 | 145 |
| 37 | 3300025961 | Ga0207712_10227088 | Ga0207712_102270882 | 145 |
| 38 | 3300025972 | Ga0207668_10030919 | Ga0207668_100309193 | 145 |
| 39 | 3300025986 | Ga0207658_10037217 | Ga0207658_100372173 | 145 |
| 40 | 3300026088 | Ga0207641_10049420 | Ga0207641_100494203 | 145 |
| 41 | 3300026118 | Ga0207675_100063497 | Ga0207675_1000634974 | 145 |
| 42 | 3300028380 | Ga0268265_10048299 | Ga0268265_100482993 | 145 |
| 43 | 3300028381 | Ga0268264_10026808 | Ga0268264_100268082 | 145 |
| 44 | 3300031616 | Ga0307508_10370166 | Ga0307508_103701662 | 145 |
| 45 | 3300032004 | Ga0307414_10924964 | Ga0307414_109249642 | 145 |
| 46 | 3300032004 | Ga0307414_11096352 | Ga0307414_110963521 | 145 |
| 47 | 3300039447 | Ga0436361_0343753 | Ga0436361_0343753_95_583 | 145 |
| 48 | 3300046616 | Ga0495668_0161801 | Ga0495668_0161801_367_846 | 145 |
| 49 | 3300047472 | Ga0495686_0325616 | Ga0495686_0325616_264_743 | 145 |
| 50 | 3300005347 | Ga0070668_100011657 | Ga0070668_1000116573 | 146 |
| 51 | 3300005367 | Ga0070667_100007513 | Ga0070667_1000075132 | 146 |
| 52 | 3300005548 | Ga0070665_100000451 | Ga0070665_10000045151 | 146 |
| 53 | 3300005843 | Ga0068860_100169550 | Ga0068860_1001695502 | 146 |
| 54 | 3300005844 | Ga0068862_100051334 | Ga0068862_1000513342 | 146 |
| 55 | 3300006048 | Ga0075363_100191868 | Ga0075363_1001918682 | 146 |
| 56 | 3300006195 | Ga0075366_10119854 | Ga0075366_101198542 | 146 |
| 57 | 3300006353 | Ga0075370_10035551 | Ga0075370_100355515 | 146 |
| 58 | 3300009177 | Ga0105248_10001337 | Ga0105248_1000133717 | 146 |
| 59 | 3300014325 | Ga0163163_10214952 | Ga0163163_102149523 | 146 |
| 60 | 3300014968 | Ga0157379_11177657 | Ga0157379_111776572 | 146 |
| 61 | 3300025941 | Ga0207711_10000882 | Ga0207711_1000088219 | 146 |
| 62 | 3300025972 | Ga0207668_10000015 | Ga0207668_1000001573 | 146 |
| 63 | 3300025986 | Ga0207658_10002733 | Ga0207658_100027332 | 146 |
| 64 | 3300028379 | Ga0268266_10000273 | Ga0268266_1000027326 | 146 |
| 65 | 3300037312 | Ga0395899_0000018 | Ga0395899_0000018_6759_7238 | 146 |
| 66 | 3300045051 | Ga0451576_1356987 | Ga0451576_1356987_70_549 | 146 |
| 67 | 3300047472 | Ga0495686_0010444 | Ga0495686_0010444_2078_2557 | 146 |
| 68 | 3300048917 | Ga0496114_0211275 | Ga0496114_0211275_665_1141 | 146 |
| 69 | 3300048918 | Ga0496115_0017829 | Ga0496115_0017829_2327_2803 | 146 |
| 70 | 3300048929 | Ga0496126_0448560 | Ga0496126_0448560_345_821 | 146 |
| 71 | 3300050490 | nmdc:mga03n38_92295_c1 | nmdc:mga03n38_92295_c1_181_669 | 146 |
| 72 | 3300050493 | nmdc:mga0k408_478263_c1 | nmdc:mga0k408_478263_c1_109_597 | 146 |
| 73 | 3300050496 | nmdc:mga07m45_4905_c1 | nmdc:mga07m45_4905_c1_3753_4241 | 146 |
| 74 | 3300053087 | Ga0500643_026735 | Ga0500643_026735_390_869 | 146 |
| 75 | 3300005327 | Ga0070658_11167315 | Ga0070658_111673151 | 147 |
| 76 | 3300005339 | Ga0070660_100053765 | Ga0070660_1000537653 | 147 |
| 77 | 3300026121 | Ga0207683_11107549 | Ga0207683_111075491 | 147 |
| 78 | 3300046538 | Ga0495609_0404572 | Ga0495609_0404572_34_513 | 147 |
| 79 | 3300053730 | Ga0500645_010341 | Ga0500645_010341_436_942 | 147 |
| 80 | 3300005618 | Ga0068864_100000038 | Ga0068864_100000038104 | 148 |
| 81 | 3300005841 | Ga0068863_100000026 | Ga0068863_100000026103 | 148 |
| 82 | 3300009092 | Ga0105250_10077955 | Ga0105250_100779552 | 148 |
| 83 | 3300026088 | Ga0207641_10000005 | Ga0207641_10000005314 | 148 |
| 84 | 3300026095 | Ga0207676_10000085 | Ga0207676_1000008545 | 148 |
| 85 | 3300005339 | Ga0070660_100290864 | Ga0070660_1002908642 | 149 |
| 86 | 3300005339 | Ga0070660_100458878 | Ga0070660_1004588782 | 149 |
| 87 | 3300005366 | Ga0070659_100000010 | Ga0070659_100000010137 | 149 |
| 88 | 3300025919 | Ga0207657_10191817 | Ga0207657_101918172 | 149 |
| 89 | 3300025932 | Ga0207690_10000020 | Ga0207690_10000020226 | 149 |
| 90 | 3300032004 | Ga0307414_10052082 | Ga0307414_100520824 | 149 |
| 91 | iso_pu_bacteria | 2738541281 | 2738743770 | 149 |
| 92 | iso_pu_bacteria | 2738543032 | 2739352676 | 149 |
| 93 | iso_pu_bacteria | 2842698319 | 2842698557 | 149 |
| 94 | 3300005347 | Ga0070668_100116099 | Ga0070668_1001160992 | 150 |
| 95 | 3300005364 | Ga0070673_100564532 | Ga0070673_1005645322 | 150 |
| 96 | 3300005546 | Ga0070696_101129388 | Ga0070696_1011293881 | 150 |
| 97 | 3300005617 | Ga0068859_100061095 | Ga0068859_1000610953 | 150 |
| 98 | 3300005618 | Ga0068864_100025449 | Ga0068864_1000254493 | 150 |
| 99 | 3300005842 | Ga0068858_100000061 | Ga0068858_10000006159 | 150 |
| 100 | 3300005843 | Ga0068860_100153126 | Ga0068860_1001531263 | 150 |
| 101 | 3300005844 | Ga0068862_100127035 | Ga0068862_1001270353 | 150 |
| 102 | 3300006931 | Ga0097620_100061095 | Ga0097620_1000610953 | 150 |
| 103 | 3300009094 | Ga0111539_10894783 | Ga0111539_108947832 | 150 |
| 104 | 3300009177 | Ga0105248_10131795 | Ga0105248_101317952 | 150 |
| 105 | 3300009177 | Ga0105248_10382830 | Ga0105248_103828302 | 150 |
