F463308

General Info

Members Datasets Scaffolds Average Seq Length
557 264 556 283

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10156669|Ga0105242_101566692
Length 323
Sequence VPYQAKGIAFQGISLVKASKGLQVSFPILLFGRPLRPRSAPMSESPAARIPRGADKAGHPADKRHFFKKLLDLVAPGPDSRDQLMESLANAEHKELIEPESRMMLEGVIRMADMTAGDVMVASRHMDLLDIDAPFEEMLHVIIHTGHSRFPVFEGERTNVIGILMAKDLLKLQRSPDLNLRTLLRPAFYVPESKGLNDLLRDFRTNRNHIAIVIDEFGHTAGLLTLEDVDAESSIYTLAGGSQRVAGDATLAAVNEAFDVALPTDEFETIGGLVAHELGRVPRRGESVTIGGLVFSVMLARGGAVRWFKVTRAAEEALGSDGA

Samples

Sample ID Description Type Environment
1 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
242 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
246 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
247 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
248 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
255 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.31
Nodule 0
Rhizoplane 3.41
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003402 3300003215 Bacteria 8914
2 rootL2_10000628 3300003322 Bacteria 1675
3 JGI26128J50194_1003138 3300003347 Bacteria 1090
4 Ga0055535_1000631 3300003761 Bacteria 28134
5 Ga0055529_1000053 3300003763 Bacteria 198996
6 Ga0055540_1024966 3300003792 Bacteria 1472
7 Ga0070658_10013296 3300005327 Bacteria 6605
8 Ga0070658_10075460 3300005327 Bacteria 2765
9 Ga0070658_10293538 3300005327 Bacteria 1386
10 Ga0070676_10013228 3300005328 Bacteria 4520
11 Ga0070676_10013968 3300005328 Bacteria 4406
12 Ga0070683_100100530 3300005329 Bacteria 2722
13 Ga0070690_100247453 3300005330 Bacteria 1260
14 Ga0070670_100003283 3300005331 Bacteria 13377
15 Ga0070670_100056403 3300005331 Bacteria 3371
16 Ga0070670_100221348 3300005331 Bacteria 1647
17 Ga0070677_10017968 3300005333 Bacteria 2541
18 Ga0070677_10034134 3300005333 Bacteria 1963
19 Ga0070677_10081488 3300005333 Bacteria 1386
20 Ga0068869_100001109 3300005334 Bacteria 15686
21 Ga0068869_100004113 3300005334 Bacteria 9017
22 Ga0068869_100063999 3300005334 Bacteria 2704
23 Ga0070666_10250821 3300005335 Bacteria 1253
24 Ga0070680_100007161 3300005336 Bacteria 8500
25 Ga0068868_100012655 3300005338 Bacteria 6171
26 Ga0068868_100049128 3300005338 Bacteria 3311
27 Ga0068868_100059480 3300005338 Bacteria 3022
28 Ga0068868_100102295 3300005338 Bacteria 2319
29 Ga0068868_100241539 3300005338 Bacteria 1518
30 Ga0068868_100584667 3300005338 Bacteria 987
31 Ga0070660_100108905 3300005339 Bacteria 2202
32 Ga0070660_100253809 3300005339 Bacteria 1435
33 Ga0070687_100036022 3300005343 Bacteria 2462
34 Ga0070661_100278698 3300005344 Bacteria 1296
35 Ga0070668_100017856 3300005347 Bacteria 5321
36 Ga0070668_100021459 3300005347 Bacteria 4879
37 Ga0070669_100015377 3300005353 Bacteria 5454
38 Ga0070669_100017528 3300005353 Bacteria 5108
39 Ga0070669_100057183 3300005353 Bacteria 2861
40 Ga0070669_100107450 3300005353 Bacteria 2113
41 Ga0070675_100002407 3300005354 Bacteria 13964
42 Ga0070675_100006726 3300005354 Bacteria 8840
43 Ga0070675_100087661 3300005354 Bacteria 2603
44 Ga0070675_100100143 3300005354 Bacteria 2440
45 Ga0070675_100112682 3300005354 Bacteria 2303
46 Ga0070675_100170681 3300005354 Bacteria 1875
47 Ga0070675_100458631 3300005354 Bacteria 1144
48 Ga0070671_100002233 3300005355 Bacteria 14954
49 Ga0070671_100003297 3300005355 Bacteria 12596
50 Ga0070671_100012267 3300005355 Bacteria 6896
51 Ga0070671_100029652 3300005355 Bacteria 4512
52 Ga0070671_100055098 3300005355 Bacteria 3308
53 Ga0070671_100068003 3300005355 Bacteria 2971
54 Ga0070671_100164336 3300005355 Bacteria 1877
55 Ga0070674_100002398 3300005356 Bacteria 10355
56 Ga0070674_100015436 3300005356 Bacteria 4768
57 Ga0070674_100085939 3300005356 Bacteria 2258
58 Ga0070673_100008976 3300005364 Bacteria 6687
59 Ga0070673_100010633 3300005364 Bacteria 6238
60 Ga0070659_100035634 3300005366 Bacteria 3875
61 Ga0070659_100058705 3300005366 Bacteria 3037
62 Ga0070659_100082624 3300005366 Bacteria 2566
63 Ga0070659_100210730 3300005366 Bacteria 1601
64 Ga0070667_100002782 3300005367 Bacteria 15106
65 Ga0070667_100029009 3300005367 Bacteria 4608
66 Ga0070667_100034093 3300005367 Bacteria 4258
67 Ga0070667_100052056 3300005367 Bacteria 3454
68 Ga0070667_100065976 3300005367 Bacteria 3074
69 Ga0070708_100215671 3300005445 Bacteria 1799
70 Ga0070663_100031787 3300005455 Bacteria 3631
71 Ga0070678_100041854 3300005456 Bacteria 3251
72 Ga0070678_100111371 3300005456 Bacteria 2142
73 Ga0070678_100183861 3300005456 Bacteria 1713
74 Ga0070678_100211717 3300005456 Bacteria 1606
75 Ga0070678_100342198 3300005456 Bacteria 1283
76 Ga0070662_100009377 3300005457 Bacteria 6398
77 Ga0070662_100076103 3300005457 Bacteria 2487
78 Ga0070662_100158354 3300005457 Bacteria 1769
79 Ga0070681_10133025 3300005458 Bacteria 2419
80 Ga0068867_100017244 3300005459 Bacteria 5128
81 Ga0068867_100022036 3300005459 Bacteria 4552
82 Ga0068867_100067625 3300005459 Bacteria 2665
83 Ga0068867_100072428 3300005459 Bacteria 2579
84 Ga0068867_100194708 3300005459 Bacteria 1619
85 Ga0070706_100012422 3300005467 Bacteria 7891
86 Ga0070707_100023065 3300005468 Bacteria 5888
87 Ga0070679_100005203 3300005530 Bacteria 12039
88 Ga0070684_100071543 3300005535 Bacteria 3052
89 Ga0068853_100047672 3300005539 Bacteria 3677
90 Ga0068853_100068091 3300005539 Bacteria 3094
91 Ga0068853_100084180 3300005539 Bacteria 2787
92 Ga0068853_100116812 3300005539 Bacteria 2376
93 Ga0070672_100022717 3300005543 Bacteria 4613
94 Ga0070672_100037061 3300005543 Bacteria 3719
95 Ga0070672_100045629 3300005543 Bacteria 3391
96 Ga0070672_100140175 3300005543 Bacteria 1994
97 Ga0070672_100159112 3300005543 Bacteria 1872
98 Ga0070672_100172829 3300005543 Bacteria 1797
99 Ga0070672_100227585 3300005543 Bacteria 1566
100 Ga0070672_100239424 3300005543 Bacteria 1526
101 Ga0070686_100039045 3300005544 Bacteria 2956
102 Ga0070665_100025972 3300005548 Bacteria 5899
103 Ga0068855_100204174 3300005563 Bacteria 2224
104 Ga0068855_100526301 3300005563 Bacteria 1282
105 Ga0070664_100044366 3300005564 Bacteria 3754
106 Ga0070664_100091439 3300005564 Bacteria 2634
107 Ga0070664_100141583 3300005564 Bacteria 2118
108 Ga0070664_100300919 3300005564 Bacteria 1449
109 Ga0070664_100441709 3300005564 Bacteria 1193
110 Ga0070664_100602536 3300005564 Bacteria 1019
111 Ga0068857_100085958 3300005577 Bacteria 2811
112 Ga0068854_100053887 3300005578 Bacteria 2890
113 Ga0068854_100068524 3300005578 Bacteria 2587
114 Ga0068854_100259962 3300005578 Bacteria 1390
115 Ga0068856_100111052 3300005614 Bacteria 2739
116 Ga0068856_100116576 3300005614 Bacteria 2671
117 Ga0068856_100560414 3300005614 Bacteria 1164
118 Ga0068852_100018326 3300005616 Bacteria 5516
119 Ga0068852_100045891 3300005616 Bacteria 3720
120 Ga0068852_100091157 3300005616 Bacteria 2727
121 Ga0068852_100167427 3300005616 Bacteria 2057
122 Ga0068852_100357816 3300005616 Bacteria 1427
123 Ga0068859_100012655 3300005617 Bacteria 8481
124 Ga0068859_100076989 3300005617 Bacteria 3376
125 Ga0068859_100094323 3300005617 Bacteria 3045
126 Ga0068864_100001586 3300005618 Bacteria 18721
127 Ga0068864_100016462 3300005618 Bacteria 6154
128 Ga0068864_100130861 3300005618 Bacteria 2253
129 Ga0068864_100164259 3300005618 Bacteria 2020
130 Ga0068866_10010640 3300005718 Bacteria 3951
131 Ga0068861_100002537 3300005719 Bacteria 11928
132 Ga0068861_100154596 3300005719 Bacteria 1885
133 Ga0068861_100635823 3300005719 Bacteria 984
134 Ga0068851_10010631 3300005834 Bacteria 4298
135 Ga0068851_10022530 3300005834 Bacteria 3070
136 Ga0068863_100028068 3300005841 Bacteria 5372
137 Ga0068863_100053280 3300005841 Bacteria 3834
138 Ga0068863_100093851 3300005841 Bacteria 2848
139 Ga0068863_100177782 3300005841 Bacteria 2042
140 Ga0068858_100017858 3300005842 Bacteria 6643