| 106 | 3300009553 | Ga0105249_10082294 | Ga0105249_100822943 | 150 |
| 107 | 3300013105 | Ga0157369_10025502 | Ga0157369_100255025 | 150 |
| 108 | 3300014968 | Ga0157379_10053177 | Ga0157379_100531772 | 150 |
| 109 | 3300014969 | Ga0157376_10903565 | Ga0157376_109035652 | 150 |
| 110 | 3300025907 | Ga0207645_10640502 | Ga0207645_106405022 | 150 |
| 111 | 3300025941 | Ga0207711_10274752 | Ga0207711_102747522 | 150 |
| 112 | 3300025960 | Ga0207651_10378353 | Ga0207651_103783533 | 150 |
| 113 | 3300026023 | Ga0207677_10000131 | Ga0207677_1000013120 | 150 |
| 114 | 3300026035 | Ga0207703_10000149 | Ga0207703_1000014914 | 150 |
| 115 | 3300026075 | Ga0207708_10302129 | Ga0207708_103021292 | 150 |
| 116 | 3300026121 | Ga0207683_10342524 | Ga0207683_103425242 | 150 |
| 117 | 3300028380 | Ga0268265_10106666 | Ga0268265_101066662 | 150 |
| 118 | 3300046533 | Ga0495640_0162735 | Ga0495640_0162735_613_1086 | 150 |
| 119 | 3300046683 | Ga0495658_0607258 | Ga0495658_0607258_212_685 | 150 |
| 120 | 3300046809 | Ga0495600_0397619 | Ga0495600_0397619_95_568 | 150 |
| 121 | 3300047322 | Ga0495680_0049658 | Ga0495680_0049658_2152_2625 | 150 |
| 122 | 3300048904 | Ga0496101_0787398 | Ga0496101_0787398_196_675 | 150 |
| 123 | 3300053119 | Ga0500595_076786 | Ga0500595_076786_432_911 | 150 |
| 124 | 3300014325 | Ga0163163_10017368 | Ga0163163_100173682 | 151 |
| 125 | iso_pu_bacteria | 2841911363 | 2841911653 | 151 |
| 126 | iso_pu_bacteria | 2841917233 | 2841917390 | 151 |
| 127 | 3300005329 | Ga0070683_101265911 | Ga0070683_1012659111 | 152 |
| 128 | 3300005331 | Ga0070670_101815265 | Ga0070670_1018152651 | 152 |
| 129 | 3300005336 | Ga0070680_100271719 | Ga0070680_1002717192 | 152 |
| 130 | 3300005337 | Ga0070682_100184566 | Ga0070682_1001845663 | 152 |
| 131 | 3300005339 | Ga0070660_100008830 | Ga0070660_1000088308 | 152 |
| 132 | 3300005339 | Ga0070660_100329941 | Ga0070660_1003299412 | 152 |
| 133 | 3300005341 | Ga0070691_10098329 | Ga0070691_100983292 | 152 |
| 134 | 3300005354 | Ga0070675_100411185 | Ga0070675_1004111851 | 152 |
| 135 | 3300005436 | Ga0070713_100153140 | Ga0070713_1001531402 | 152 |
| 136 | 3300005455 | Ga0070663_100440190 | Ga0070663_1004401902 | 152 |
| 137 | 3300005456 | Ga0070678_100816857 | Ga0070678_1008168572 | 152 |
| 138 | 3300005458 | Ga0070681_10049985 | Ga0070681_100499853 | 152 |
| 139 | 3300005548 | Ga0070665_101378309 | Ga0070665_1013783091 | 152 |
| 140 | 3300005564 | Ga0070664_100121654 | Ga0070664_1001216543 | 152 |
| 141 | 3300005614 | Ga0068856_100485167 | Ga0068856_1004851672 | 152 |
| 142 | 3300005841 | Ga0068863_100181944 | Ga0068863_1001819443 | 152 |
| 143 | 3300006028 | Ga0070717_11128762 | Ga0070717_111287621 | 152 |
| 144 | 3300006038 | Ga0075365_10440209 | Ga0075365_104402093 | 152 |
| 145 | 3300006844 | Ga0075428_100111928 | Ga0075428_1001119281 | 152 |
| 146 | 3300006871 | Ga0075434_100960548 | Ga0075434_1009605481 | 152 |
| 147 | 3300006880 | Ga0075429_100156015 | Ga0075429_1001560151 | 152 |
| 148 | 3300006914 | Ga0075436_100033596 | Ga0075436_1000335963 | 152 |
| 149 | 3300009098 | Ga0105245_10094769 | Ga0105245_100947695 | 152 |
| 150 | 3300009545 | Ga0105237_10327637 | Ga0105237_103276373 | 152 |
| 151 | 3300009551 | Ga0105238_10020446 | Ga0105238_100204467 | 152 |
| 152 | 3300009553 | Ga0105249_10326058 | Ga0105249_103260581 | 152 |
| 153 | 3300013104 | Ga0157370_10033772 | Ga0157370_100337725 | 152 |
| 154 | 3300013105 | Ga0157369_10041248 | Ga0157369_100412486 | 152 |
| 155 | 3300013105 | Ga0157369_10813879 | Ga0157369_108138792 | 152 |
| 156 | 3300013296 | Ga0157374_10117104 | Ga0157374_101171044 | 152 |
| 157 | 3300013306 | Ga0163162_10041067 | Ga0163162_100410674 | 152 |
| 158 | 3300013307 | Ga0157372_11116299 | Ga0157372_111162991 | 152 |
| 159 | 3300014325 | Ga0163163_10021156 | Ga0163163_100211562 | 152 |
| 160 | 3300014745 | Ga0157377_10243372 | Ga0157377_102433722 | 152 |
| 161 | 3300020081 | Ga0206354_10645515 | Ga0206354_106455152 | 152 |
| 162 | 3300025912 | Ga0207707_10037163 | Ga0207707_100371633 | 152 |
| 163 | 3300025914 | Ga0207671_10275971 | Ga0207671_102759712 | 152 |
| 164 | 3300025917 | Ga0207660_10199121 | Ga0207660_101991211 | 152 |
| 165 | 3300025945 | Ga0207679_10110204 | Ga0207679_101102042 | 152 |
| 166 | 3300025945 | Ga0207679_10491486 | Ga0207679_104914862 | 152 |
| 167 | 3300025949 | Ga0207667_10006965 | Ga0207667_100069659 | 152 |
| 168 | 3300025981 | Ga0207640_10574285 | Ga0207640_105742851 | 152 |
| 169 | 3300026067 | Ga0207678_10486210 | Ga0207678_104862102 | 152 |
| 170 | 3300026078 | Ga0207702_10565760 | Ga0207702_105657602 | 152 |
| 171 | 3300026088 | Ga0207641_11009256 | Ga0207641_110092562 | 152 |
| 172 | 3300028379 | Ga0268266_11793544 | Ga0268266_117935441 | 152 |
| 173 | 3300030521 | Ga0307511_10023924 | Ga0307511_100239248 | 152 |
| 174 | 3300035691 | Ga0373931_0580329 | Ga0373931_0580329_56_517 | 152 |
| 175 | 3300048904 | Ga0496101_0082262 | Ga0496101_0082262_496_957 | 152 |
| 176 | 3300048905 | Ga0496102_0065025 | Ga0496102_0065025_1086_1547 | 152 |
| 177 | 3300048907 | Ga0496104_0089238 | Ga0496104_0089238_867_1328 | 152 |
| 178 | 3300048908 | Ga0496105_0262866 | Ga0496105_0262866_486_947 | 152 |
| 179 | 3300048909 | Ga0496106_0146022 | Ga0496106_0146022_393_854 | 152 |
| 180 | 3300048910 | Ga0496107_0040746 | Ga0496107_0040746_2336_2797 | 152 |
| 181 | 3300048912 | Ga0496109_0017491 | Ga0496109_0017491_1869_2330 | 152 |
| 182 | 3300048913 | Ga0496110_0068829 | Ga0496110_0068829_2114_2575 | 152 |
| 183 | 3300048914 | Ga0496111_0051787 | Ga0496111_0051787_1888_2349 | 152 |
| 184 | 3300048915 | Ga0496112_0019675 | Ga0496112_0019675_1659_2120 | 152 |
| 185 | 3300048916 | Ga0496113_0017247 | Ga0496113_0017247_904_1365 | 152 |
| 186 | 3300048924 | Ga0496121_0379080 | Ga0496121_0379080_162_680 | 152 |
| 187 | 3300050492 | nmdc:mga0yw44_143073_c1 | nmdc:mga0yw44_143073_c1_668_1147 | 152 |
| 188 | 3300050512 | nmdc:mga0n895_396388_c1 | nmdc:mga0n895_396388_c1_884_1351 | 152 |
| 189 | 3300050514 | nmdc:mga08x19_26557_c1 | nmdc:mga08x19_26557_c1_1497_1964 | 152 |
| 190 | 3300053087 | Ga0500643_014186 | Ga0500643_014186_1490_1969 | 152 |
| 191 | 3300053087 | Ga0500643_089986 | Ga0500643_089986_205_702 | 152 |
| 192 | 3300053117 | Ga0500593_236611 | Ga0500593_236611_40_501 | 152 |
| 193 | 3300005335 | Ga0070666_10057739 | Ga0070666_100577393 | 153 |
| 194 | 3300005344 | Ga0070661_100664694 | Ga0070661_1006646941 | 153 |
| 195 | 3300005347 | Ga0070668_100000232 | Ga0070668_10000023219 | 153 |
| 196 | 3300005367 | Ga0070667_100000118 | Ga0070667_10000011875 | 153 |
| 197 | 3300005406 | Ga0070703_10153815 | Ga0070703_101538151 | 153 |
| 198 | 3300005434 | Ga0070709_10262413 | Ga0070709_102624132 | 153 |
| 199 | 3300005467 | Ga0070706_100258368 | Ga0070706_1002583683 | 153 |
| 200 | 3300005468 | Ga0070707_100972997 | Ga0070707_1009729971 | 153 |
| 201 | 3300005548 | Ga0070665_100000713 | Ga0070665_10000071330 | 153 |
| 202 | 3300005617 | Ga0068859_100059997 | Ga0068859_1000599972 | 153 |
| 203 | 3300005618 | Ga0068864_100000206 | Ga0068864_10000020636 | 153 |
| 204 | 3300005841 | Ga0068863_100000071 | Ga0068863_10000007177 | 153 |
| 205 | 3300005842 | Ga0068858_100006858 | Ga0068858_1000068588 | 153 |
| 206 | 3300005843 | Ga0068860_100000205 | Ga0068860_10000020563 | 153 |
| 207 | 3300005844 | Ga0068862_100000057 | Ga0068862_100000057115 | 153 |
| 208 | 3300006038 | Ga0075365_10085818 | Ga0075365_100858183 | 153 |
| 209 | 3300006051 | Ga0075364_10412619 | Ga0075364_104126192 | 153 |
| 210 | 3300006844 | Ga0075428_100008355 | Ga0075428_1000083557 | 153 |
| 211 | 3300006846 | Ga0075430_100015743 | Ga0075430_1000157434 | 153 |
| 212 | 3300006847 | Ga0075431_100002242 | Ga0075431_10000224217 | 153 |
| 213 | 3300006880 | Ga0075429_100008008 | Ga0075429_10000800812 | 153 |
| 214 | 3300006931 | Ga0097620_100059998 | Ga0097620_1000599982 | 153 |
| 215 | 3300009094 | Ga0111539_10000200 | Ga0111539_1000020060 | 153 |
| 216 | 3300009101 | Ga0105247_10049867 | Ga0105247_100498672 | 153 |
| 217 | 3300009147 | Ga0114129_10000205 | Ga0114129_1000020518 | 153 |
| 218 | 3300014325 | Ga0163163_11263488 | Ga0163163_112634882 | 153 |
| 219 | 3300014968 | Ga0157379_10025233 | Ga0157379_100252332 | 153 |
| 220 | 3300025900 | Ga0207710_10210631 | Ga0207710_102106311 | 153 |
| 221 | 3300025920 | Ga0207649_10441367 | Ga0207649_104413671 | 153 |
| 222 | 3300025922 | Ga0207646_10772307 | Ga0207646_107723071 | 153 |
| 223 | 3300025925 | Ga0207650_10000032 | Ga0207650_1000003272 | 153 |
| 224 | 3300025961 | Ga0207712_10002979 | Ga0207712_100029792 | 153 |
| 225 | 3300025972 | Ga0207668_10000097 | Ga0207668_1000009749 | 153 |
| 226 | 3300025972 | Ga0207668_10454670 | Ga0207668_104546702 | 153 |
| 227 | 3300025986 | Ga0207658_10000116 | Ga0207658_1000011631 | 153 |
| 228 | 3300026035 | Ga0207703_10006513 | Ga0207703_100065136 | 153 |
| 229 | 3300026041 | Ga0207639_10101388 | Ga0207639_101013881 | 153 |
| 230 | 3300026075 | Ga0207708_11432003 | Ga0207708_114320031 | 153 |
| 231 | 3300026088 | Ga0207641_10010502 | Ga0207641_100105022 | 153 |
| 232 | 3300026095 | Ga0207676_10000237 | Ga0207676_1000023711 | 153 |
| 233 | 3300026118 | Ga0207675_101223857 | Ga0207675_1012238571 | 153 |
| 234 | 3300027907 | Ga0207428_10025712 | Ga0207428_100257125 | 153 |
| 235 | 3300028379 | Ga0268266_10292041 | Ga0268266_102920412 | 153 |
| 236 | 3300028381 | Ga0268264_10000202 | Ga0268264_1000020251 | 153 |
| 237 | 3300037466 | Ga0395898_0113459 | Ga0395898_0113459_2031_2540 | 153 |
| 238 | 3300048904 | Ga0496101_0462785 | Ga0496101_0462785_475_954 | 153 |
| 239 | 3300048916 | Ga0496113_1323468 | Ga0496113_1323468_66_527 | 153 |
| 240 | 3300050492 | nmdc:mga0yw44_270630_c1 | nmdc:mga0yw44_270630_c1_654_1115 | 153 |
| 241 | 3300050494 | nmdc:mga06z11_435034_c1 | nmdc:mga06z11_435034_c1_236_697 | 153 |
| 242 | 3300050496 | nmdc:mga07m45_499398_c1 | nmdc:mga07m45_499398_c1_62_523 | 153 |