141 Ga0068858_100026618 3300005842 Bacteria 5372
142 Ga0068858_100238073 3300005842 Bacteria 1726
143 Ga0068860_100024201 3300005843 Bacteria 5871
144 Ga0068860_100092712 3300005843 Bacteria 2878
145 Ga0068860_100342735 3300005843 Bacteria 1469
146 Ga0068862_100020476 3300005844 Bacteria 5526
147 Ga0068862_100122689 3300005844 Bacteria 2292
148 Ga0075368_10046046 3300006042 Bacteria 1725
149 Ga0075363_100069387 3300006048 Bacteria 1912
150 Ga0075362_10005313 3300006177 Bacteria 4705
151 Ga0075367_10002892 3300006178 Bacteria 7997
152 Ga0075367_10024832 3300006178 Bacteria 3382
153 Ga0075367_10045902 3300006178 Bacteria 2565
154 Ga0075369_10032135 3300006186 Bacteria 2219
155 Ga0075366_10015243 3300006195 Bacteria 4401
156 Ga0075366_10017361 3300006195 Bacteria 4142
157 Ga0075366_10033012 3300006195 Bacteria 3048
158 Ga0075366_10040385 3300006195 Bacteria 2759
159 Ga0097621_100028448 3300006237 Bacteria 4405
160 Ga0097621_100029233 3300006237 Bacteria 4351
161 Ga0075370_10000343 3300006353 Bacteria 16803
162 Ga0075370_10016278 3300006353 Bacteria 3999
163 Ga0075370_10023781 3300006353 Bacteria 3378
164 Ga0075370_10032812 3300006353 Bacteria 2904
165 Ga0075370_10072582 3300006353 Bacteria 1970
166 Ga0068871_100019550 3300006358 Bacteria 5173
167 Ga0068871_100083998 3300006358 Bacteria 2642
168 Ga0068871_100142966 3300006358 Bacteria 2035
169 Ga0068865_100026408 3300006881 Bacteria 3828
170 Ga0068865_100135682 3300006881 Bacteria 1849
171 Ga0097620_100012655 3300006931 Bacteria 8481
172 Ga0097620_100076996 3300006931 Bacteria 3376
173 Ga0097620_100094327 3300006931 Bacteria 3045
174 Ga0105240_10112489 3300009093 Bacteria 3291
175 Ga0105245_10036989 3300009098 Bacteria 4338
176 Ga0105243_10024506 3300009148 Bacteria 4602
177 Ga0105243_10027047 3300009148 Bacteria 4393
178 Ga0105243_10039684 3300009148 Bacteria 3672
179 Ga0105243_10157069 3300009148 Bacteria 1957
180 Ga0105243_10266713 3300009148 Bacteria 1535
181 Ga0105241_10235895 3300009174 Bacteria 1544
182 Ga0105242_10156669 3300009176 Bacteria 1990
183 Ga0105248_10019055 3300009177 Bacteria 7587
184 Ga0105248_10074326 3300009177 Bacteria 3820
185 Ga0105248_10393031 3300009177 Bacteria 1561
186 Ga0105237_10000678 3300009545 Bacteria 47128
187 Ga0105237_10015682 3300009545 Bacteria 7877
188 Ga0105237_10291803 3300009545 Bacteria 1634
189 Ga0105237_10352768 3300009545 Bacteria 1475
190 Ga0105238_10003973 3300009551 Bacteria 14670
191 Ga0105238_10113877 3300009551 Bacteria 2684
192 Ga0105249_10065537 3300009553 Bacteria 3342
193 Ga0105239_10000292 3300010375 Bacteria 73809
194 Ga0105239_10210629 3300010375 Bacteria 2179
195 Ga0105239_10447998 3300010375 Bacteria 1464
196 Ga0157373_10032511 3300013100 Bacteria 3755
197 Ga0157371_10036782 3300013102 Bacteria 3506
198 Ga0157371_10264218 3300013102 Bacteria 1241
199 Ga0157369_10056119 3300013105 Bacteria 4250
200 Ga0157369_10129815 3300013105 Bacteria 2671
201 Ga0157369_10167075 3300013105 Bacteria 2320
202 Ga0157374_10043485 3300013296 Bacteria 4151
203 Ga0157374_10044976 3300013296 Bacteria 4084
204 Ga0157374_10324057 3300013296 Bacteria 1527
205 Ga0157374_10457009 3300013296 Bacteria 1279
206 Ga0157378_10148273 3300013297 Bacteria 2184
207 Ga0157378_10159434 3300013297 Bacteria 2109
208 Ga0157378_10336149 3300013297 Bacteria 1471
209 Ga0157378_10403809 3300013297 Bacteria 1347
210 Ga0163162_10017055 3300013306 Bacteria 7105
211 Ga0163162_10067365 3300013306 Bacteria 3630
212 Ga0163162_10171208 3300013306 Bacteria 2296
213 Ga0157372_10026397 3300013307 Bacteria 6320
214 Ga0157372_10073513 3300013307 Bacteria 3854
215 Ga0157372_10253020 3300013307 Bacteria 2045
216 Ga0157375_10028018 3300013308 Bacteria 5274
217 Ga0157375_10028830 3300013308 Bacteria 5211
218 Ga0157375_10032445 3300013308 Bacteria 4954
219 Ga0157375_10134046 3300013308 Bacteria 2599
220 Ga0157375_10227582 3300013308 Bacteria 2024
221 Ga0157375_10248600 3300013308 Bacteria 1939
222 Ga0157375_10252093 3300013308 Bacteria 1926
223 Ga0163163_10019768 3300014325 Bacteria 6334
224 Ga0163163_10167520 3300014325 Bacteria 2243
225 Ga0163163_10217480 3300014325 Bacteria 1959
226 Ga0163163_10267550 3300014325 Bacteria 1760
227 Ga0157380_10026078 3300014326 Bacteria 4437
228 Ga0157377_10082660 3300014745 Bacteria 1880
229 Ga0157379_10017802 3300014968 Bacteria 6259
230 Ga0157379_10047603 3300014968 Bacteria 3825
231 Ga0157379_10053546 3300014968 Bacteria 3604
232 Ga0157379_10061570 3300014968 Bacteria 3356
233 Ga0157379_10069596 3300014968 Bacteria 3148
234 Ga0157379_10102006 3300014968 Bacteria 2575
235 Ga0157379_10163864 3300014968 Bacteria 2007
236 Ga0157379_10339000 3300014968 Bacteria 1375
237 Ga0157376_10010522 3300014969 Bacteria 6772
238 Ga0163161_10025768 3300017792 Bacteria 4164
239 Ga0163161_10056154 3300017792 Bacteria 2859
240 Ga0163161_10085867 3300017792 Bacteria 2322
241 Ga0213872_10000213 3300021361 Bacteria 51454
242 Ga0213872_10013302 3300021361 Bacteria 3858
243 Ga0213876_10076094 3300021384 Bacteria 1773
244 Ga0209672_104836 3300025228 Bacteria 2425
245 Ga0207427_100845 3300025231 Bacteria 13689
246 Ga0209258_100684 3300025242 Bacteria 23521
247 Ga0209258_101416 3300025242 Bacteria 8529
248 Ga0209677_105635 3300025253 Bacteria 3209
249 Ga0209759_1000863 3300025256 Bacteria 23454
250 Ga0209455_1000066 3300025272 Bacteria 316811
251 Ga0209758_1000045 3300025297 Bacteria 369174
252 Ga0209051_1006233 3300025303 Bacteria 6764
253 Ga0207697_10097017 3300025315 Bacteria 1254
254 Ga0207682_10073476 3300025893 Bacteria 1452
255 Ga0207642_10017138 3300025899 Bacteria 2747
256 Ga0207688_10064432 3300025901 Bacteria 2069
257 Ga0207688_10206740 3300025901 Bacteria 1178
258 Ga0207680_10018322 3300025903 Bacteria 3720
259 Ga0207680_10067162 3300025903 Bacteria 2208
260 Ga0207680_10330298 3300025903 Bacteria 1068
261 Ga0207645_10014294 3300025907 Bacteria 5316
262 Ga0207645_10019272 3300025907 Bacteria 4474
263 Ga0207645_10020699 3300025907 Bacteria 4301
264 Ga0207645_10025799 3300025907 Bacteria 3802
265 Ga0207705_10044030 3300025909 Bacteria 3207
266 Ga0207705_10054983 3300025909 Bacteria 2869
267 Ga0207654_10149869 3300025911 Bacteria 1496
268 Ga0207707_10339118 3300025912 Bacteria 1296
269 Ga0207695_10022891 3300025913 Bacteria 7077
270 Ga0207695_10027767 3300025913 Bacteria 6296
271 Ga0207671_10002997 3300025914 Bacteria 17310
272 Ga0207671_10056288 3300025914 Bacteria 2913
273 Ga0207662_10010872 3300025918 Bacteria 5031
274 Ga0207662_10025880 3300025918 Bacteria 3382
275 Ga0207657_10045702 3300025919 Bacteria 3840
276 Ga0207657_10078549 3300025919 Bacteria 2779
277 Ga0207657_10100446 3300025919 Bacteria 2402
278 Ga0207657_10130267 3300025919 Bacteria 2062
279 Ga0207649_10006792 3300025920 Bacteria 6216
280 Ga0207649_10023420 3300025920 Bacteria 3576
281 Ga0207649_10159191 3300025920 Bacteria 1563
282 Ga0207681_10001232 3300025923 Bacteria 16486
283 Ga0207681_10012963 3300025923 Bacteria 5153
284 Ga0207681_10028185 3300025923 Bacteria 3636
285 Ga0207681_10045058 3300025923 Bacteria 2959
286 Ga0207694_10012208 3300025924 Bacteria 6478
287 Ga0207694_10078909 3300025924 Bacteria 2581
288 Ga0207650_10001909 3300025925 Bacteria 14684
289 Ga0207650_10002430 3300025925 Bacteria 12967
290 Ga0207650_10005782 3300025925 Bacteria 8439
291 Ga0207650_10112175 3300025925 Bacteria 2112
292 Ga0207650_10152350 3300025925 Bacteria 1825
293 Ga0207659_10013801 3300025926 Bacteria 5191
294 Ga0207659_10017237 3300025926 Bacteria 4714
295 Ga0207659_10054027 3300025926 Bacteria 2867
296 Ga0207659_10136330 3300025926 Bacteria 1900
297 Ga0207687_10337303 3300025927 Bacteria 1225
298 Ga0207644_10000360 3300025931 Bacteria 29659
299 Ga0207644_10001397 3300025931 Bacteria 15575
300 Ga0207644_10001986 3300025931 Bacteria 13227