| 243 | 3300050507 | nmdc:mga05p37_7561_c1 | nmdc:mga05p37_7561_c1_11719_12180 | 153 |
| 244 | 3300050508 | nmdc:mga09592_1356_c1 | nmdc:mga09592_1356_c1_17813_18274 | 153 |
| 245 | 3300050509 | nmdc:mga0qj67_12317_c1 | nmdc:mga0qj67_12317_c1_2607_3068 | 153 |
| 246 | 3300050510 | nmdc:mga06r32_347_c1 | nmdc:mga06r32_347_c1_7559_8020 | 153 |
| 247 | 3300050511 | nmdc:mga08y16_2055_c1 | nmdc:mga08y16_2055_c1_1537_1998 | 153 |
| 248 | 3300005614 | Ga0068856_100522709 | Ga0068856_1005227092 | 154 |
| 249 | 3300006038 | Ga0075365_10214432 | Ga0075365_102144323 | 154 |
| 250 | 3300006042 | Ga0075368_10045417 | Ga0075368_100454173 | 154 |
| 251 | 3300006177 | Ga0075362_10138819 | Ga0075362_101388193 | 154 |
| 252 | 3300006846 | Ga0075430_100535707 | Ga0075430_1005357073 | 154 |
| 253 | 3300006847 | Ga0075431_100410919 | Ga0075431_1004109192 | 154 |
| 254 | 3300031241 | Ga0265325_10000004 | Ga0265325_10000004234 | 154 |
| 255 | 3300035090 | Ga0373949_0207747 | Ga0373949_0207747_67_564 | 154 |
| 256 | 3300035170 | Ga0373943_0441655 | Ga0373943_0441655_281_745 | 154 |
| 257 | 3300035171 | Ga0373946_0155074 | Ga0373946_0155074_137_601 | 154 |
| 258 | 3300035692 | Ga0373935_0157263 | Ga0373935_0157263_1026_1490 | 154 |
| 259 | 3300050509 | nmdc:mga0qj67_1066641_c1 | nmdc:mga0qj67_1066641_c1_73_537 | 154 |
| 260 | 3300050510 | nmdc:mga06r32_56099_c1 | nmdc:mga06r32_56099_c1_1983_2447 | 154 |
| 261 | 3300050510 | nmdc:mga06r32_664936_c1 | nmdc:mga06r32_664936_c1_292_774 | 154 |
| 262 | 3300061734 | Ga0530510_0147430 | Ga0530510_0147430_702_1166 | 154 |
| 263 | iso_pu_bacteria | 2643221574 | 2643882294 | 154 |
| 264 | iso_pu_bacteria | 2643221663 | 2644354637 | 154 |
| 265 | iso_pu_bacteria | 2643221699 | 2644549270 | 154 |
| 266 | iso_pu_bacteria | 2643221699 | 2644552408 | 154 |
| 267 | iso_pu_bacteria | 2941485952 | 2941487997 | 154 |
| 268 | 3300035083 | Ga0373926_0405616 | Ga0373926_0405616_60_527 | 155 |
| 269 | 3300035116 | Ga0373945_0016317 | Ga0373945_0016317_1878_2345 | 155 |
| 270 | 3300046460 | Ga0495638_0266067 | Ga0495638_0266067_44_511 | 155 |
| 271 | 3300046491 | Ga0495584_0025227 | Ga0495584_0025227_715_1182 | 155 |
| 272 | 3300046520 | Ga0495637_0021394 | Ga0495637_0021394_1056_1523 | 155 |
| 273 | 3300046537 | Ga0495598_0001261 | Ga0495598_0001261_584_1051 | 155 |
| 274 | 3300046558 | Ga0495633_0009773 | Ga0495633_0009773_1580_2047 | 155 |
| 275 | 3300048917 | Ga0496114_0170083 | Ga0496114_0170083_1058_1525 | 155 |
| 276 | 3300049568 | Ga0501031_0083481 | Ga0501031_0083481_654_1124 | 155 |
| 277 | 3300049571 | Ga0501034_0035345 | Ga0501034_0035345_4444_4914 | 155 |
| 278 | 3300049573 | Ga0501037_0021683 | Ga0501037_0021683_2811_3281 | 155 |
| 279 | 3300049576 | Ga0501040_0121472 | Ga0501040_0121472_611_1078 | 155 |
| 280 | 3300049578 | Ga0501042_0393149 | Ga0501042_0393149_71_538 | 155 |
| 281 | 3300049579 | Ga0501043_0545232 | Ga0501043_0545232_77_547 | 155 |
| 282 | 3300049587 | Ga0501071_0959591 | Ga0501071_0959591_141_608 | 155 |
| 283 | 3300049591 | Ga0501075_0641427 | Ga0501075_0641427_41_508 | 155 |
| 284 | 3300049593 | Ga0501077_0103061 | Ga0501077_0103061_1245_1712 | 155 |
| 285 | 3300049741 | Ga0501079_0353939 | Ga0501079_0353939_358_825 | 155 |
| 286 | 3300049743 | Ga0501081_0199505 | Ga0501081_0199505_846_1313 | 155 |
| 287 | 3300049823 | Ga0501044_0737576 | Ga0501044_0737576_355_825 | 155 |
| 288 | 3300054114 | Ga0501084_0150288 | Ga0501084_0150288_480_947 | 155 |
| 289 | 3300060353 | Ga0501082_0262361 | Ga0501082_0262361_193_660 | 155 |
| 290 | 3300061734 | Ga0530510_0062608 | Ga0530510_0062608_1404_1871 | 155 |
| 291 | iso_pu_bacteria | 2582581280 | 2585150496 | 155 |
| 292 | iso_pu_bacteria | 2582581293 | 2585197686 | 155 |
| 293 | iso_pu_bacteria | 2643221545 | 2643750952 | 155 |
| 294 | iso_pu_bacteria | 2643221552 | 2643780799 | 155 |
| 295 | iso_pu_bacteria | 2643221584 | 2643931437 | 155 |
| 296 | iso_pu_bacteria | 2643221691 | 2644510025 | 155 |
| 297 | iso_pu_bacteria | 2791355048 | 2792462763 | 155 |
| 298 | iso_pu_bacteria | 2843744320 | 2843749509 | 155 |
| 299 | iso_pu_bacteria | 2849560528 | 2849562473 | 155 |
| 300 | iso_pu_bacteria | 2849573788 | 2849574936 | 155 |
| 301 | iso_pu_bacteria | 2898329390 | 2898332271 | 155 |
| 302 | iso_pu_bacteria | 2928972540 | 2928973444 | 155 |
| 303 | 3300047320 | Ga0495672_0014805 | Ga0495672_0014805_235_777 | 156 |
| 304 | 3300049571 | Ga0501034_0246687 | Ga0501034_0246687_1208_1687 | 157 |
| 305 | 3300003781 | Ga0055536_1001525 | Ga0055536_100152517 | 158 |
| 306 | 3300003781 | Ga0055536_1019991 | Ga0055536_10199915 | 158 |
| 307 | 3300003794 | Ga0055531_10008457 | Ga0055531_100084575 | 158 |
| 308 | 3300025292 | Ga0209676_1000140 | Ga0209676_1000140131 | 158 |
| 309 | 3300025298 | Ga0209050_1009395 | Ga0209050_10093956 | 158 |
| 310 | 3300025304 | Ga0209257_1000630 | Ga0209257_100063043 | 158 |
| 311 | 3300031824 | Ga0307413_10085276 | Ga0307413_100852763 | 158 |
| 312 | 3300031824 | Ga0307413_11039356 | Ga0307413_110393561 | 158 |
| 313 | 3300031901 | Ga0307406_10001802 | Ga0307406_100018028 | 158 |
| 314 | 3300031911 | Ga0307412_10007240 | Ga0307412_100072402 | 158 |
| 315 | 3300032004 | Ga0307414_10008170 | Ga0307414_100081703 | 158 |
| 316 | 3300032004 | Ga0307414_10038833 | Ga0307414_100388332 | 158 |
| 317 | 3300032004 | Ga0307414_10393750 | Ga0307414_103937501 | 158 |
| 318 | 3300032004 | Ga0307414_10426620 | Ga0307414_104266202 | 158 |
| 319 | 3300032004 | Ga0307414_10431324 | Ga0307414_104313242 | 158 |
| 320 | 3300042876 | Ga0451577_1349090 | Ga0451577_1349090_77_559 | 158 |
| 321 | 3300046522 | Ga0495643_0140087 | Ga0495643_0140087_162_638 | 158 |
| 322 | 3300046694 | Ga0495649_0001927 | Ga0495649_0001927_4803_5279 | 158 |
| 323 | 3300048928 | Ga0496125_0000334 | Ga0496125_0000334_65580_66056 | 158 |
| 324 | 3300053088 | Ga0500644_0003373 | Ga0500644_0003373_469_945 | 158 |
| 325 | 3300053093 | Ga0500651_0032591 | Ga0500651_0032591_2729_3205 | 158 |
| 326 | 3300053153 | Ga0500616_0187798 | Ga0500616_0187798_90_566 | 158 |
| 327 | 3300003215 | JGI25153J46596_10051182 | JGI25153J46596_100511822 | 159 |
| 328 | 3300003322 | rootL2_10077638 | rootL2_100776382 | 159 |
| 329 | 3300003322 | rootL2_10077639 | rootL2_100776393 | 159 |
| 330 | 3300003578 | Ga0006562J51391_1091438 | Ga0006562J51391_10914385 | 159 |
| 331 | 3300003578 | Ga0006562J51391_1091439 | Ga0006562J51391_10914398 | 159 |
| 332 | 3300003775 | Ga0055524_1008397 | Ga0055524_10083974 | 159 |
| 333 | 3300003794 | Ga0055531_10073438 | Ga0055531_100734381 | 159 |
| 334 | 3300005262 | Ga0065165_1021762 | Ga0065165_10217622 | 159 |
| 335 | 3300005327 | Ga0070658_10182545 | Ga0070658_101825452 | 159 |
| 336 | 3300005344 | Ga0070661_100572328 | Ga0070661_1005723281 | 159 |
| 337 | 3300005347 | Ga0070668_100000734 | Ga0070668_10000073416 | 159 |
| 338 | 3300005347 | Ga0070668_100103145 | Ga0070668_1001031452 | 159 |
| 339 | 3300005353 | Ga0070669_100748027 | Ga0070669_1007480272 | 159 |
| 340 | 3300005355 | Ga0070671_100023883 | Ga0070671_1000238835 | 159 |
| 341 | 3300005366 | Ga0070659_100000700 | Ga0070659_10000070012 | 159 |
| 342 | 3300005456 | Ga0070678_100845985 | Ga0070678_1008459851 | 159 |
| 343 | 3300005457 | Ga0070662_100139956 | Ga0070662_1001399562 | 159 |
| 344 | 3300005458 | Ga0070681_10019859 | Ga0070681_1001985912 | 159 |
| 345 | 3300005530 | Ga0070679_100085752 | Ga0070679_1000857522 | 159 |
| 346 | 3300005530 | Ga0070679_100884699 | Ga0070679_1008846992 | 159 |
| 347 | 3300005535 | Ga0070684_101534509 | Ga0070684_1015345091 | 159 |
| 348 | 3300005539 | Ga0068853_100000534 | Ga0068853_10000053422 | 159 |
| 349 | 3300005539 | Ga0068853_100194853 | Ga0068853_1001948532 | 159 |
| 350 | 3300005539 | Ga0068853_100257291 | Ga0068853_1002572912 | 159 |
| 351 | 3300005539 | Ga0068853_101132536 | Ga0068853_1011325361 | 159 |
| 352 | 3300005548 | Ga0070665_100015124 | Ga0070665_1000151242 | 159 |
| 353 | 3300005548 | Ga0070665_100070014 | Ga0070665_1000700144 | 159 |
| 354 | 3300005548 | Ga0070665_100631768 | Ga0070665_1006317681 | 159 |
| 355 | 3300005563 | Ga0068855_100243222 | Ga0068855_1002432222 | 159 |
| 356 | 3300005563 | Ga0068855_100835390 | Ga0068855_1008353902 | 159 |
| 357 | 3300005577 | Ga0068857_100094168 | Ga0068857_1000941682 | 159 |
| 358 | 3300005577 | Ga0068857_101083390 | Ga0068857_1010833902 | 159 |
| 359 | 3300005614 | Ga0068856_101274522 | Ga0068856_1012745222 | 159 |
| 360 | 3300005616 | Ga0068852_100323993 | Ga0068852_1003239932 | 159 |
| 361 | 3300005618 | Ga0068864_100105225 | Ga0068864_1001052254 | 159 |
| 362 | 3300005618 | Ga0068864_101309816 | Ga0068864_1013098161 | 159 |
| 363 | 3300005718 | Ga0068866_10664714 | Ga0068866_106647141 | 159 |
| 364 | 3300005841 | Ga0068863_100041347 | Ga0068863_1000413473 | 159 |
| 365 | 3300005841 | Ga0068863_100149956 | Ga0068863_1001499562 | 159 |
| 366 | 3300005843 | Ga0068860_100000265 | Ga0068860_10000026539 | 159 |
| 367 | 3300005844 | Ga0068862_100077176 | Ga0068862_1000771764 | 159 |
| 368 | 3300005844 | Ga0068862_100454520 | Ga0068862_1004545202 | 159 |
| 369 | 3300005844 | Ga0068862_100648143 | Ga0068862_1006481432 | 159 |
| 370 | 3300006051 | Ga0075364_10001888 | Ga0075364_100018889 | 159 |
| 371 | 3300006178 | Ga0075367_10013041 | Ga0075367_100130413 | 159 |
| 372 | 3300006237 | Ga0097621_100989994 | Ga0097621_1009899942 | 159 |
| 373 | 3300006353 | Ga0075370_10296399 | Ga0075370_102963991 | 159 |
| 374 | 3300006881 | Ga0068865_100000449 | Ga0068865_10000044917 | 159 |
| 375 | 3300009174 | Ga0105241_12173908 | Ga0105241_121739081 | 159 |
| 376 | 3300009176 | Ga0105242_10312626 | Ga0105242_103126262 | 159 |
| 377 | 3300009177 | Ga0105248_10003125 | Ga0105248_100031251 | 159 |
| 378 | 3300009177 | Ga0105248_10005661 | Ga0105248_100056613 | 159 |
| 379 | 3300009177 | Ga0105248_10422353 | Ga0105248_104223532 | 159 |
| 380 | 3300009177 | Ga0105248_11186065 | Ga0105248_111860652 | 159 |