301 Ga0207644_10021425 3300025931 Bacteria 4403
302 Ga0207644_10132628 3300025931 Bacteria 1909
303 Ga0207644_10138544 3300025931 Bacteria 1871
304 Ga0207690_10010640 3300025932 Bacteria 5481
305 Ga0207690_10017773 3300025932 Bacteria 4350
306 Ga0207690_10287058 3300025932 Bacteria 1283
307 Ga0207706_10002136 3300025933 Bacteria 19351
308 Ga0207706_10081416 3300025933 Bacteria 2845
309 Ga0207706_10097815 3300025933 Bacteria 2581
310 Ga0207706_10391405 3300025933 Bacteria 1206
311 Ga0207686_10102686 3300025934 Bacteria 1912
312 Ga0207686_10199343 3300025934 Bacteria 1432
313 Ga0207709_10014029 3300025935 Bacteria 4423
314 Ga0207669_10007339 3300025937 Bacteria 5091
315 Ga0207669_10024206 3300025937 Bacteria 3259
316 Ga0207665_10063433 3300025939 Bacteria 2509
317 Ga0207691_10006224 3300025940 Bacteria 11527
318 Ga0207691_10041671 3300025940 Bacteria 4238
319 Ga0207691_10067381 3300025940 Bacteria 3237
320 Ga0207691_10095757 3300025940 Bacteria 2654
321 Ga0207691_10243654 3300025940 Bacteria 1553
322 Ga0207711_10003194 3300025941 Bacteria 14299
323 Ga0207711_10019245 3300025941 Bacteria 5684
324 Ga0207711_10032898 3300025941 Bacteria 4385
325 Ga0207689_10001660 3300025942 Bacteria 21098
326 Ga0207689_10011343 3300025942 Bacteria 7644
327 Ga0207689_10048437 3300025942 Bacteria 3505
328 Ga0207679_10000587 3300025945 Bacteria 24340
329 Ga0207679_10044288 3300025945 Bacteria 3210
330 Ga0207667_10012039 3300025949 Bacteria 10007
331 Ga0207667_10047835 3300025949 Bacteria 4526
332 Ga0207667_10108049 3300025949 Bacteria 2870
333 Ga0207667_10152173 3300025949 Bacteria 2381
334 Ga0207651_10024383 3300025960 Bacteria 3741
335 Ga0207651_10034458 3300025960 Bacteria 3279
336 Ga0207712_10010534 3300025961 Bacteria 5869
337 Ga0207668_10025672 3300025972 Bacteria 3815
338 Ga0207668_10053415 3300025972 Bacteria 2800
339 Ga0207668_10363892 3300025972 Bacteria 1213
340 Ga0207640_10019976 3300025981 Bacteria 3969
341 Ga0207658_10000904 3300025986 Bacteria 24667
342 Ga0207658_10001973 3300025986 Bacteria 15312
343 Ga0207658_10024111 3300025986 Bacteria 4252
344 Ga0207658_10035665 3300025986 Bacteria 3564
345 Ga0207658_10046784 3300025986 Bacteria 3162
346 Ga0207677_10003021 3300026023 Bacteria 8884
347 Ga0207677_10007546 3300026023 Bacteria 6030
348 Ga0207677_10083713 3300026023 Bacteria 2297
349 Ga0207677_10157477 3300026023 Bacteria 1761
350 Ga0207677_10243787 3300026023 Bacteria 1455
351 Ga0207677_10376819 3300026023 Bacteria 1196
352 Ga0207703_10001363 3300026035 Bacteria 22299
353 Ga0207703_10004044 3300026035 Bacteria 12114
354 Ga0207703_10251861 3300026035 Bacteria 1592
355 Ga0207703_10349041 3300026035 Bacteria 1362
356 Ga0207639_10023442 3300026041 Bacteria 4458
357 Ga0207639_10058070 3300026041 Bacteria 2974
358 Ga0207639_10072479 3300026041 Bacteria 2697
359 Ga0207639_10327832 3300026041 Bacteria 1361
360 Ga0207678_10003971 3300026067 Bacteria 13306
361 Ga0207702_10025983 3300026078 Bacteria 4861
362 Ga0207702_10132968 3300026078 Bacteria 2241
363 Ga0207702_10511187 3300026078 Bacteria 1172
364 Ga0207641_10001982 3300026088 Bacteria 19548
365 Ga0207641_10043981 3300026088 Bacteria 3753
366 Ga0207641_10089816 3300026088 Bacteria 2685
367 Ga0207641_10123693 3300026088 Bacteria 2312
368 Ga0207648_10019999 3300026089 Bacteria 6040
369 Ga0207648_10102530 3300026089 Bacteria 2508
370 Ga0207648_10141396 3300026089 Bacteria 2121
371 Ga0207648_10298059 3300026089 Bacteria 1445
372 Ga0207676_10012968 3300026095 Bacteria 5985
373 Ga0207676_10038561 3300026095 Bacteria 3648
374 Ga0207676_10059422 3300026095 Bacteria 3019
375 Ga0207676_10070880 3300026095 Bacteria 2796
376 Ga0207676_10115786 3300026095 Bacteria 2251
377 Ga0207674_10030621 3300026116 Bacteria 5656
378 Ga0207675_100011117 3300026118 Bacteria 8434
379 Ga0207675_100073601 3300026118 Bacteria 3197
380 Ga0207675_100151385 3300026118 Bacteria 2208
381 Ga0207683_10015725 3300026121 Bacteria 6440
382 Ga0207683_10053490 3300026121 Bacteria 3540
383 Ga0207683_10148089 3300026121 Bacteria 2118
384 Ga0207683_10192747 3300026121 Bacteria 1851
385 Ga0207683_10446165 3300026121 Bacteria 1192
386 Ga0207698_10019362 3300026142 Bacteria 4658
387 Ga0207698_10033499 3300026142 Bacteria 3734
388 Ga0207698_10050800 3300026142 Bacteria 3166
389 Ga0207698_10089353 3300026142 Bacteria 2516
390 Ga0207698_10118199 3300026142 Bacteria 2238
391 Ga0207698_10416722 3300026142 Bacteria 1288
392 Ga0209996_1002217 3300027395 Bacteria 2398
393 Ga0209968_1002111 3300027526 Bacteria 3021
394 Ga0209966_1000245 3300027695 Bacteria 20071
395 Ga0209974_10000344 3300027876 Bacteria 15213
396 Ga0268266_10045727 3300028379 Bacteria 3745
397 Ga0268265_10005342 3300028380 Bacteria 8802
398 Ga0268265_10091803 3300028380 Bacteria 2429
399 Ga0268264_10013830 3300028381 Bacteria 6639
400 Ga0268264_10127289 3300028381 Bacteria 2253
401 Ga0268264_10159545 3300028381 Bacteria 2030
402 Ga0307515_10026866 3300028794 Bacteria 9874
403 Ga0307515_10038096 3300028794 Bacteria 7705
404 Ga0307515_10111695 3300028794 Bacteria 3186
405 Ga0307512_10096602 3300030522 Bacteria 2025
406 Ga0265328_10094978 3300031239 Bacteria 1102
407 Ga0307513_10087334 3300031456 Bacteria 3192
408 Ga0307509_10001361 3300031507 Bacteria 41386
409 Ga0307509_10010234 3300031507 Bacteria 11535
410 Ga0307509_10011254 3300031507 Bacteria 10856
411 Ga0307509_10050269 3300031507 Bacteria 4464
412 Ga0307508_10016446 3300031616 Bacteria 6735
413 Ga0307514_10033173 3300031649 Bacteria 4122
414 Ga0307514_10168064 3300031649 Bacteria 1438
415 Ga0307516_10000556 3300031730 Bacteria 50206
416 Ga0307516_10031885 3300031730 Bacteria 5311
417 Ga0307413_10013390 3300031824 Bacteria 4122
418 Ga0307410_10000671 3300031852 Bacteria 14181
419 Ga0307410_10240354 3300031852 Bacteria 1403
420 Ga0307407_10068440 3300031903 Bacteria 2103
421 Ga0307407_10211116 3300031903 Bacteria 1307
422 Ga0307412_10006313 3300031911 Bacteria 6695
423 Ga0307409_100003270 3300031995 Bacteria 8748
424 Ga0307416_100002710 3300032002 Bacteria 10263
425 Ga0307416_100148990 3300032002 Bacteria 2142
426 Ga0307416_100555318 3300032002 Bacteria 1222
427 Ga0307414_10040553 3300032004 Bacteria 3146
428 Ga0307411_10006540 3300032005 Bacteria 5843
429 Ga0307415_100035673 3300032126 Bacteria 3250
430 Ga0307415_100187583 3300032126 Bacteria 1629
431 Ga0307510_10001484 3300033180 Bacteria 25882
432 Ga0307510_10022280 3300033180 Bacteria 7362
433 Ga0307510_10054512 3300033180 Bacteria 4186
434 Ga0307510_10128435 3300033180 Bacteria 2216
435 Ga0373945_0042645 3300035116 Bacteria 1645
436 Ga0373961_0048062 3300035241 Bacteria 1256
437 Ga0373931_0001799 3300035691 Bacteria 9321
438 Ga0373931_0002595 3300035691 Bacteria 8052
439 Ga0373931_0015779 3300035691 Bacteria 3708
440 Ga0373931_0099169 3300035691 Bacteria 1636
441 Ga0373927_0055683 3300035695 Bacteria 2557
442 Ga0373925_0001991 3300037068 Bacteria 16921
443 Ga0395898_0000466 3300037466 Bacteria 80988
444 Ga0395905_0051063 3300037471 Bacteria 3873
445 Ga0395905_0053475 3300037471 Bacteria 3779
446 Ga0436365_0487766 3300039437 Bacteria 2081
447 Ga0436361_0524686 3300039447 Bacteria 114368
448 Ga0436361_1056014 3300039447 Bacteria 7773
449 Ga0450898_029272 3300042134 Bacteria 1004
450 Ga0439434_0054522 3300042435 Bacteria 1244
451 Ga0451577_0011231 3300042876 Bacteria 8488
452 Ga0451577_0058330 3300042876 Bacteria 3441
453 Ga0466969_0002937 3300044656 Bacteria 9097
454 Ga0466965_0000776 3300044683 Bacteria 12035
455 Ga0466966_0000733 3300044684 Bacteria 20852
456 Ga0466961_0028233 3300044693 Bacteria 3607
457 Ga0466964_0002801 3300044706 Bacteria 6274
458 Ga0453684_0181597 3300044712 Bacteria 2470
459 Ga0466971_0001760 3300044719 Bacteria 9189
460 Ga0466970_0023834 3300044765 Bacteria 3199