| 381 | 3300009551 | Ga0105238_10019180 | Ga0105238_100191804 | 159 |
| 382 | 3300009551 | Ga0105238_11074745 | Ga0105238_110747452 | 159 |
| 383 | 3300013100 | Ga0157373_10001950 | Ga0157373_1000195010 | 159 |
| 384 | 3300013100 | Ga0157373_10002460 | Ga0157373_100024605 | 159 |
| 385 | 3300013102 | Ga0157371_10006522 | Ga0157371_1000652211 | 159 |
| 386 | 3300013104 | Ga0157370_10017214 | Ga0157370_100172146 | 159 |
| 387 | 3300013105 | Ga0157369_10014296 | Ga0157369_100142964 | 159 |
| 388 | 3300013105 | Ga0157369_10763220 | Ga0157369_107632202 | 159 |
| 389 | 3300013306 | Ga0163162_10058506 | Ga0163162_100585063 | 159 |
| 390 | 3300013308 | Ga0157375_10388298 | Ga0157375_103882982 | 159 |
| 391 | 3300014325 | Ga0163163_10079552 | Ga0163163_100795522 | 159 |
| 392 | 3300014325 | Ga0163163_10127132 | Ga0163163_101271323 | 159 |
| 393 | 3300014745 | Ga0157377_10223414 | Ga0157377_102234142 | 159 |
| 394 | 3300021384 | Ga0213876_10068386 | Ga0213876_100683862 | 159 |
| 395 | 3300025297 | Ga0209758_1000923 | Ga0209758_100092323 | 159 |
| 396 | 3300025298 | Ga0209050_1091769 | Ga0209050_10917691 | 159 |
| 397 | 3300025299 | Ga0209256_1000535 | Ga0209256_100053552 | 159 |
| 398 | 3300025304 | Ga0209257_1002598 | Ga0209257_100259816 | 159 |
| 399 | 3300025903 | Ga0207680_10151584 | Ga0207680_101515842 | 159 |
| 400 | 3300025908 | Ga0207643_10960936 | Ga0207643_109609361 | 159 |
| 401 | 3300025909 | Ga0207705_10003940 | Ga0207705_100039402 | 159 |
| 402 | 3300025912 | Ga0207707_10023363 | Ga0207707_100233635 | 159 |
| 403 | 3300025917 | Ga0207660_10002074 | Ga0207660_100020744 | 159 |
| 404 | 3300025919 | Ga0207657_10010291 | Ga0207657_100102912 | 159 |
| 405 | 3300025919 | Ga0207657_10023114 | Ga0207657_100231142 | 159 |
| 406 | 3300025919 | Ga0207657_10023860 | Ga0207657_100238606 | 159 |
| 407 | 3300025919 | Ga0207657_10346208 | Ga0207657_103462082 | 159 |
| 408 | 3300025920 | Ga0207649_10324682 | Ga0207649_103246822 | 159 |
| 409 | 3300025920 | Ga0207649_10958900 | Ga0207649_109589001 | 159 |
| 410 | 3300025921 | Ga0207652_10243497 | Ga0207652_102434972 | 159 |
| 411 | 3300025921 | Ga0207652_10450870 | Ga0207652_104508702 | 159 |
| 412 | 3300025924 | Ga0207694_10013457 | Ga0207694_100134575 | 159 |
| 413 | 3300025924 | Ga0207694_10208618 | Ga0207694_102086182 | 159 |
| 414 | 3300025931 | Ga0207644_10018698 | Ga0207644_100186982 | 159 |
| 415 | 3300025932 | Ga0207690_10000220 | Ga0207690_1000022038 | 159 |
| 416 | 3300025932 | Ga0207690_10038293 | Ga0207690_100382933 | 159 |
| 417 | 3300025932 | Ga0207690_11164069 | Ga0207690_111640692 | 159 |
| 418 | 3300025933 | Ga0207706_10098290 | Ga0207706_100982902 | 159 |
| 419 | 3300025938 | Ga0207704_10002118 | Ga0207704_100021188 | 159 |
| 420 | 3300025941 | Ga0207711_10013999 | Ga0207711_100139993 | 159 |
| 421 | 3300025941 | Ga0207711_10080747 | Ga0207711_100807471 | 159 |
| 422 | 3300025949 | Ga0207667_10007379 | Ga0207667_1000737918 | 159 |
| 423 | 3300025949 | Ga0207667_10119203 | Ga0207667_101192033 | 159 |
| 424 | 3300025972 | Ga0207668_10015373 | Ga0207668_100153736 | 159 |
| 425 | 3300025972 | Ga0207668_10103597 | Ga0207668_101035972 | 159 |
| 426 | 3300026023 | Ga0207677_10081513 | Ga0207677_100815132 | 159 |
| 427 | 3300026035 | Ga0207703_10080296 | Ga0207703_100802962 | 159 |
| 428 | 3300026041 | Ga0207639_10001443 | Ga0207639_100014438 | 159 |
| 429 | 3300026041 | Ga0207639_10047578 | Ga0207639_100475783 | 159 |
| 430 | 3300026041 | Ga0207639_10112969 | Ga0207639_101129692 | 159 |
| 431 | 3300026041 | Ga0207639_11153864 | Ga0207639_111538642 | 159 |
| 432 | 3300026067 | Ga0207678_10224694 | Ga0207678_102246942 | 159 |
| 433 | 3300026088 | Ga0207641_10017443 | Ga0207641_100174435 | 159 |
| 434 | 3300026088 | Ga0207641_10274444 | Ga0207641_102744442 | 159 |
| 435 | 3300026095 | Ga0207676_10162893 | Ga0207676_101628932 | 159 |
| 436 | 3300026116 | Ga0207674_11712788 | Ga0207674_117127882 | 159 |
| 437 | 3300026121 | Ga0207683_10409218 | Ga0207683_104092182 | 159 |
| 438 | 3300026142 | Ga0207698_10262997 | Ga0207698_102629972 | 159 |
| 439 | 3300027665 | Ga0209983_1003823 | Ga0209983_10038237 | 159 |
| 440 | 3300028379 | Ga0268266_10325611 | Ga0268266_103256112 | 159 |
| 441 | 3300028380 | Ga0268265_10004161 | Ga0268265_100041612 | 159 |
| 442 | 3300028380 | Ga0268265_10644756 | Ga0268265_106447562 | 159 |
| 443 | 3300028381 | Ga0268264_10000318 | Ga0268264_1000031829 | 159 |
| 444 | 3300028800 | Ga0265338_10002913 | Ga0265338_1000291312 | 159 |
| 445 | 3300028800 | Ga0265338_10087299 | Ga0265338_100872994 | 159 |
| 446 | 3300031251 | Ga0265327_10001787 | Ga0265327_100017876 | 159 |
| 447 | 3300031251 | Ga0265327_10012400 | Ga0265327_100124004 | 159 |
| 448 | 3300031711 | Ga0265314_10048417 | Ga0265314_100484175 | 159 |
| 449 | 3300031731 | Ga0307405_10201817 | Ga0307405_102018173 | 159 |
| 450 | 3300032004 | Ga0307414_10522788 | Ga0307414_105227882 | 159 |
| 451 | 3300033180 | Ga0307510_10298923 | Ga0307510_102989232 | 159 |
| 452 | 3300035083 | Ga0373926_0353601 | Ga0373926_0353601_60_539 | 159 |
| 453 | 3300035089 | Ga0373944_0030079 | Ga0373944_0030079_156_635 | 159 |
| 454 | 3300035695 | Ga0373927_0000530 | Ga0373927_0000530_17143_17622 | 159 |
| 455 | 3300037068 | Ga0373925_0000089 | Ga0373925_0000089_50347_50826 | 159 |
| 456 | 3300037312 | Ga0395899_0001557 | Ga0395899_0001557_6361_6840 | 159 |
| 457 | 3300037312 | Ga0395899_0005180 | Ga0395899_0005180_1674_2153 | 159 |
| 458 | 3300037312 | Ga0395899_0415563 | Ga0395899_0415563_284_763 | 159 |
| 459 | 3300037312 | Ga0395899_0731061 | Ga0395899_0731061_57_536 | 159 |
| 460 | 3300037418 | Ga0395900_0000004 | Ga0395900_0000004_225347_225826 | 159 |
| 461 | 3300037418 | Ga0395900_0106571 | Ga0395900_0106571_1453_1932 | 159 |
| 462 | 3300037418 | Ga0395900_0593906 | Ga0395900_0593906_459_938 | 159 |
| 463 | 3300037466 | Ga0395898_0004167 | Ga0395898_0004167_13471_13950 | 159 |
| 464 | 3300037466 | Ga0395898_0559061 | Ga0395898_0559061_155_634 | 159 |
| 465 | 3300037466 | Ga0395898_0627220 | Ga0395898_0627220_289_768 | 159 |
| 466 | 3300037466 | Ga0395898_0698249 | Ga0395898_0698249_170_649 | 159 |
| 467 | 3300037471 | Ga0395905_0003519 | Ga0395905_0003519_3925_4404 | 159 |
| 468 | 3300037471 | Ga0395905_0032986 | Ga0395905_0032986_426_905 | 159 |
| 469 | 3300037471 | Ga0395905_0095786 | Ga0395905_0095786_581_1060 | 159 |
| 470 | 3300037471 | Ga0395905_0234957 | Ga0395905_0234957_360_839 | 159 |
| 471 | 3300037471 | Ga0395905_0400040 | Ga0395905_0400040_176_655 | 159 |
| 472 | 3300038443 | Ga0395901_0000005 | Ga0395901_0000005_339740_340219 | 159 |
| 473 | 3300038443 | Ga0395901_0107245 | Ga0395901_0107245_1710_2189 | 159 |
| 474 | 3300038443 | Ga0395901_0256316 | Ga0395901_0256316_505_984 | 159 |
| 475 | 3300039437 | Ga0436365_0773082 | Ga0436365_0773082_3678_4157 | 159 |
| 476 | 3300039447 | Ga0436361_0377648 | Ga0436361_0377648_414_893 | 159 |
| 477 | 3300042127 | Ga0450890_055412 | Ga0450890_055412_62_568 | 159 |
| 478 | 3300042130 | Ga0450892_012043 | Ga0450892_012043_254_760 | 159 |
| 479 | 3300042436 | Ga0439435_0003710 | Ga0439435_0003710_418_897 | 159 |
| 480 | 3300045049 | Ga0466959_0471781 | Ga0466959_0471781_48_533 | 159 |
| 481 | 3300045051 | Ga0451576_0264627 | Ga0451576_0264627_380_859 | 159 |
| 482 | 3300046454 | Ga0495592_0227448 | Ga0495592_0227448_474_953 | 159 |
| 483 | 3300046459 | Ga0495629_0019898 | Ga0495629_0019898_3462_3941 | 159 |
| 484 | 3300046459 | Ga0495629_0566272 | Ga0495629_0566272_178_657 | 159 |
| 485 | 3300046473 | Ga0495582_0344432 | Ga0495582_0344432_219_698 | 159 |
| 486 | 3300046499 | Ga0495594_0095541 | Ga0495594_0095541_695_1174 | 159 |
| 487 | 3300046507 | Ga0495606_0336293 | Ga0495606_0336293_72_551 | 159 |
| 488 | 3300046516 | Ga0495628_0649503 | Ga0495628_0649503_192_671 | 159 |
| 489 | 3300046516 | Ga0495628_0869866 | Ga0495628_0869866_114_593 | 159 |
| 490 | 3300046522 | Ga0495643_0103843 | Ga0495643_0103843_426_905 | 159 |
| 491 | 3300046528 | Ga0495642_0001865 | Ga0495642_0001865_5613_6092 | 159 |
| 492 | 3300046528 | Ga0495642_0090232 | Ga0495642_0090232_726_1205 | 159 |
| 493 | 3300046537 | Ga0495598_0149142 | Ga0495598_0149142_196_675 | 159 |
| 494 | 3300046542 | Ga0495597_0008223 | Ga0495597_0008223_2115_2594 | 159 |
| 495 | 3300046557 | Ga0495622_0002683 | Ga0495622_0002683_4678_5157 | 159 |
| 496 | 3300046558 | Ga0495633_0000400 | Ga0495633_0000400_7624_8115 | 159 |
| 497 | 3300046558 | Ga0495633_0185986 | Ga0495633_0185986_388_867 | 159 |
| 498 | 3300046616 | Ga0495668_0208207 | Ga0495668_0208207_65_544 | 159 |
| 499 | 3300046616 | Ga0495668_0393780 | Ga0495668_0393780_206_685 | 159 |
| 500 | 3300046660 | Ga0495625_0000165 | Ga0495625_0000165_48716_49201 | 159 |
| 501 | 3300046660 | Ga0495625_0004667 | Ga0495625_0004667_4528_5007 | 159 |
| 502 | 3300046660 | Ga0495625_0136368 | Ga0495625_0136368_885_1364 | 159 |
| 503 | 3300046660 | Ga0495625_0195375 | Ga0495625_0195375_425_916 | 159 |
| 504 | 3300046660 | Ga0495625_0323331 | Ga0495625_0323331_443_922 | 159 |
| 505 | 3300046684 | Ga0495669_0000008 | Ga0495669_0000008_12072_12563 | 159 |
| 506 | 3300046684 | Ga0495669_0023949 | Ga0495669_0023949_1203_1682 | 159 |
| 507 | 3300047319 | Ga0495674_0461864 | Ga0495674_0461864_141_620 | 159 |
| 508 | 3300047472 | Ga0495686_0171079 | Ga0495686_0171079_691_1170 | 159 |
| 509 | 3300047472 | Ga0495686_0274947 | Ga0495686_0274947_271_753 | 159 |
| 510 | 3300047673 | Ga0495593_0224050 | Ga0495593_0224050_78_557 | 159 |
| 511 | 3300048088 | Ga0495602_0454887 | Ga0495602_0454887_232_711 | 159 |
| 512 | 3300048090 | Ga0495615_0080535 | Ga0495615_0080535_61_540 | 159 |
| 513 | 3300048904 | Ga0496101_0910362 | Ga0496101_0910362_20_499 | 159 |
| 514 | 3300048905 | Ga0496102_0161842 | Ga0496102_0161842_965_1444 | 159 |
| 515 | 3300048910 | Ga0496107_0208392 | Ga0496107_0208392_98_577 | 159 |
| 516 | 3300048910 | Ga0496107_0783812 | Ga0496107_0783812_157_636 | 159 |