461 Ga0466957_0001375 3300044842 Bacteria 12693
462 Ga0451576_0248001 3300045051 Bacteria 1861
463 Ga0495592_0000495 3300046454 Bacteria 28713
464 Ga0495585_0022129 3300046492 Bacteria 3649
465 Ga0495583_0003127 3300046506 Bacteria 13069
466 Ga0495606_0000444 3300046507 Bacteria 67633
467 Ga0495610_0075921 3300046512 Bacteria 1555
468 Ga0495632_0020185 3300046519 Bacteria 3613
469 Ga0495632_0025341 3300046519 Bacteria 3138
470 Ga0495642_0103648 3300046528 Bacteria 1213
471 Ga0495621_0010233 3300046539 Bacteria 2863
472 Ga0495621_0018430 3300046539 Bacteria 2266
473 Ga0495597_0022481 3300046542 Bacteria 2925
474 Ga0495645_0053726 3300046543 Bacteria 2928
475 Ga0495668_0060534 3300046616 Bacteria 2089
476 Ga0495625_0014161 3300046660 Bacteria 6380
477 Ga0495646_0089842 3300046680 Bacteria 1776
478 Ga0495658_0029859 3300046683 Bacteria 2955
479 Ga0495613_0158245 3300046689 Bacteria 1613
480 Ga0495624_0134069 3300046690 Bacteria 1518
481 Ga0495649_0001120 3300046694 Bacteria 20832
482 Ga0495649_0004853 3300046694 Bacteria 8693
483 Ga0495676_0060280 3300047321 Bacteria 2975
484 Ga0495687_000292 3300047443 Bacteria 65859
485 Ga0495687_004028 3300047443 Bacteria 10202
486 Ga0495673_0039788 3300047469 Bacteria 2131
487 Ga0495684_0091452 3300047471 Bacteria 2305
488 Ga0495686_0006348 3300047472 Bacteria 9069
489 Ga0495686_0012113 3300047472 Bacteria 6053
490 Ga0495686_0042733 3300047472 Bacteria 2879
491 Ga0495686_0066475 3300047472 Bacteria 2228
492 Ga0495593_0022387 3300047673 Bacteria 3521
493 Ga0496100_0079881 3300048903 Bacteria 2205
494 Ga0496101_0110108 3300048904 Bacteria 2072
495 Ga0496102_0042012 3300048905 Bacteria 4143
496 Ga0496102_0240434 3300048905 Bacteria 1707
497 Ga0496103_0072501 3300048906 Bacteria 2157
498 Ga0496104_0201450 3300048907 Bacteria 1902
499 Ga0496105_0237904 3300048908 Bacteria 1478
500 Ga0496106_0013266 3300048909 Bacteria 6083
501 Ga0496107_0013711 3300048910 Bacteria 5668
502 Ga0496107_0401086 3300048910 Bacteria 1020
503 Ga0496108_0134366 3300048911 Bacteria 2127
504 Ga0496109_0068718 3300048912 Bacteria 3247
505 Ga0496110_0151050 3300048913 Bacteria 2103
506 Ga0496110_0345566 3300048913 Bacteria 1355
507 Ga0496111_0053517 3300048914 Bacteria 2917
508 Ga0496112_0709619 3300048915 Bacteria 933
509 Ga0496114_0244172 3300048917 Bacteria 1579
510 Ga0496115_0023338 3300048918 Bacteria 4800
511 Ga0496115_0407705 3300048918 Bacteria 1102
512 Ga0496125_0084409 3300048928 Bacteria 2412
513 Ga0501043_0000049 3300049579 Bacteria 107569
514 Ga0501046_0000120 3300049580 Bacteria 83103
515 Ga0501047_0000106 3300049581 Bacteria 102213
516 Ga0501048_0001095 3300049582 Bacteria 20333
517 Ga0501198_000016 3300049649 Bacteria 102263
518 Ga0501222_000015 3300049662 Bacteria 83034
519 nmdc:mga03683_27841_c1 3300050489 Bacteria 2243
520 nmdc:mga0yw44_206962_c1 3300050492 Bacteria 1297
521 nmdc:mga0k408_1564_c1 3300050493 Bacteria 12138
522 nmdc:mga0k408_167065_c1 3300050493 Bacteria 1311
523 nmdc:mga0k408_24165_c1 3300050493 Bacteria 3434
524 nmdc:mga0k408_252_c1 3300050493 Bacteria 29077
525 nmdc:mga0k408_40960_c1 3300050493 Bacteria 2667
526 nmdc:mga0k408_66900_c1 3300050493 Bacteria 2094
527 nmdc:mga06z11_4444_c1 3300050494 Bacteria 5517
528 nmdc:mga06z11_71973_c1 3300050494 Bacteria 1832
529 nmdc:mga06z11_90527_c1 3300050494 Bacteria 1660
530 nmdc:mga04h51_6896_c1 3300050495 Bacteria 2972
531 nmdc:mga07m45_1024_c1 3300050496 Bacteria 12383
532 nmdc:mga07m45_18045_c1 3300050496 Bacteria 3801
533 nmdc:mga07m45_215968_c1 3300050496 Bacteria 1116
534 nmdc:mga07m45_240_c1 3300050496 Bacteria 22136
535 nmdc:mga07m45_3135_c1 3300050496 Bacteria 7922
536 nmdc:mga07m45_4116_c2 3300050496 Bacteria 6690
537 nmdc:mga07m45_6788_c1 3300050496 Bacteria 5814
538 nmdc:mga0n895_410480_c1 3300050512 Bacteria 1369
539 nmdc:mga0sz30_26461_c1 3300050516 Bacteria 2378
540 nmdc:mga0sz30_44702_c1 3300050516 Bacteria 1867
541 Ga0495595_0129712 3300053084 Bacteria 1232
542 Ga0500651_0043052 3300053093 Bacteria 2844
543 Ga0500651_0059118 3300053093 Bacteria 2397
544 Ga0500593_000371 3300053117 Bacteria 18072
545 Ga0500594_0006299 3300053118 Bacteria 2661
546 Ga0500655_018582 3300053133 Bacteria 1291
547 Ga0500658_0009325 3300053134 Bacteria 3620
548 Ga0500559_0000176 3300053136 Bacteria 50699
549 Ga0500568_0006103 3300053139 Bacteria 6107
550 Ga0500568_0019092 3300053139 Bacteria 2987
551 Ga0500619_000054 3300053154 Bacteria 34866
552 Ga0500622_0001562 3300053156 Bacteria 18102
553 Ga0500636_0029809 3300053177 Bacteria 3225
554 Ga0500645_006890 3300053730 Bacteria 4012
555 Ga0500587_004729 3300053739 Bacteria 1858
556 Ga0466962_0033473 3300061719 Bacteria 2458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021361 Ga0213872_10000213 Ga0213872_1000021312 245
2 3300039447 Ga0436361_0524686 Ga0436361_0524686_42499_43296 245
3 3300003761 Ga0055535_1000631 Ga0055535_100063116 253
4 3300003763 Ga0055529_1000053 Ga0055529_100005310 253
5 3300035691 Ga0373931_0002595 Ga0373931_0002595_4170_5003 253
6 3300035691 Ga0373931_0099169 Ga0373931_0099169_307_1140 253
7 3300009174 Ga0105241_10235895 Ga0105241_102358951 257
8 3300005535 Ga0070684_100071543 Ga0070684_1000715432 258
9 3300025903 Ga0207680_10067162 Ga0207680_100671622 261
10 3300005331 Ga0070670_100056403 Ga0070670_1000564032 262
11 3300005333 Ga0070677_10081488 Ga0070677_100814882 262
12 3300005338 Ga0068868_100049128 Ga0068868_1000491281 262
13 3300005347 Ga0070668_100017856 Ga0070668_1000178564 262
14 3300005353 Ga0070669_100015377 Ga0070669_1000153774 262
15 3300005355 Ga0070671_100003297 Ga0070671_1000032978 262
16 3300005356 Ga0070674_100002398 Ga0070674_1000023989 262
17 3300005364 Ga0070673_100008976 Ga0070673_1000089762 262
18 3300005367 Ga0070667_100052056 Ga0070667_1000520562 262
19 3300005456 Ga0070678_100211717 Ga0070678_1002117172 262
20 3300005459 Ga0068867_100017244 Ga0068867_1000172444 262
21 3300005543 Ga0070672_100037061 Ga0070672_1000370612 262
22 3300005616 Ga0068852_100091157 Ga0068852_1000911572 262
23 3300006237 Ga0097621_100028448 Ga0097621_1000284482 262
24 3300017792 Ga0163161_10085867 Ga0163161_100858671 262
25 3300025901 Ga0207688_10064432 Ga0207688_100644322 262
26 3300025923 Ga0207681_10045058 Ga0207681_100450583 262
27 3300025925 Ga0207650_10005782 Ga0207650_100057822 262
28 3300025931 Ga0207644_10001397 Ga0207644_1000139713 262
29 3300025937 Ga0207669_10024206 Ga0207669_100242062 262
30 3300025940 Ga0207691_10006224 Ga0207691_100062248 262
31 3300025960 Ga0207651_10034458 Ga0207651_100344582 262
32 3300025972 Ga0207668_10053415 Ga0207668_100534152 262
33 3300025986 Ga0207658_10035665 Ga0207658_100356653 262
34 3300026142 Ga0207698_10050800 Ga0207698_100508002 262
35 3300005338 Ga0068868_100241539 Ga0068868_1002415392 263
36 3300005355 Ga0070671_100055098 Ga0070671_1000550982 263
37 3300005356 Ga0070674_100015436 Ga0070674_1000154362 263
38 3300005459 Ga0068867_100194708 Ga0068867_1001947082 263
39 3300005578 Ga0068854_100259962 Ga0068854_1002599622 263
40 3300025907 Ga0207645_10025799 Ga0207645_100257994 263
41 3300025931 Ga0207644_10132628 Ga0207644_101326282 263
42 3300026023 Ga0207677_10157477 Ga0207677_101574772 263
43 3300026121 Ga0207683_10192747 Ga0207683_101927472 263
44 3300037471 Ga0395905_0051063 Ga0395905_0051063_1263_2102 264
45 3300037471 Ga0395905_0053475 Ga0395905_0053475_2458_3297 264
46 3300005353 Ga0070669_100107450 Ga0070669_1001074502 265
47 3300005456 Ga0070678_100111371 Ga0070678_1001113712 265
48 3300005543 Ga0070672_100227585 Ga0070672_1002275852 265
49 3300009148 Ga0105243_10039684 Ga0105243_100396843 265
50 3300013105 Ga0157369_10167075 Ga0157369_101670751 265
51 3300025893 Ga0207682_10073476 Ga0207682_100734762 265
52 3300025923 Ga0207681_10012963 Ga0207681_100129632 265
53 3300025940 Ga0207691_10095757 Ga0207691_100957572 265
54 3300046539 Ga0495621_0010233 Ga0495621_0010233_1139_2068 265
55 3300046539 Ga0495621_0018430 Ga0495621_0018430_270_1199 265
56 3300047673 Ga0495593_0022387 Ga0495593_0022387_1838_2728 265
57 3300005548 Ga0070665_100025972 Ga0070665_1000259724 266
58 3300013296 Ga0157374_10457009 Ga0157374_104570092 266
59 3300013297 Ga0157378_10159434 Ga0157378_101594342 266
60 3300013308 Ga0157375_10227582 Ga0157375_102275822 266
61 3300014325 Ga0163163_10267550 Ga0163163_102675502 266
62 3300014968 Ga0157379_10061570 Ga0157379_100615702 266
63 3300028379 Ga0268266_10045727 Ga0268266_100457272 266
64 3300021361 Ga0213872_10013302 Ga0213872_100133022 269
65 3300031824 Ga0307413_10013390 Ga0307413_100133902 269
66 3300031852 Ga0307410_10000671 Ga0307410_100006718 269
67 3300031911 Ga0307412_10006313 Ga0307412_100063132 269
68 3300031995 Ga0307409_100003270 Ga0307409_1000032704 269
69 3300032002 Ga0307416_100002710 Ga0307416_1000027103 269
70 3300032004 Ga0307414_10040553 Ga0307414_100405532 269
71 3300032005 Ga0307411_10006540 Ga0307411_100065404 269
72 3300039447 Ga0436361_1056014 Ga0436361_1056014_2195_3163 269
73 3300003347 JGI26128J50194_1003138 JGI26128J50194_10031381 270
74 3300027395 Ga0209996_1002217 Ga0209996_10022173 270
75 3300027526 Ga0209968_1002111 Ga0209968_10021112 270
76 3300027695 Ga0209966_1000245 Ga0209966_10002458 270
77 3300031730 Ga0307516_10031885 Ga0307516_100318853 270
78 3300050493 nmdc:mga0k408_1564_c1 nmdc:mga0k408_1564_c1_7509_8369 270
79 3300005539 Ga0068853_100116812 Ga0068853_1001168121 271
80 3300009545 Ga0105237_10000678 Ga0105237_1000067840 271
81 3300009551 Ga0105238_10003973 Ga0105238_1000397311 271
82 3300010375 Ga0105239_10000292 Ga0105239_1000029263 271
83 3300025242 Ga0209258_101416 Ga0209258_1014164 271
84 3300025913 Ga0207695_10027767 Ga0207695_100277676 271
85 3300025914 Ga0207671_10002997 Ga0207671_1000299714 271
86 3300025924 Ga0207694_10012208 Ga0207694_100122084 271
87 3300026041 Ga0207639_10058070 Ga0207639_100580701 271
88 3300026121 Ga0207683_10148089 Ga0207683_101480892 271
89 3300028380 Ga0268265_10091803 Ga0268265_100918032 271
90 3300048928 Ga0496125_0084409 Ga0496125_0084409_326_1189 271
91 3300003792 Ga0055540_1024966 Ga0055540_10249661 272
92 3300013306 Ga0163162_10171208 Ga0163162_101712082 272
93 3300025303 Ga0209051_1006233 Ga0209051_10062334 272
94 3300042876 Ga0451577_0058330 Ga0451577_0058330_1877_2764 272
95 3300044712 Ga0453684_0181597 Ga0453684_0181597_1484_2371 272
96 3300048910 Ga0496107_0401086 Ga0496107_0401086_81_983 272
97 3300005614 Ga0068856_100111052 Ga0068856_1001110521 273
98 3300025253 Ga0209677_105635 Ga0209677_1056354 273
99 3300026078 Ga0207702_10511187 Ga0207702_105111871 273
100 3300005327 Ga0070658_10075460 Ga0070658_100754602 274
101 3300006195 Ga0075366_10040385 Ga0075366_100403851 274
102 3300006353 Ga0075370_10000343 Ga0075370_100003433 274
103 3300009148 Ga0105243_10024506 Ga0105243_100245064 274
104 3300025228 Ga0209672_104836 Ga0209672_1048362 274
105 3300025231 Ga0207427_100845 Ga0207427_1008454 274
106 3300025242 Ga0209258_100684 Ga0209258_10068410 274
107 3300025256 Ga0209759_1000863 Ga0209759_100086310 274
108 3300025272 Ga0209455_1000066 Ga0209455_100006610 274
109 3300025909 Ga0207705_10054983 Ga0207705_100549832 274
110 3300025913 Ga0207695_10022891 Ga0207695_100228914 274
111 3300025919 Ga0207657_10045702 Ga0207657_100457024 274
112 3300025949 Ga0207667_10012039 Ga0207667_100120392 274
113 3300032002 Ga0307416_100555318 Ga0307416_1005553182 274
114 3300035116 Ga0373945_0042645 Ga0373945_0042645_617_1492 274
115 3300035695 Ga0373927_0055683 Ga0373927_0055683_125_1000 274
116 3300037068 Ga0373925_0001991 Ga0373925_0001991_15328_16203 274
117 3300042435 Ga0439434_0054522 Ga0439434_0054522_326_1198 274
118 3300044656 Ga0466969_0002937 Ga0466969_0002937_3097_4002 274
119 3300044683 Ga0466965_0000776 Ga0466965_0000776_1701_2606 274
120 3300044684 Ga0466966_0000733 Ga0466966_0000733_1311_2216 274
121 3300044693 Ga0466961_0028233 Ga0466961_0028233_1709_2614 274
122 3300044706 Ga0466964_0002801 Ga0466964_0002801_638_1543 274
123 3300044719 Ga0466971_0001760 Ga0466971_0001760_608_1513 274
124 3300044765 Ga0466970_0023834 Ga0466970_0023834_1760_2665 274
125 3300044842 Ga0466957_0001375 Ga0466957_0001375_10009_10914 274
126 3300046492 Ga0495585_0022129 Ga0495585_0022129_1609_2511 274
127 3300046506 Ga0495583_0003127 Ga0495583_0003127_9628_10530 274
128 3300046507 Ga0495606_0000444 Ga0495606_0000444_54150_55052 274
129 3300046660 Ga0495625_0014161 Ga0495625_0014161_5353_6255 274
130 3300046694 Ga0495649_0001120 Ga0495649_0001120_8486_9388 274
131 3300047472 Ga0495686_0012113 Ga0495686_0012113_4734_5636 274
132 3300048918 Ga0496115_0407705 Ga0496115_0407705_95_997 274
133 3300050493 nmdc:mga0k408_167065_c1 nmdc:mga0k408_167065_c1_299_1201 274
134 3300050496 nmdc:mga07m45_240_c1 nmdc:mga07m45_240_c1_6910_7812 274
135 3300053093 Ga0500651_0059118 Ga0500651_0059118_686_1588 274
136 3300053177 Ga0500636_0029809 Ga0500636_0029809_521_1423 274
137 3300061719 Ga0466962_0033473 Ga0466962_0033473_1000_1905 274
138 3300005338 Ga0068868_100102295 Ga0068868_1001022952 277
139 3300005355 Ga0070671_100164336 Ga0070671_1001643362 277
140 3300005617 Ga0068859_100012655 Ga0068859_1000126554 277
141 3300005841 Ga0068863_100093851 Ga0068863_1000938512 277
142 3300006353 Ga0075370_10016278 Ga0075370_100162784 277
143 3300006931 Ga0097620_100012655 Ga0097620_1000126554 277
144 3300026035 Ga0207703_10251861 Ga0207703_102518612 277
145 3300026088 Ga0207641_10123693 Ga0207641_101236932 277
146 3300050496 nmdc:mga07m45_18045_c1 nmdc:mga07m45_18045_c1_2756_3643 277
147 3300053139 Ga0500568_0006103 Ga0500568_0006103_3203_4150 277
148 3300003322 rootL2_10000628 rootL2_100006282 278
149 3300005445 Ga0070708_100215671 Ga0070708_1002156712 278
150 3300005467 Ga0070706_100012422 Ga0070706_1000124228 278
151 3300005468 Ga0070707_100023065 Ga0070707_1000230654 278
152 3300005564 Ga0070664_100602536 Ga0070664_1006025361 278
153 3300006042 Ga0075368_10046046 Ga0075368_100460462 278
154 3300006178 Ga0075367_10024832 Ga0075367_100248323 278
155 3300006195 Ga0075366_10015243 Ga0075366_100152433 278
156 3300033180 Ga0307510_10001484 Ga0307510_1000148410 278
157 3300050493 nmdc:mga0k408_24165_c1 nmdc:mga0k408_24165_c1_1675_2559 278
158 3300050494 nmdc:mga06z11_90527_c1 nmdc:mga06z11_90527_c1_157_1041 278
159 iso_pu_bacteria 2643221654 2644303426 278
160 3300005328 Ga0070676_10013228 Ga0070676_100132282 279
161 3300005331 Ga0070670_100221348 Ga0070670_1002213481 279
162 3300005354 Ga0070675_100087661 Ga0070675_1000876612 279
163 3300005355 Ga0070671_100029652 Ga0070671_1000296522 279
164 3300005355 Ga0070671_100068003 Ga0070671_1000680032 279
165 3300005367 Ga0070667_100034093 Ga0070667_1000340934 279
166 3300005459 Ga0068867_100022036 Ga0068867_1000220363 279
167 3300005543 Ga0070672_100140175 Ga0070672_1001401752 279
168 3300005563 Ga0068855_100526301 Ga0068855_1005263012 279
169 3300005577 Ga0068857_100085958 Ga0068857_1000859582 279
170 3300006881 Ga0068865_100026408 Ga0068865_1000264083 279
171 3300009148 Ga0105243_10157069 Ga0105243_101570692 279
172 3300009177 Ga0105248_10393031 Ga0105248_103930312 279
173 3300013296 Ga0157374_10324057 Ga0157374_103240572 279
174 3300013297 Ga0157378_10403809 Ga0157378_104038092 279
175 3300013308 Ga0157375_10134046 Ga0157375_101340462 279
176 3300014968 Ga0157379_10102006 Ga0157379_101020062 279
177 3300025907 Ga0207645_10020699 Ga0207645_100206992 279
178 3300025925 Ga0207650_10152350 Ga0207650_101523501 279
179 3300025926 Ga0207659_10013801 Ga0207659_100138014 279
180 3300025927 Ga0207687_10337303 Ga0207687_103373032 279
181 3300025931 Ga0207644_10021425 Ga0207644_100214253 279
182 3300025949 Ga0207667_10047835 Ga0207667_100478353 279
183 3300025972 Ga0207668_10363892 Ga0207668_103638921 279
184 3300026023 Ga0207677_10083713 Ga0207677_100837131 279
185 3300026089 Ga0207648_10019999 Ga0207648_100199993 279
186 3300026116 Ga0207674_10030621 Ga0207674_100306214 279
187 3300026121 Ga0207683_10446165 Ga0207683_104461652 279
188 3300028794 Ga0307515_10026866 Ga0307515_100268665 279
189 3300037466 Ga0395898_0000466 Ga0395898_0000466_15821_16714 279
190 3300048905 Ga0496102_0240434 Ga0496102_0240434_231_1115 279
191 3300049579 Ga0501043_0000049 Ga0501043_0000049_24048_24944 279
192 3300049580 Ga0501046_0000120 Ga0501046_0000120_58160_59056 279
193 3300049581 Ga0501047_0000106 Ga0501047_0000106_18115_19011 279
194 3300049582 Ga0501048_0001095 Ga0501048_0001095_10243_11139 279
195 3300049649 Ga0501198_000016 Ga0501198_000016_53687_54580 279
196 3300049662 Ga0501222_000015 Ga0501222_000015_28423_29316 279
197 3300005354 Ga0070675_100458631 Ga0070675_1004586311 280
198 3300005543 Ga0070672_100239424 Ga0070672_1002394242 280
199 3300006353 Ga0075370_10032812 Ga0075370_100328122 280
200 3300009545 Ga0105237_10352768 Ga0105237_103527682 280
201 3300010375 Ga0105239_10447998 Ga0105239_104479982 280
202 3300025940 Ga0207691_10243654 Ga0207691_102436542 280
203 3300028794 Ga0307515_10111695 Ga0307515_101116952 280
204 3300030522 Ga0307512_10096602 Ga0307512_100966022 280
205 3300031239 Ga0265328_10094978 Ga0265328_100949781 280
206 3300031507 Ga0307509_10001361 Ga0307509_1000136112 280
207 3300031507 Ga0307509_10010234 Ga0307509_100102344 280
208 3300031507 Ga0307509_10011254 Ga0307509_100112547 280
209 3300031616 Ga0307508_10016446 Ga0307508_100164464 280
210 3300031649 Ga0307514_10033173 Ga0307514_100331733 280
211 3300031649 Ga0307514_10168064 Ga0307514_101680642 280
212 3300033180 Ga0307510_10022280 Ga0307510_100222802 280
213 3300033180 Ga0307510_10054512 Ga0307510_100545122 280
214 3300033180 Ga0307510_10128435 Ga0307510_101284352 280
215 3300035691 Ga0373931_0015779 Ga0373931_0015779_321_1211 280
216 3300042134 Ga0450898_029272 Ga0450898_029272_19_918 280
217 3300046454 Ga0495592_0000495 Ga0495592_0000495_25567_26457 280
218 3300046512 Ga0495610_0075921 Ga0495610_0075921_426_1316 280
219 3300046680 Ga0495646_0089842 Ga0495646_0089842_329_1219 280
220 3300046689 Ga0495613_0158245 Ga0495613_0158245_142_1032 280
221 3300046690 Ga0495624_0134069 Ga0495624_0134069_507_1397 280
222 3300047321 Ga0495676_0060280 Ga0495676_0060280_1814_2704 280
223 3300047469 Ga0495673_0039788 Ga0495673_0039788_477_1367 280
224 3300047472 Ga0495686_0066475 Ga0495686_0066475_1265_2155 280
225 3300050496 nmdc:mga07m45_6788_c1 nmdc:mga07m45_6788_c1_952_1842 280
226 3300053093 Ga0500651_0043052 Ga0500651_0043052_1484_2374 280
227 3300053118 Ga0500594_0006299 Ga0500594_0006299_1605_2495 280
228 3300053133 Ga0500655_018582 Ga0500655_018582_366_1256 280
229 3300053136 Ga0500559_0000176 Ga0500559_0000176_45255_46145 280
230 3300053156 Ga0500622_0001562 Ga0500622_0001562_16966_17856 280
231 3300053739 Ga0500587_004729 Ga0500587_004729_654_1544 280
232 3300005334 Ga0068869_100001109 Ga0068869_1000011095 281
233 3300005334 Ga0068869_100063999 Ga0068869_1000639992 281
234 3300005335 Ga0070666_10250821 Ga0070666_102508211 281
235 3300005336 Ga0070680_100007161 Ga0070680_1000071611 281
236 3300005338 Ga0068868_100012655 Ga0068868_1000126554 281
237 3300005339 Ga0070660_100108905 Ga0070660_1001089052 281
238 3300005344 Ga0070661_100278698 Ga0070661_1002786982 281
239 3300005353 Ga0070669_100017528 Ga0070669_1000175284 281
240 3300005354 Ga0070675_100006726 Ga0070675_1000067263 281
241 3300005366 Ga0070659_100035634 Ga0070659_1000356343 281
242 3300005366 Ga0070659_100082624 Ga0070659_1000826243 281
243 3300005455 Ga0070663_100031787 Ga0070663_1000317873 281
244 3300005457 Ga0070662_100009377 Ga0070662_1000093775 281
245 3300005457 Ga0070662_100076103 Ga0070662_1000761032 281
246 3300005458 Ga0070681_10133025 Ga0070681_101330252 281
247 3300005459 Ga0068867_100067625 Ga0068867_1000676252 281
248 3300005530 Ga0070679_100005203 Ga0070679_1000052033 281
249 3300005539 Ga0068853_100047672 Ga0068853_1000476723 281
250 3300005539 Ga0068853_100084180 Ga0068853_1000841802 281
251 3300005563 Ga0068855_100204174 Ga0068855_1002041742 281
252 3300005564 Ga0070664_100091439 Ga0070664_1000914392 281
253 3300005564 Ga0070664_100441709 Ga0070664_1004417091 281
254 3300005578 Ga0068854_100053887 Ga0068854_1000538872 281
255 3300005578 Ga0068854_100068524 Ga0068854_1000685242 281
256 3300005614 Ga0068856_100116576 Ga0068856_1001165762 281
257 3300005614 Ga0068856_100560414 Ga0068856_1005604141 281
258 3300005616 Ga0068852_100018326 Ga0068852_1000183264 281
259 3300005616 Ga0068852_100357816 Ga0068852_1003578161 281
260 3300005618 Ga0068864_100016462 Ga0068864_1000164622 281
261 3300005719 Ga0068861_100002537 Ga0068861_1000025373 281
262 3300005834 Ga0068851_10010631 Ga0068851_100106312 281
263 3300005843 Ga0068860_100092712 Ga0068860_1000927122 281
264 3300005844 Ga0068862_100122689 Ga0068862_1001226892 281
265 3300006048 Ga0075363_100069387 Ga0075363_1000693872 281
266 3300006177 Ga0075362_10005313 Ga0075362_100053134 281
267 3300006178 Ga0075367_10002892 Ga0075367_100028922 281
268 3300006178 Ga0075367_10045902 Ga0075367_100459022 281
269 3300006186 Ga0075369_10032135 Ga0075369_100321352 281
270 3300006353 Ga0075370_10023781 Ga0075370_100237813 281
271 3300006353 Ga0075370_10072582 Ga0075370_100725822 281
272 3300006358 Ga0068871_100019550 Ga0068871_1000195503 281
273 3300009093 Ga0105240_10112489 Ga0105240_101124892 281
274 3300009098 Ga0105245_10036989 Ga0105245_100369893 281
275 3300009148 Ga0105243_10027047 Ga0105243_100270474 281
276 3300009177 Ga0105248_10019055 Ga0105248_100190554 281
277 3300009545 Ga0105237_10015682 Ga0105237_100156827 281
278 3300009551 Ga0105238_10113877 Ga0105238_101138772 281
279 3300010375 Ga0105239_10210629 Ga0105239_102106291 281
280 3300013102 Ga0157371_10036782 Ga0157371_100367823 281
281 3300013296 Ga0157374_10044976 Ga0157374_100449762 281
282 3300013297 Ga0157378_10336149 Ga0157378_103361492 281
283 3300013306 Ga0163162_10017055 Ga0163162_100170553 281
284 3300013307 Ga0157372_10073513 Ga0157372_100735133 281
285 3300014745 Ga0157377_10082660 Ga0157377_100826602 281
286 3300014968 Ga0157379_10069596 Ga0157379_100695962 281
287 3300014969 Ga0157376_10010522 Ga0157376_100105224 281
288 3300025901 Ga0207688_10206740 Ga0207688_102067401 281
289 3300025907 Ga0207645_10019272 Ga0207645_100192722 281
290 3300025911 Ga0207654_10149869 Ga0207654_101498692 281
291 3300025912 Ga0207707_10339118 Ga0207707_103391182 281
292 3300025914 Ga0207671_10056288 Ga0207671_100562882 281
293 3300025919 Ga0207657_10130267 Ga0207657_101302672 281
294 3300025920 Ga0207649_10006792 Ga0207649_100067922 281
295 3300025920 Ga0207649_10023420 Ga0207649_100234202 281
296 3300025923 Ga0207681_10028185 Ga0207681_100281854 281
297 3300025924 Ga0207694_10078909 Ga0207694_100789092 281
298 3300025926 Ga0207659_10017237 Ga0207659_100172374 281
299 3300025926 Ga0207659_10136330 Ga0207659_101363302 281
300 3300025931 Ga0207644_10138544 Ga0207644_101385442 281
301 3300025932 Ga0207690_10010640 Ga0207690_100106403 281
302 3300025932 Ga0207690_10017773 Ga0207690_100177733 281
303 3300025933 Ga0207706_10002136 Ga0207706_100021365 281
304 3300025933 Ga0207706_10097815 Ga0207706_100978152 281
305 3300025933 Ga0207706_10391405 Ga0207706_103914052 281
306 3300025935 Ga0207709_10014029 Ga0207709_100140292 281
307 3300025941 Ga0207711_10019245 Ga0207711_100192454 281
308 3300025942 Ga0207689_10001660 Ga0207689_100016609 281
309 3300025942 Ga0207689_10048437 Ga0207689_100484373 281
310 3300025945 Ga0207679_10000587 Ga0207679_1000058720 281
311 3300025945 Ga0207679_10044288 Ga0207679_100442882 281
312 3300025949 Ga0207667_10108049 Ga0207667_101080492 281
313 3300025981 Ga0207640_10019976 Ga0207640_100199762 281
314 3300025986 Ga0207658_10046784 Ga0207658_100467842 281
315 3300026023 Ga0207677_10007546 Ga0207677_100075462 281
316 3300026041 Ga0207639_10023442 Ga0207639_100234423 281
317 3300026067 Ga0207678_10003971 Ga0207678_1000397110 281
318 3300026078 Ga0207702_10132968 Ga0207702_101329682 281
319 3300026089 Ga0207648_10102530 Ga0207648_101025302 281
320 3300026089 Ga0207648_10141396 Ga0207648_101413962 281
321 3300026089 Ga0207648_10298059 Ga0207648_102980592 281
322 3300026095 Ga0207676_10012968 Ga0207676_100129684 281
323 3300026118 Ga0207675_100011117 Ga0207675_1000111174 281
324 3300026142 Ga0207698_10019362 Ga0207698_100193624 281
325 3300026142 Ga0207698_10089353 Ga0207698_100893532 281
326 3300028381 Ga0268264_10159545 Ga0268264_101595452 281
327 3300031456 Ga0307513_10087334 Ga0307513_100873343 281
328 3300031852 Ga0307410_10240354 Ga0307410_102403542 281
329 3300031903 Ga0307407_10068440 Ga0307407_100684402 281
330 3300031903 Ga0307407_10211116 Ga0307407_102111162 281
331 3300032002 Ga0307416_100148990 Ga0307416_1001489901 281
332 3300032126 Ga0307415_100035673 Ga0307415_1000356732 281
333 3300035241 Ga0373961_0048062 Ga0373961_0048062_147_1043 281
334 3300035691 Ga0373931_0001799 Ga0373931_0001799_147_1043 281
335 3300042876 Ga0451577_0011231 Ga0451577_0011231_5617_6558 281
336 3300046519 Ga0495632_0020185 Ga0495632_0020185_1527_2423 281
337 3300046528 Ga0495642_0103648 Ga0495642_0103648_281_1177 281
338 3300046542 Ga0495597_0022481 Ga0495597_0022481_1581_2477 281
339 3300046616 Ga0495668_0060534 Ga0495668_0060534_120_1016 281
340 3300046694 Ga0495649_0004853 Ga0495649_0004853_244_1140 281
341 3300047443 Ga0495687_000292 Ga0495687_000292_46654_47550 281
342 3300047443 Ga0495687_004028 Ga0495687_004028_8937_9833 281
343 3300047472 Ga0495686_0006348 Ga0495686_0006348_7602_8495 281
344 3300048903 Ga0496100_0079881 Ga0496100_0079881_532_1428 281
345 3300048904 Ga0496101_0110108 Ga0496101_0110108_560_1456 281
346 3300048905 Ga0496102_0042012 Ga0496102_0042012_2020_2916 281
347 3300048906 Ga0496103_0072501 Ga0496103_0072501_798_1694 281
348 3300048909 Ga0496106_0013266 Ga0496106_0013266_2911_3807 281
349 3300048910 Ga0496107_0013711 Ga0496107_0013711_1734_2630 281
350 3300048912 Ga0496109_0068718 Ga0496109_0068718_1564_2460 281
351 3300048913 Ga0496110_0151050 Ga0496110_0151050_368_1264 281
352 3300048914 Ga0496111_0053517 Ga0496111_0053517_1159_2055 281
353 3300048915 Ga0496112_0709619 Ga0496112_0709619_15_911 281
354 3300048917 Ga0496114_0244172 Ga0496114_0244172_31_927 281
355 3300048918 Ga0496115_0023338 Ga0496115_0023338_1440_2336 281
356 3300050489 nmdc:mga03683_27841_c1 nmdc:mga03683_27841_c1_347_1243 281
357 3300050492 nmdc:mga0yw44_206962_c1 nmdc:mga0yw44_206962_c1_108_1004 281
358 3300050493 nmdc:mga0k408_252_c1 nmdc:mga0k408_252_c1_14538_15434 281
359 3300050493 nmdc:mga0k408_40960_c1 nmdc:mga0k408_40960_c1_123_1019 281
360 3300050493 nmdc:mga0k408_66900_c1 nmdc:mga0k408_66900_c1_584_1480 281
361 3300050494 nmdc:mga06z11_4444_c1 nmdc:mga06z11_4444_c1_4247_5143 281
362 3300050494 nmdc:mga06z11_71973_c1 nmdc:mga06z11_71973_c1_492_1388 281
363 3300050495 nmdc:mga04h51_6896_c1 nmdc:mga04h51_6896_c1_1191_2087 281
364 3300050496 nmdc:mga07m45_1024_c1 nmdc:mga07m45_1024_c1_1389_2285 281
365 3300050496 nmdc:mga07m45_215968_c1 nmdc:mga07m45_215968_c1_82_978 281
366 3300050496 nmdc:mga07m45_3135_c1 nmdc:mga07m45_3135_c1_138_1034 281
367 3300050496 nmdc:mga07m45_4116_c2 nmdc:mga07m45_4116_c2_4428_5324 281
368 3300050512 nmdc:mga0n895_410480_c1 nmdc:mga0n895_410480_c1_77_973 281
369 3300050516 nmdc:mga0sz30_26461_c1 nmdc:mga0sz30_26461_c1_468_1364 281
370 3300050516 nmdc:mga0sz30_44702_c1 nmdc:mga0sz30_44702_c1_90_986 281
371 3300053134 Ga0500658_0009325 Ga0500658_0009325_97_993 281
372 3300003215 JGI25153J46596_10003402 JGI25153J46596_100034024 282
373 3300005327 Ga0070658_10013296 Ga0070658_100132963 282
374 3300005327 Ga0070658_10293538 Ga0070658_102935382 282
375 3300005328 Ga0070676_10013968 Ga0070676_100139682 282
376 3300005329 Ga0070683_100100530 Ga0070683_1001005302 282
377 3300005330 Ga0070690_100247453 Ga0070690_1002474531 282
378 3300005331 Ga0070670_100003283 Ga0070670_1000032832 282
379 3300005333 Ga0070677_10017968 Ga0070677_100179681 282
380 3300005333 Ga0070677_10034134 Ga0070677_100341342 282
381 3300005334 Ga0068869_100004113 Ga0068869_1000041132 282
382 3300005338 Ga0068868_100059480 Ga0068868_1000594802 282
383 3300005338 Ga0068868_100584667 Ga0068868_1005846671 282
384 3300005339 Ga0070660_100253809 Ga0070660_1002538092 282
385 3300005343 Ga0070687_100036022 Ga0070687_1000360222 282
386 3300005347 Ga0070668_100021459 Ga0070668_1000214593 282
387 3300005353 Ga0070669_100057183 Ga0070669_1000571832 282
388 3300005354 Ga0070675_100002407 Ga0070675_1000024074 282
389 3300005354 Ga0070675_100100143 Ga0070675_1001001432 282
390 3300005354 Ga0070675_100112682 Ga0070675_1001126822 282
391 3300005354 Ga0070675_100170681 Ga0070675_1001706812 282
392 3300005355 Ga0070671_100002233 Ga0070671_1000022333 282
393 3300005355 Ga0070671_100012267 Ga0070671_1000122674 282
394 3300005356 Ga0070674_100085939 Ga0070674_1000859392 282
395 3300005364 Ga0070673_100010633 Ga0070673_1000106332 282
396 3300005366 Ga0070659_100058705 Ga0070659_1000587052 282
397 3300005366 Ga0070659_100210730 Ga0070659_1002107302 282
398 3300005367 Ga0070667_100002782 Ga0070667_10000278210 282
399 3300005367 Ga0070667_100029009 Ga0070667_1000290092 282
400 3300005367 Ga0070667_100065976 Ga0070667_1000659763 282
401 3300005456 Ga0070678_100041854 Ga0070678_1000418543 282
402 3300005456 Ga0070678_100183861 Ga0070678_1001838612 282
403 3300005456 Ga0070678_100342198 Ga0070678_1003421981 282
404 3300005457 Ga0070662_100158354 Ga0070662_1001583542 282
405 3300005459 Ga0068867_100072428 Ga0068867_1000724281 282
406 3300005539 Ga0068853_100068091 Ga0068853_1000680913 282
407 3300005543 Ga0070672_100022717 Ga0070672_1000227172 282
408 3300005543 Ga0070672_100045629 Ga0070672_1000456293 282
409 3300005543 Ga0070672_100159112 Ga0070672_1001591122 282
410 3300005543 Ga0070672_100172829 Ga0070672_1001728292 282
411 3300005544 Ga0070686_100039045 Ga0070686_1000390452 282
412 3300005564 Ga0070664_100044366 Ga0070664_1000443662 282
413 3300005564 Ga0070664_100141583 Ga0070664_1001415831 282
414 3300005564 Ga0070664_100300919 Ga0070664_1003009191 282
415 3300005616 Ga0068852_100045891 Ga0068852_1000458913 282
416 3300005616 Ga0068852_100167427 Ga0068852_1001674272 282
417 3300005617 Ga0068859_100076989 Ga0068859_1000769892 282
418 3300005617 Ga0068859_100094323 Ga0068859_1000943231 282
419 3300005618 Ga0068864_100001586 Ga0068864_1000015863 282
420 3300005618 Ga0068864_100130861 Ga0068864_1001308612 282
421 3300005618 Ga0068864_100164259 Ga0068864_1001642592 282
422 3300005718 Ga0068866_10010640 Ga0068866_100106403 282
423 3300005719 Ga0068861_100154596 Ga0068861_1001545962 282
424 3300005719 Ga0068861_100635823 Ga0068861_1006358231 282
425 3300005834 Ga0068851_10022530 Ga0068851_100225302 282
426 3300005841 Ga0068863_100028068 Ga0068863_1000280683 282
427 3300005841 Ga0068863_100053280 Ga0068863_1000532803 282
428 3300005841 Ga0068863_100177782 Ga0068863_1001777822 282
429 3300005842 Ga0068858_100017858 Ga0068858_1000178583 282
430 3300005842 Ga0068858_100026618 Ga0068858_1000266183 282
431 3300005842 Ga0068858_100238073 Ga0068858_1002380732 282
432 3300005843 Ga0068860_100024201 Ga0068860_1000242012 282
433 3300005843 Ga0068860_100342735 Ga0068860_1003427352 282
434 3300005844 Ga0068862_100020476 Ga0068862_1000204762 282
435 3300006195 Ga0075366_10017361 Ga0075366_100173612 282
436 3300006195 Ga0075366_10033012 Ga0075366_100330122 282
437 3300006237 Ga0097621_100029233 Ga0097621_1000292332 282
438 3300006358 Ga0068871_100083998 Ga0068871_1000839982 282
439 3300006358 Ga0068871_100142966 Ga0068871_1001429662 282
440 3300006881 Ga0068865_100135682 Ga0068865_1001356822 282
441 3300006931 Ga0097620_100076996 Ga0097620_1000769962 282
442 3300006931 Ga0097620_100094327 Ga0097620_1000943273 282
443 3300009148 Ga0105243_10266713 Ga0105243_102667132 282
444 3300009176 Ga0105242_10156669 Ga0105242_101566692 282
445 3300009177 Ga0105248_10074326 Ga0105248_100743262 282
446 3300009545 Ga0105237_10291803 Ga0105237_102918032 282
447 3300009553 Ga0105249_10065537 Ga0105249_100655372 282
448 3300013100 Ga0157373_10032511 Ga0157373_100325112 282
449 3300013102 Ga0157371_10264218 Ga0157371_102642182 282
450 3300013105 Ga0157369_10056119 Ga0157369_100561193 282
451 3300013105 Ga0157369_10129815 Ga0157369_101298152 282
452 3300013296 Ga0157374_10043485 Ga0157374_100434851 282
453 3300013297 Ga0157378_10148273 Ga0157378_101482731 282
454 3300013306 Ga0163162_10067365 Ga0163162_100673652 282
455 3300013307 Ga0157372_10026397 Ga0157372_100263972 282
456 3300013307 Ga0157372_10253020 Ga0157372_102530202 282
457 3300013308 Ga0157375_10028018 Ga0157375_100280182 282
458 3300013308 Ga0157375_10028830 Ga0157375_100288303 282
459 3300013308 Ga0157375_10032445 Ga0157375_100324453 282
460 3300013308 Ga0157375_10248600 Ga0157375_102486001 282
461 3300013308 Ga0157375_10252093 Ga0157375_102520932 282
462 3300014325 Ga0163163_10019768 Ga0163163_100197682 282
463 3300014325 Ga0163163_10167520 Ga0163163_101675202 282
464 3300014325 Ga0163163_10217480 Ga0163163_102174802 282
465 3300014326 Ga0157380_10026078 Ga0157380_100260782 282
466 3300014968 Ga0157379_10017802 Ga0157379_100178025 282
467 3300014968 Ga0157379_10047603 Ga0157379_100476033 282
468 3300014968 Ga0157379_10053546 Ga0157379_100535462 282
469 3300014968 Ga0157379_10163864 Ga0157379_101638642 282
470 3300014968 Ga0157379_10339000 Ga0157379_103390001 282
471 3300017792 Ga0163161_10025768 Ga0163161_100257682 282
472 3300017792 Ga0163161_10056154 Ga0163161_100561542 282
473 3300021384 Ga0213876_10076094 Ga0213876_100760941 282
474 3300025297 Ga0209758_1000045 Ga0209758_1000045130 282
475 3300025315 Ga0207697_10097017 Ga0207697_100970171 282
476 3300025899 Ga0207642_10017138 Ga0207642_100171382 282
477 3300025903 Ga0207680_10018322 Ga0207680_100183222 282
478 3300025903 Ga0207680_10330298 Ga0207680_103302981 282
479 3300025907 Ga0207645_10014294 Ga0207645_100142943 282
480 3300025909 Ga0207705_10044030 Ga0207705_100440302 282
481 3300025918 Ga0207662_10010872 Ga0207662_100108724 282
482 3300025918 Ga0207662_10025880 Ga0207662_100258802 282
483 3300025919 Ga0207657_10078549 Ga0207657_100785492 282
484 3300025919 Ga0207657_10100446 Ga0207657_101004462 282
485 3300025920 Ga0207649_10159191 Ga0207649_101591912 282
486 3300025923 Ga0207681_10001232 Ga0207681_1000123213 282
487 3300025925 Ga0207650_10001909 Ga0207650_1000190914 282
488 3300025925 Ga0207650_10002430 Ga0207650_1000243010 282
489 3300025925 Ga0207650_10112175 Ga0207650_101121752 282
490 3300025926 Ga0207659_10054027 Ga0207659_100540272 282
491 3300025931 Ga0207644_10000360 Ga0207644_100003603 282
492 3300025931 Ga0207644_10001986 Ga0207644_100019866 282
493 3300025932 Ga0207690_10287058 Ga0207690_102870582 282
494 3300025933 Ga0207706_10081416 Ga0207706_100814162 282
495 3300025934 Ga0207686_10102686 Ga0207686_101026862 282
496 3300025934 Ga0207686_10199343 Ga0207686_101993432 282
497 3300025937 Ga0207669_10007339 Ga0207669_100073392 282
498 3300025939 Ga0207665_10063433 Ga0207665_100634333 282
499 3300025940 Ga0207691_10041671 Ga0207691_100416713 282
500 3300025940 Ga0207691_10067381 Ga0207691_100673813 282
501 3300025941 Ga0207711_10003194 Ga0207711_100031944 282
502 3300025941 Ga0207711_10032898 Ga0207711_100328982 282
503 3300025942 Ga0207689_10011343 Ga0207689_100113437 282
504 3300025949 Ga0207667_10152173 Ga0207667_101521732 282
505 3300025960 Ga0207651_10024383 Ga0207651_100243833 282
506 3300025961 Ga0207712_10010534 Ga0207712_100105342 282
507 3300025972 Ga0207668_10025672 Ga0207668_100256724 282
508 3300025986 Ga0207658_10000904 Ga0207658_1000090411 282
509 3300025986 Ga0207658_10001973 Ga0207658_1000197311 282
510 3300025986 Ga0207658_10024111 Ga0207658_100241112 282
511 3300026023 Ga0207677_10003021 Ga0207677_100030213 282
512 3300026023 Ga0207677_10243787 Ga0207677_102437871 282
513 3300026023 Ga0207677_10376819 Ga0207677_103768191 282
514 3300026035 Ga0207703_10001363 Ga0207703_1000136316 282
515 3300026035 Ga0207703_10004044 Ga0207703_100040444 282
516 3300026035 Ga0207703_10349041 Ga0207703_103490412 282
517 3300026041 Ga0207639_10072479 Ga0207639_100724792 282
518 3300026041 Ga0207639_10327832 Ga0207639_103278322 282
519 3300026078 Ga0207702_10025983 Ga0207702_100259834 282
520 3300026088 Ga0207641_10001982 Ga0207641_1000198215 282
521 3300026088 Ga0207641_10043981 Ga0207641_100439813 282
522 3300026088 Ga0207641_10089816 Ga0207641_100898162 282
523 3300026095 Ga0207676_10038561 Ga0207676_100385613 282
524 3300026095 Ga0207676_10059422 Ga0207676_100594222 282
525 3300026095 Ga0207676_10070880 Ga0207676_100708802 282
526 3300026095 Ga0207676_10115786 Ga0207676_101157862 282
527 3300026118 Ga0207675_100073601 Ga0207675_1000736013 282
528 3300026118 Ga0207675_100151385 Ga0207675_1001513852 282
529 3300026121 Ga0207683_10015725 Ga0207683_100157253 282
530 3300026121 Ga0207683_10053490 Ga0207683_100534902 282
531 3300026142 Ga0207698_10033499 Ga0207698_100334993 282
532 3300026142 Ga0207698_10118199 Ga0207698_101181992 282
533 3300026142 Ga0207698_10416722 Ga0207698_104167222 282
534 3300027876 Ga0209974_10000344 Ga0209974_1000034410 282
535 3300028380 Ga0268265_10005342 Ga0268265_100053426 282
536 3300028381 Ga0268264_10013830 Ga0268264_100138303 282
537 3300028381 Ga0268264_10127289 Ga0268264_101272892 282
538 3300028794 Ga0307515_10038096 Ga0307515_100380966 282
539 3300031507 Ga0307509_10050269 Ga0307509_100502692 282
540 3300031730 Ga0307516_10000556 Ga0307516_100005566 282
541 3300032126 Ga0307415_100187583 Ga0307415_1001875832 282
542 3300039437 Ga0436365_0487766 Ga0436365_0487766_66_962 282
543 3300045051 Ga0451576_0248001 Ga0451576_0248001_719_1615 282
544 3300046519 Ga0495632_0025341 Ga0495632_0025341_249_1142 282
545 3300046543 Ga0495645_0053726 Ga0495645_0053726_1623_2516 282
546 3300046683 Ga0495658_0029859 Ga0495658_0029859_2043_2936 282
547 3300047471 Ga0495684_0091452 Ga0495684_0091452_1295_2188 282
548 3300047472 Ga0495686_0042733 Ga0495686_0042733_131_1027 282
549 3300048907 Ga0496104_0201450 Ga0496104_0201450_66_959 282
550 3300048908 Ga0496105_0237904 Ga0496105_0237904_23_916 282
551 3300048911 Ga0496108_0134366 Ga0496108_0134366_67_960 282
552 3300048913 Ga0496110_0345566 Ga0496110_0345566_31_924 282
553 3300053084 Ga0495595_0129712 Ga0495595_0129712_131_1024 282
554 3300053117 Ga0500593_000371 Ga0500593_000371_14948_15844 282
555 3300053139 Ga0500568_0019092 Ga0500568_0019092_262_1155 282
556 3300053154 Ga0500619_000054 Ga0500619_000054_5837_6730 282
557 3300053730 Ga0500645_006890 Ga0500645_006890_102_998 282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21917

NMB0537_N

N-terminal region of NMB0537

76

111

0.96

PF03471

CorC_HlyC

Transporter associated domain

236

314

0.95

PF00571

CBS

CBS domain

180

233

0.85

PF00571

CBS

CBS domain

116

175

0.83

Feature Viewer

pLDDT pTM Quality
75.25 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map