| 517 | 3300048913 | Ga0496110_0097061 | Ga0496110_0097061_1143_1622 | 159 |
| 518 | 3300048915 | Ga0496112_0111799 | Ga0496112_0111799_1595_2074 | 159 |
| 519 | 3300048918 | Ga0496115_0001534 | Ga0496115_0001534_2761_3240 | 159 |
| 520 | 3300048918 | Ga0496115_0016352 | Ga0496115_0016352_1494_1973 | 159 |
| 521 | 3300048918 | Ga0496115_0084360 | Ga0496115_0084360_261_740 | 159 |
| 522 | 3300048918 | Ga0496115_0235592 | Ga0496115_0235592_767_1246 | 159 |
| 523 | 3300048919 | Ga0496116_0388068 | Ga0496116_0388068_61_540 | 159 |
| 524 | 3300048920 | Ga0496117_0010947 | Ga0496117_0010947_5507_5986 | 159 |
| 525 | 3300048921 | Ga0496118_0017266 | Ga0496118_0017266_360_839 | 159 |
| 526 | 3300048922 | Ga0496119_0498977 | Ga0496119_0498977_36_515 | 159 |
| 527 | 3300048924 | Ga0496121_0000059 | Ga0496121_0000059_19633_20112 | 159 |
| 528 | 3300048925 | Ga0496122_0026937 | Ga0496122_0026937_1091_1636 | 159 |
| 529 | 3300049460 | Ga0495682_0250132 | Ga0495682_0250132_104_583 | 159 |
| 530 | 3300049742 | Ga0501080_0735942 | Ga0501080_0735942_49_528 | 159 |
| 531 | 3300053086 | Ga0500578_0213773 | Ga0500578_0213773_163_642 | 159 |
| 532 | 3300053091 | Ga0500647_0196311 | Ga0500647_0196311_199_678 | 159 |
| 533 | 3300053092 | Ga0500583_0232578 | Ga0500583_0232578_342_821 | 159 |
| 534 | 3300053093 | Ga0500651_0010034 | Ga0500651_0010034_2035_2514 | 159 |
| 535 | 3300053094 | Ga0500566_0110003 | Ga0500566_0110003_890_1369 | 159 |
| 536 | 3300053096 | Ga0500641_0085126 | Ga0500641_0085126_580_1059 | 159 |
| 537 | 3300053102 | Ga0500554_000600 | Ga0500554_000600_5821_6300 | 159 |
| 538 | 3300053108 | Ga0500562_000374 | Ga0500562_000374_6010_6489 | 159 |
| 539 | 3300053108 | Ga0500562_015463 | Ga0500562_015463_1295_1774 | 159 |
| 540 | 3300053108 | Ga0500562_034794 | Ga0500562_034794_50_529 | 159 |
| 541 | 3300053109 | Ga0500569_004887 | Ga0500569_004887_160_639 | 159 |
| 542 | 3300053111 | Ga0500572_000299 | Ga0500572_000299_5019_5498 | 159 |
| 543 | 3300053119 | Ga0500595_001544 | Ga0500595_001544_9615_10094 | 159 |
| 544 | 3300053120 | Ga0500597_070712 | Ga0500597_070712_290_769 | 159 |
| 545 | 3300053121 | Ga0500607_268988 | Ga0500607_268988_160_639 | 159 |
| 546 | 3300053122 | Ga0500608_001622 | Ga0500608_001622_5239_5718 | 159 |
| 547 | 3300053123 | Ga0500614_021544 | Ga0500614_021544_431_910 | 159 |
| 548 | 3300053130 | Ga0500642_0046791 | Ga0500642_0046791_1229_1708 | 159 |
| 549 | 3300053136 | Ga0500559_0003514 | Ga0500559_0003514_3775_4260 | 159 |
| 550 | 3300053148 | Ga0500590_013063 | Ga0500590_013063_37_516 | 159 |
| 551 | 3300053154 | Ga0500619_133924 | Ga0500619_133924_193_672 | 159 |
| 552 | 3300053162 | Ga0500638_169401 | Ga0500638_169401_155_634 | 159 |
| 553 | 3300053177 | Ga0500636_0094931 | Ga0500636_0094931_621_1100 | 159 |
| 554 | 3300053178 | Ga0500637_0038670 | Ga0500637_0038670_1510_1989 | 159 |
| 555 | 3300053729 | Ga0500625_128133 | Ga0500625_128133_67_546 | 159 |
| 556 | 3300053735 | Ga0500596_006623 | Ga0500596_006623_955_1434 | 159 |
| 557 | iso_pu_bacteria | 2977240413 | 2977240578 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tt7-assembly1.cif.gz_H | ovine atp synthase 1a state | 0.8449 | 36 | 77 |
| 6ixg-assembly2.cif.gz_B | crystal structure of native apo sh3bp5 (p41) | 0.8152 | 35 | 77 |
| 6v7u-assembly1.cif.gz_B | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.8126 | 32 | 77 |
| 6v7v-assembly1.cif.gz_B | structure of a phage-encoded quorum sensing anti-activator, aqs1 | 0.8083 | 32 | 77 |
| 8ap6-assembly1.cif.gz_H1 | trypanosoma brucei mitochondrial f1fo atp synthase dimer | 0.7804 | 35 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1grjA02 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.8875 | 83 | 156 | 3.10.50.30 |
| af_Q2FXW7_79_158_3.10.50.30 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.8653 | 83 | 156 | 3.10.50.30 |
| af_C6TGU6_233_320_1.20.58.160 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.8479 | 33 | 78 | 1.20.58.160 |
| af_Q20157_147_233_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.8435 | 35 | 78 | 1.20.1280.290 |
| 2eulB02 | Alpha Beta;Roll;Chitinase A; domain 3;Transcription elongation factor, GreA/GreB, C-terminal domain | 0.8417 | 89 | 151 | 3.10.50.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519JJQ2-F1-model_v4 | Transcription elongation factor | 0.9911 | 91 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A519JJQ2-F1-model_v4 | Transcription elongation factor | 0.9765 | 91 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A0Q7F9H2-F1-model_v4 | Transcription elongation factor | 0.966 | 1 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A0Q7F9H2-F1-model_v4 | Transcription elongation factor | 0.96 | 1 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
| AF-A0A4Q3UZ58-F1-model_v4 | Transcription elongation factor | 0.9578 | 64 | 156 |
GO:0003677
GO:0003746 GO:0006354 GO:0032784 GO:0070063 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar