F463225
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 556 | 259 | 1112 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300028558|Ga0265326_10010129|Ga0265326_100101292 |
| Length | 345 |
| Sequence | MMTRQSKRTPASSTIAPRLDKSGKKCELGAVSANKLEQLRTVLRHYGSCLVAYSGGVDSVFLARVAHEVLGDRALAVIADSPSLPRRELQEALAIAAQFHFPVRVVQTAEFDNPDYLSNPANRCYFCKHELFEHLTPIARAEKFAVIAYGENASDNGDFRPGAKAATEFQVRAPLKEAGLTKTDIRELSARLGLPTADKPQMACLSSRIPYGEPVTPEKLKMIEAAEYVLRDLGFHDVRVRHHELGVASDKWQVTGKPPAPGAVSATRHPSLVTHLARIELGPTEIPRFLEDGRPAQVAEALKKVGYAHVTLDLQGYRRGSLNEKIEKPDARLTAHDSRITKGTT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 161 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 176 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.72 |
| Rhizosphere | 98.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265326_10010129 | 3300028558 | Unclassified | 2805 |
| 2 | JGI24737J22298_10042547 | 3300001990 | Bacteria | 1392 |
| 3 | JGI25406J46586_10000252 | 3300003203 | Bacteria | 23827 |
| 4 | rootL2_10317165 | 3300003322 | Unclassified | 1122 |
| 5 | Ga0065715_10005921 | 3300005293 | Bacteria | 3590 |
| 6 | Ga0065715_10018500 | 3300005293 | Bacteria | 3913 |
| 7 | Ga0070683_100328102 | 3300005329 | Bacteria | 1457 |
| 8 | Ga0070690_100008969 | 3300005330 | Bacteria | 5780 |
| 9 | Ga0070690_100010952 | 3300005330 | Bacteria | 5293 |
| 10 | Ga0070690_100030624 | 3300005330 | Bacteria | 3345 |
| 11 | Ga0070670_100011745 | 3300005331 | Bacteria | 7491 |
| 12 | Ga0070670_100077061 | 3300005331 | Bacteria | 2865 |
| 13 | Ga0070666_10037030 | 3300005335 | Bacteria | 3242 |
| 14 | Ga0070666_10046606 | 3300005335 | Bacteria | 2908 |
| 15 | Ga0070680_100089080 | 3300005336 | Unclassified | 2553 |
| 16 | Ga0070682_100038002 | 3300005337 | Unclassified | 2950 |
| 17 | Ga0068868_100005366 | 3300005338 | Bacteria | 9002 |
| 18 | Ga0068868_100009262 | 3300005338 | Bacteria | 7076 |
| 19 | Ga0068868_100018252 | 3300005338 | Bacteria | 5241 |
| 20 | Ga0070689_100029141 | 3300005340 | Bacteria | 4175 |
| 21 | Ga0070689_100105558 | 3300005340 | Bacteria | 2234 |
| 22 | Ga0070689_100415496 | 3300005340 | Unclassified | 1139 |
| 23 | Ga0070691_10083984 | 3300005341 | Unclassified | 1563 |
| 24 | Ga0070687_100136710 | 3300005343 | Bacteria | 1422 |
| 25 | Ga0070661_100019772 | 3300005344 | Bacteria | 4800 |
| 26 | Ga0070661_100033461 | 3300005344 | Bacteria | 3723 |
| 27 | Ga0070668_100038128 | 3300005347 | Bacteria | 3672 |
| 28 | Ga0070669_100286826 | 3300005353 | Bacteria | 1320 |
| 29 | Ga0070675_100183668 | 3300005354 | Bacteria | 1809 |
| 30 | Ga0070688_100005672 | 3300005365 | Bacteria | 6591 |
| 31 | Ga0070688_100074653 | 3300005365 | Bacteria | 2178 |
| 32 | Ga0070688_100118065 | 3300005365 | Bacteria | 1773 |
| 33 | Ga0070667_100039945 | 3300005367 | Bacteria | 3933 |
| 34 | Ga0070709_10026531 | 3300005434 | Unclassified | 3435 |
| 35 | Ga0070709_10197323 | 3300005434 | Unclassified | 1423 |
| 36 | Ga0070714_100003667 | 3300005435 | Bacteria | 11496 |
| 37 | Ga0070714_100132920 | 3300005435 | Unclassified | 2225 |
| 38 | Ga0070714_100173218 | 3300005435 | Bacteria | 1959 |
| 39 | Ga0070713_100043767 | 3300005436 | Bacteria | 3663 |
| 40 | Ga0070713_100049973 | 3300005436 | Bacteria | 3451 |
| 41 | Ga0070713_100177236 | 3300005436 | Unclassified | 1913 |
| 42 | Ga0070713_100376627 | 3300005436 | Unclassified | 1321 |
| 43 | Ga0070710_10047169 | 3300005437 | Unclassified | 2402 |
| 44 | Ga0070701_10011455 | 3300005438 | Bacteria | 3966 |
| 45 | Ga0070701_10014994 | 3300005438 | Bacteria | 3566 |
| 46 | Ga0070711_100015204 | 3300005439 | Bacteria | 4868 |
| 47 | Ga0070711_100022841 | 3300005439 | Bacteria | 4059 |
| 48 | Ga0070700_100398197 | 3300005441 | Bacteria | 1034 |
| 49 | Ga0070694_100002556 | 3300005444 | Bacteria | 10751 |
| 50 | Ga0070708_100030319 | 3300005445 | Unclassified | 4675 |
| 51 | Ga0070708_100072556 | 3300005445 | Bacteria | 3102 |
| 52 | Ga0070663_100071382 | 3300005455 | Bacteria | 2527 |
| 53 | Ga0070678_100003365 | 3300005456 | Bacteria | 8911 |
| 54 | Ga0070662_100075273 | 3300005457 | Bacteria | 2500 |
| 55 | Ga0070662_100119377 | 3300005457 | Bacteria | 2019 |
| 56 | Ga0070681_10000049 | 3300005458 | Bacteria | 82355 |
| 57 | Ga0070681_10036240 | 3300005458 | Bacteria | 4953 |
| 58 | Ga0068867_100227240 | 3300005459 | Bacteria | 1507 |
| 59 | Ga0068867_100426688 | 3300005459 | Unclassified | 1124 |
| 60 | Ga0070707_100123163 | 3300005468 | Bacteria | 2518 |
| 61 | Ga0070698_100002069 | 3300005471 | Bacteria | 22295 |
| 62 | Ga0070699_100018109 | 3300005518 | Bacteria | 6051 |
| 63 | Ga0070679_100088782 | 3300005530 | Bacteria | 3078 |
| 64 | Ga0070684_100090367 | 3300005535 | Unclassified | 2723 |
| 65 | Ga0070684_100154647 | 3300005535 | Unclassified | 2079 |
| 66 | Ga0070684_100166464 | 3300005535 | Bacteria | 2001 |
| 67 | Ga0070684_100174868 | 3300005535 | Unclassified | 1951 |
| 68 | Ga0070697_100167978 | 3300005536 | Bacteria | 1856 |
| 69 | Ga0070697_100566600 | 3300005536 | Unclassified | 997 |
| 70 | Ga0068853_100024956 | 3300005539 | Bacteria | 5016 |
| 71 | Ga0070672_100288444 | 3300005543 | Bacteria | 1389 |
| 72 | Ga0070686_100015739 | 3300005544 | Bacteria | 4388 |
| 73 | Ga0070686_100035049 | 3300005544 | Bacteria | 3097 |
| 74 | Ga0070686_100047853 | 3300005544 | Bacteria | 2706 |
| 75 | Ga0070686_100057428 | 3300005544 | Bacteria | 2500 |
| 76 | Ga0070686_100145144 | 3300005544 | Unclassified | 1656 |
| 77 | Ga0070696_100295252 | 3300005546 | Bacteria | 1239 |
| 78 | Ga0070693_100039730 | 3300005547 | Unclassified | 2637 |
| 79 | Ga0070665_100018093 | 3300005548 | Bacteria | 7071 |
| 80 | Ga0070704_100000899 | 3300005549 | Bacteria | 14895 |
| 81 | Ga0070704_100094886 | 3300005549 | Bacteria | 2233 |
| 82 | Ga0068855_100000397 | 3300005563 | Bacteria | 53677 |
| 83 | Ga0068855_100002551 | 3300005563 | Bacteria | 22437 |
| 84 | Ga0068855_100013146 | 3300005563 | Bacteria | 9984 |
| 85 | Ga0068855_100070636 | 3300005563 | Bacteria | 4062 |
| 86 | Ga0068855_100071452 | 3300005563 | Unclassified | 4036 |
| 87 | Ga0068855_100149699 | 3300005563 | Unclassified | 2654 |
| 88 | Ga0068855_100274231 | 3300005563 | Bacteria | 1875 |
| 89 | Ga0070664_100000468 | 3300005564 | Bacteria | 30654 |
| 90 | Ga0070664_100018413 | 3300005564 | Bacteria | 5737 |
| 91 | Ga0070664_100357758 | 3300005564 | Unclassified | 1329 |
| 92 | Ga0068857_100000474 | 3300005577 | Bacteria | 28698 |
| 93 | Ga0068857_100027934 | 3300005577 | Unclassified | 4975 |
| 94 | Ga0068857_100092967 | 3300005577 | Bacteria | 2701 |
| 95 | Ga0068854_100001866 | 3300005578 | Bacteria | 12844 |
| 96 | Ga0068856_100000475 | 3300005614 | Bacteria | 44356 |
| 97 | Ga0068856_100001356 | 3300005614 | Bacteria | 25733 |
| 98 | Ga0068856_100026313 | 3300005614 | Bacteria | 5674 |
| 99 | Ga0068856_100032831 | 3300005614 | Bacteria | 5083 |
| 100 | Ga0068856_100040002 | 3300005614 | Bacteria | 4604 |
| 101 | Ga0068856_100284481 | 3300005614 | Bacteria | 1670 |
| 102 | Ga0070702_100023512 | 3300005615 | Bacteria | 3276 |
| 103 | Ga0070702_100068527 | 3300005615 | Bacteria | 2088 |
| 104 | Ga0068852_100067185 | 3300005616 | Unclassified | 3134 |
| 105 | Ga0068852_100114783 | 3300005616 | Bacteria | 2454 |
| 106 | Ga0068859_100000610 | 3300005617 | Bacteria | 35815 |
| 107 | Ga0068859_100238302 | 3300005617 | Unclassified | 1908 |
| 108 | Ga0068859_100286499 | 3300005617 | Unclassified | 1740 |
| 109 | Ga0068859_100519100 | 3300005617 | Bacteria | 1286 |
| 110 | Ga0068864_100000254 | 3300005618 | Bacteria | 47729 |
| 111 | Ga0068864_100312048 | 3300005618 | Bacteria | 1474 |
| 112 | Ga0068861_100061638 | 3300005719 | Bacteria | 2879 |
| 113 | Ga0068870_10009722 | 3300005840 | Unclassified | 4385 |
| 114 | Ga0068870_10060978 | 3300005840 | Bacteria | 2026 |
| 115 | Ga0068863_100006753 | 3300005841 | Bacteria | 11250 |
| 116 | Ga0068863_100013508 | 3300005841 | Bacteria | 7877 |
| 117 | Ga0068863_100015155 | 3300005841 | Bacteria | 7405 |
| 118 | Ga0068863_100100916 | 3300005841 | Bacteria | 2743 |
| 119 | Ga0068863_100122001 | 3300005841 | Bacteria | 2486 |
| 120 | Ga0068858_100001715 | 3300005842 | Bacteria | 22396 |
| 121 | Ga0068858_100013396 | 3300005842 | Bacteria | 7740 |
| 122 | Ga0068858_100042108 | 3300005842 | Bacteria | 4234 |
| 123 | Ga0068860_100029683 | 3300005843 | Bacteria | 5261 |
| 124 | Ga0068860_100032387 | 3300005843 | Bacteria | 5022 |
| 125 | Ga0068860_100096204 | 3300005843 | Bacteria | 2822 |
| 126 | Ga0081539_10000025 | 3300005985 | Bacteria | 340255 |
| 127 | Ga0081539_10000134 | 3300005985 | Bacteria | 173625 |
| 128 | Ga0070717_10003158 | 3300006028 | Bacteria | 11766 |
| 129 | Ga0070717_10033928 | 3300006028 | Unclassified | 4121 |
| 130 | Ga0070717_10173040 | 3300006028 | Bacteria | 1879 |
| 131 | Ga0070717_10189909 | 3300006028 | Bacteria | 1795 |
| 132 | Ga0070716_100002035 | 3300006173 | Bacteria | 9244 |
| 133 | Ga0070712_100047824 | 3300006175 | Bacteria | 2962 |
| 134 | Ga0097621_100000549 | 3300006237 | Bacteria | 26421 |
| 135 | Ga0097621_100004628 | 3300006237 | Bacteria | 9601 |
| 136 | Ga0097621_100018031 | 3300006237 | Bacteria | 5381 |
| 137 | Ga0097621_100038175 | 3300006237 | Bacteria | 3854 |
| 138 | Ga0068871_100000254 | 3300006358 | Bacteria | 37126 |
| 139 | Ga0068871_100004051 | 3300006358 | Bacteria | 10130 |
| 140 | Ga0068871_100019443 | 3300006358 | Bacteria | 5185 |
| 141 | Ga0075428_100002152 | 3300006844 | Bacteria | 21278 |
| 142 | Ga0075428_100008934 | 3300006844 | Bacteria | 11120 |
| 143 | Ga0075428_100023694 | 3300006844 | Bacteria | 6794 |
| 144 | Ga0075428_100218847 | 3300006844 | Bacteria | 2056 |
| 145 | Ga0075430_100002081 | 3300006846 | Bacteria | 16524 |
| 146 | Ga0075430_100041398 | 3300006846 | Bacteria | 3898 |
| 147 | Ga0075431_100035674 | 3300006847 | Bacteria | 5120 |
| 148 | Ga0075431_100162790 | 3300006847 | Unclassified | 2294 |
| 149 | Ga0075431_100213944 | 3300006847 | Bacteria | 1968 |
| 150 | Ga0075433_10001558 | 3300006852 | Bacteria | 16961 |
| 151 | Ga0075434_100001885 | 3300006871 | Bacteria | 18146 |
| 152 | Ga0075429_100027948 | 3300006880 | Unclassified | 4896 |
| 153 | Ga0068865_100007187 | 3300006881 | Bacteria | 6839 |
| 154 | Ga0068865_100169283 | 3300006881 | Bacteria | 1673 |
| 155 | Ga0075436_100000519 | 3300006914 | Bacteria | 25057 |
| 156 | Ga0097620_100000610 | 3300006931 | Bacteria | 35815 |
| 157 | Ga0097620_100238287 | 3300006931 | Unclassified | 1908 |
| 158 | Ga0097620_100286492 | 3300006931 | Unclassified | 1740 |
| 159 | Ga0097620_100519013 | 3300006931 | Bacteria | 1286 |
| 160 | Ga0075435_100013713 | 3300007076 | Bacteria | 6038 |
| 161 | Ga0075435_100020723 | 3300007076 | Bacteria | 5045 |
| 162 | Ga0105240_10003552 | 3300009093 | Bacteria | 24193 |
| 163 | Ga0105240_10009159 | 3300009093 | Bacteria | 14045 |
| 164 | Ga0105240_10075719 | 3300009093 | Unclassified | 4150 |
| 165 | Ga0105240_10306025 | 3300009093 | Bacteria | 1817 |
| 166 | Ga0111539_10008597 | 3300009094 | Bacteria | 12966 |
| 167 | Ga0111539_10145495 | 3300009094 | Bacteria | 2775 |
| 168 | Ga0111539_10395673 | 3300009094 | Unclassified | 1609 |
| 169 | Ga0114129_10288334 | 3300009147 | Unclassified | 2191 |
| 170 | Ga0114129_10309450 | 3300009147 | Bacteria | 2103 |
| 171 | Ga0105243_10588142 | 3300009148 | Bacteria | 1069 |
| 172 | Ga0105241_10022878 | 3300009174 | Unclassified | 4633 |
| 173 | Ga0105242_10054137 | 3300009176 | Bacteria | 3279 |
| 174 | Ga0105248_10006482 | 3300009177 | Bacteria | 12835 |
| 175 | Ga0105248_10121524 | 3300009177 | Unclassified | 2946 |
| 176 | Ga0105248_10256727 | 3300009177 | Bacteria | 1968 |
| 177 | Ga0105237_10245317 | 3300009545 | Bacteria | 1793 |
| 178 | Ga0105237_10310614 | 3300009545 | Unclassified | 1580 |
| 179 | Ga0105238_10000330 | 3300009551 | Bacteria | 51705 |
| 180 | Ga0105238_10030750 | 3300009551 | Bacteria | 5466 |
| 181 | Ga0105238_10433110 | 3300009551 | Unclassified | 1311 |
| 182 | Ga0099796_10073876 | 3300010159 | Unclassified | 1237 |
| 183 | Ga0105239_10035623 | 3300010375 | Bacteria | 5465 |
| 184 | Ga0105239_10442756 | 3300010375 | Unclassified | 1473 |
| 185 | Ga0157373_10007960 | 3300013100 | Bacteria | 7880 |
| 186 | Ga0157373_10017211 | 3300013100 | Bacteria | 5263 |
| 187 | Ga0157373_10184285 | 3300013100 | Bacteria | 1470 |
| 188 | Ga0157371_10015553 | 3300013102 | Bacteria | 5707 |
| 189 | Ga0157371_10089432 | 3300013102 | Unclassified | 2181 |
| 190 | Ga0157371_10098737 | 3300013102 | Bacteria | 2071 |
| 191 | Ga0157370_10029559 | 3300013104 | Bacteria | 5374 |
| 192 | Ga0157369_10000860 | 3300013105 | Bacteria | 38699 |
| 193 | Ga0157369_10048209 | 3300013105 | Unclassified | 4623 |
| 194 | Ga0157369_10064279 | 3300013105 | Unclassified | 3952 |
| 195 | Ga0157369_10073705 | 3300013105 | Unclassified | 3662 |
| 196 | Ga0157374_10000270 | 3300013296 | Bacteria | 48104 |
| 197 | Ga0157374_10000488 | 3300013296 | Bacteria | 35893 |
| 198 | Ga0157374_10001096 | 3300013296 | Bacteria | 23321 |
| 199 | Ga0157374_10034862 | 3300013296 | Unclassified | 4601 |
| 200 | Ga0157378_10000668 | 3300013297 | Bacteria | 32294 |
| 201 | Ga0157378_10002760 | 3300013297 | Bacteria | 15642 |
| 202 | Ga0157378_10017669 | 3300013297 | Bacteria | 6261 |
| 203 | Ga0157378_10049151 | 3300013297 | Unclassified | 3752 |
| 204 | Ga0163162_10048602 | 3300013306 | Bacteria | 4251 |
| 205 | Ga0157372_10000224 | 3300013307 | Bacteria | 62900 |
| 206 | Ga0157372_10005618 | 3300013307 | Bacteria | 13336 |
| 207 | Ga0157372_10011568 | 3300013307 | Bacteria | 9390 |
| 208 | Ga0157372_10015190 | 3300013307 | Bacteria | 8244 |
| 209 | Ga0157372_10021905 | 3300013307 | Bacteria | 6907 |
| 210 | Ga0157372_10292770 | 3300013307 | Bacteria | 1893 |
| 211 | Ga0157375_10000041 | 3300013308 | Bacteria | 162765 |
| 212 | Ga0157375_10618986 | 3300013308 | Unclassified | 1241 |
| 213 | Ga0163163_10000108 | 3300014325 | Bacteria | 87727 |
| 214 | Ga0163163_10181003 | 3300014325 | Unclassified | 2155 |
| 215 | Ga0163163_10212377 | 3300014325 | Bacteria | 1984 |
| 216 | Ga0157376_10131193 | 3300014969 | Unclassified | 2236 |
| 217 | Ga0163161_10012571 | 3300017792 | Bacteria | 5881 |
| 218 | Ga0213872_10008719 | 3300021361 | Bacteria | 4897 |
| 219 | Ga0213874_10072544 | 3300021377 | Bacteria | 1101 |
| 220 | Ga0213876_10033838 | 3300021384 | Unclassified | 2694 |
| 221 | Ga0207697_10002682 | 3300025315 | Bacteria | 9101 |
| 222 | Ga0207682_10004219 | 3300025893 | Bacteria | 6070 |
| 223 | Ga0207688_10002275 | 3300025901 | Bacteria | 10324 |
| 224 | Ga0207699_10002243 | 3300025906 | Bacteria | 9116 |
| 225 | Ga0207699_10072572 | 3300025906 | Unclassified | 2109 |
| 226 | Ga0207645_10007866 | 3300025907 | Bacteria | 7497 |
| 227 | Ga0207643_10000596 | 3300025908 | Bacteria | 22885 |
| 228 | Ga0207705_10416858 | 3300025909 | Unclassified | 1039 |
| 229 | Ga0207707_10000233 | 3300025912 | Bacteria | 60050 |
| 230 | Ga0207707_10008255 | 3300025912 | Bacteria | 9039 |
| 231 | Ga0207707_10169794 | 3300025912 | Bacteria | 1906 |
| 232 | Ga0207695_10053035 | 3300025913 | Unclassified | 4244 |
| 233 | Ga0207695_10058272 | 3300025913 | Unclassified | 4009 |
| 234 | Ga0207695_10077083 | 3300025913 | Unclassified | 3387 |
| 235 | Ga0207671_10284847 | 3300025914 | Bacteria | 1304 |
| 236 | Ga0207663_10204356 | 3300025916 | Bacteria | 1427 |
| 237 | Ga0207660_10002370 | 3300025917 | Bacteria | 12397 |
| 238 | Ga0207662_10002749 | 3300025918 | Bacteria | 8884 |
| 239 | Ga0207657_10244030 | 3300025919 | Unclassified | 1433 |
| 240 | Ga0207649_10013888 | 3300025920 | Bacteria | 4505 |
| 241 | Ga0207649_10034785 | 3300025920 | Bacteria | 3022 |
| 242 | Ga0207646_10244053 | 3300025922 | Unclassified | 1622 |
| 243 | Ga0207681_10297677 | 3300025923 | Bacteria | 1275 |
| 244 | Ga0207694_10001856 | 3300025924 | Bacteria | 17584 |
| 245 | Ga0207694_10438387 | 3300025924 | Bacteria | 1090 |
| 246 | Ga0207650_10104242 | 3300025925 | Bacteria | 2188 |
| 247 | Ga0207650_10174126 | 3300025925 | Bacteria | 1712 |
| 248 | Ga0207659_10038353 | 3300025926 | Unclassified | 3332 |
| 249 | Ga0207659_10191213 | 3300025926 | Bacteria | 1629 |
| 250 | Ga0207700_10017937 | 3300025928 | Bacteria | 4740 |
| 251 | Ga0207700_10267348 | 3300025928 | Unclassified | 1466 |
| 252 | Ga0207700_10459491 | 3300025928 | Bacteria | 1123 |
| 253 | Ga0207664_10424127 | 3300025929 | Bacteria | 1185 |
| 254 | Ga0207706_10018285 | 3300025933 | Bacteria | 6306 |
| 255 | Ga0207706_10111174 | 3300025933 | Bacteria | 2410 |
| 256 | Ga0207686_10127467 | 3300025934 | Bacteria | 1741 |
| 257 | Ga0207709_10356894 | 3300025935 | Bacteria | 1105 |
| 258 | Ga0207670_10007729 | 3300025936 | Bacteria | 6027 |
| 259 | Ga0207670_10023207 | 3300025936 | Bacteria | 3858 |
| 260 | Ga0207670_10074067 | 3300025936 | Bacteria | 2363 |
| 261 | Ga0207704_10138737 | 3300025938 | Bacteria | 1697 |
| 262 | Ga0207665_10001680 | 3300025939 | Bacteria | 14896 |
| 263 | Ga0207665_10160411 | 3300025939 | Unclassified | 1617 |
| 264 | Ga0207691_10000690 | 3300025940 | Bacteria | 33386 |
| 265 | Ga0207711_10003080 | 3300025941 | Bacteria | 14540 |
| 266 | Ga0207689_10009863 | 3300025942 | Bacteria | 8232 |
| 267 | Ga0207661_10120034 | 3300025944 | Unclassified | 2237 |
| 268 | Ga0207679_10006950 | 3300025945 | Bacteria | 7171 |
| 269 | Ga0207679_10153045 | 3300025945 | Unclassified | 1880 |
| 270 | Ga0207679_10323106 | 3300025945 | Unclassified | 1337 |
| 271 | Ga0207667_10000742 | 3300025949 | Bacteria | 42462 |
| 272 | Ga0207667_10020801 | 3300025949 | Bacteria | 7287 |
| 273 | Ga0207667_10038109 | 3300025949 | Bacteria | 5135 |
| 274 | Ga0207667_10111572 | 3300025949 | Unclassified | 2820 |
| 275 | Ga0207667_10152106 | 3300025949 | Bacteria | 2381 |
| 276 | Ga0207667_10220795 | 3300025949 | Unclassified | 1942 |
| 277 | Ga0207712_10037218 | 3300025961 | Unclassified | 3319 |
| 278 | Ga0207640_10003040 | 3300025981 | Bacteria | 9030 |
| 279 | Ga0207640_10038226 | 3300025981 | Unclassified | 3027 |
| 280 | Ga0207658_10075194 | 3300025986 | Bacteria | 2569 |
| 281 | Ga0207677_10014024 | 3300026023 | Unclassified | 4664 |
| 282 | Ga0207677_10023103 | 3300026023 | Bacteria | 3834 |
| 283 | Ga0207703_10008845 | 3300026035 | Bacteria | 7939 |
| 284 | Ga0207639_10012295 | 3300026041 | Bacteria | 5961 |
| 285 | Ga0207708_10016599 | 3300026075 | Bacteria | 5539 |
| 286 | Ga0207702_10000770 | 3300026078 | Bacteria | 33957 |
| 287 | Ga0207702_10008117 | 3300026078 | Bacteria | 8882 |
| 288 | Ga0207702_10022693 | 3300026078 | Bacteria | 5204 |
| 289 | Ga0207702_10082605 | 3300026078 | Unclassified | 2794 |
| 290 | Ga0207702_10105138 | 3300026078 | Bacteria | 2500 |
| 291 | Ga0207702_10175386 | 3300026078 | Unclassified | 1969 |
| 292 | Ga0207702_10317834 | 3300026078 | Bacteria | 1482 |
| 293 | Ga0207641_10042889 | 3300026088 | Unclassified | 3797 |
| 294 | Ga0207641_10062311 | 3300026088 | Bacteria | 3182 |
| 295 | Ga0207641_10065616 | 3300026088 | Unclassified | 3106 |
| 296 | Ga0207648_10003120 | 3300026089 | Bacteria | 17501 |
| 297 | Ga0207648_10079430 | 3300026089 | Bacteria | 2862 |
| 298 | Ga0207676_10007081 | 3300026095 | Bacteria | 7952 |
| 299 | Ga0207676_10087602 | 3300026095 | Bacteria | 2547 |
| 300 | Ga0207674_10003389 | 3300026116 | Bacteria | 19553 |
| 301 | Ga0207674_10040557 | 3300026116 | Bacteria | 4822 |
| 302 | Ga0207674_10122319 | 3300026116 | Unclassified | 2568 |
| 303 | Ga0207675_100011151 | 3300026118 | Bacteria | 8419 |
| 304 | Ga0207675_100090416 | 3300026118 | Bacteria | 2878 |
| 305 | Ga0207683_10034687 | 3300026121 | Bacteria | 4386 |
| 306 | Ga0209974_10017927 | 3300027876 | Bacteria | 2348 |
| 307 | Ga0207428_10022650 | 3300027907 | Bacteria | 5298 |
| 308 | Ga0207428_10065559 | 3300027907 | Bacteria | 2864 |
| 309 | Ga0268266_10285653 | 3300028379 | Bacteria | 1535 |
| 310 | Ga0268265_10050532 | 3300028380 | Bacteria | 3133 |
| 311 | Ga0268265_10173833 | 3300028380 | Unclassified | 1844 |
| 312 | Ga0268264_10168353 | 3300028381 | Bacteria | 1980 |
| 313 | Ga0265337_1001683 | 3300028556 | Bacteria | 10731 |
| 314 | Ga0265337_1004002 | 3300028556 | Bacteria | 6234 |
| 315 | Ga0265337_1009597 | 3300028556 | Unclassified | 3444 |
| 316 | Ga0265337_1015556 | 3300028556 | Unclassified | 2487 |
| 317 | Ga0265337_1020319 | 3300028556 | Bacteria | 2080 |
| 318 | Ga0265337_1066231 | 3300028556 | Bacteria | 996 |
| 319 | Ga0265326_10003592 | 3300028558 | Bacteria | 5073 |
| 320 | Ga0265334_10033283 | 3300028573 | Unclassified | 2052 |
| 321 | Ga0265334_10040028 | 3300028573 | Bacteria | 1837 |
| 322 | Ga0265323_10000147 | 3300028653 | Bacteria | 41074 |
| 323 | Ga0265323_10030654 | 3300028653 | Unclassified | 2002 |
| 324 | Ga0265323_10031374 | 3300028653 | Bacteria | 1975 |
| 325 | Ga0265323_10043951 | 3300028653 | Unclassified | 1611 |
| 326 | Ga0265336_10000776 | 3300028666 | Bacteria | 16918 |
| 327 | Ga0265336_10058262 | 3300028666 | Bacteria | 1159 |
| 328 | Ga0265338_10000208 | 3300028800 | Bacteria | 109817 |
| 329 | Ga0265338_10000282 | 3300028800 | Bacteria | 91694 |
| 330 | Ga0265338_10002054 | 3300028800 | Bacteria | 31147 |
| 331 | Ga0265338_10002629 | 3300028800 | Bacteria | 26496 |
| 332 | Ga0265338_10003122 | 3300028800 | Bacteria | 23683 |
| 333 | Ga0265338_10005169 | 3300028800 | Bacteria | 17145 |
| 334 | Ga0265338_10005911 | 3300028800 | Bacteria | 15772 |
| 335 | Ga0265338_10007596 | 3300028800 | Bacteria | 13393 |
| 336 | Ga0265338_10013151 | 3300028800 | Bacteria | 9372 |
| 337 | Ga0265338_10046998 | 3300028800 | Unclassified | 3947 |
| 338 | Ga0265338_10059100 | 3300028800 | Bacteria | 3379 |
| 339 | Ga0265338_10104478 | 3300028800 | Unclassified | 2299 |
| 340 | Ga0265338_10111680 | 3300028800 | Unclassified | 2199 |
| 341 | Ga0265338_10118612 | 3300028800 | Bacteria | 2114 |
| 342 | Ga0265338_10198541 | 3300028800 | Unclassified | 1514 |
| 343 | Ga0265324_10000279 | 3300029957 | Bacteria | 37760 |
| 344 | Ga0265324_10000455 | 3300029957 | Bacteria | 28816 |
| 345 | Ga0265324_10004055 | 3300029957 | Bacteria | 6732 |
| 346 | Ga0265324_10004924 | 3300029957 | Bacteria | 5876 |
| 347 | Ga0265324_10010902 | 3300029957 | Bacteria | 3484 |
| 348 | Ga0265324_10012171 | 3300029957 | Bacteria | 3253 |
| 349 | Ga0265324_10012897 | 3300029957 | Bacteria | 3136 |
| 350 | Ga0265324_10015474 | 3300029957 | Unclassified | 2806 |
| 351 | Ga0265324_10019975 | 3300029957 | Bacteria | 2410 |
| 352 | Ga0265324_10072503 | 3300029957 | Unclassified | 1173 |
| 353 | Ga0265330_10023226 | 3300031235 | Unclassified | 2818 |
| 354 | Ga0265320_10000378 | 3300031240 | Bacteria | 36023 |
| 355 | Ga0265320_10007638 | 3300031240 | Bacteria | 6692 |
| 356 | Ga0265320_10155561 | 3300031240 | Bacteria | 1031 |
| 357 | Ga0265331_10070064 | 3300031250 | Bacteria | 1642 |
| 358 | Ga0265331_10116319 | 3300031250 | Unclassified | 1224 |
| 359 | Ga0265327_10001043 | 3300031251 | Bacteria | 38982 |
| 360 | Ga0265327_10050065 | 3300031251 | Bacteria | 2188 |
| 361 | Ga0265327_10126867 | 3300031251 | Bacteria | 1204 |
| 362 | Ga0265316_10001466 | 3300031344 | Bacteria | 25278 |
| 363 | Ga0265316_10018471 | 3300031344 | Bacteria | 5990 |
| 364 | Ga0265316_10031614 | 3300031344 | Bacteria | 4326 |
| 365 | Ga0265316_10053988 | 3300031344 | Bacteria | 3146 |
| 366 | Ga0265316_10195092 | 3300031344 | Bacteria | 1503 |
| 367 | Ga0265316_10214850 | 3300031344 | Bacteria | 1421 |
| 368 | Ga0265314_10015190 | 3300031711 | Bacteria | 6118 |
| 369 | Ga0265314_10028688 | 3300031711 | Bacteria | 4146 |
| 370 | Ga0265314_10031061 | 3300031711 | Bacteria | 3948 |
| 371 | Ga0316576_10000158 | 3300031727 | Bacteria | 27353 |
| 372 | Ga0316576_10000489 | 3300031727 | Bacteria | 18595 |
| 373 | Ga0373934_0075653 | 3300035086 | Bacteria | 1350 |
| 374 | Ga0373954_0009821 | 3300035118 | Unclassified | 4211 |
| 375 | Ga0373943_0016682 | 3300035170 | Bacteria | 3352 |
| 376 | Ga0373946_0012410 | 3300035171 | Unclassified | 3190 |
| 377 | Ga0373946_0126586 | 3300035171 | Unclassified | 1171 |
| 378 | Ga0316574_0119645 | 3300035398 | Bacteria | 1691 |
| 379 | Ga0373924_0080144 | 3300035410 | Bacteria | 1388 |
| 380 | Ga0373935_0004792 | 3300035692 | Bacteria | 7956 |
| 381 | Ga0373927_0011638 | 3300035695 | Bacteria | 5855 |
| 382 | Ga0373927_0052848 | 3300035695 | Bacteria | 2627 |
| 383 | Ga0373947_0003737 | 3300035725 | Bacteria | 8985 |
| 384 | Ga0373947_0035643 | 3300035725 | Bacteria | 2946 |
| 385 | Ga0373937_0010675 | 3300036401 | Bacteria | 8034 |
| 386 | Ga0373937_0018069 | 3300036401 | Bacteria | 6290 |
| 387 | Ga0373925_0005942 | 3300037068 | Bacteria | 9042 |
| 388 | Ga0373925_0106429 | 3300037068 | Bacteria | 2162 |
| 389 | Ga0436364_0266987 | 3300037853 | Bacteria | 1064 |
| 390 | Ga0436365_1596478 | 3300039437 | Bacteria | 92213 |
| 391 | Ga0436361_0408373 | 3300039447 | Bacteria | 9614 |
| 392 | Ga0436363_0800850 | 3300039450 | Bacteria | 6284 |
| 393 | Ga0450893_0032895 | 3300042532 | Bacteria | 929 |
| 394 | Ga0451577_0010144 | 3300042876 | Bacteria | 9023 |
| 395 | Ga0451577_0013861 | 3300042876 | Bacteria | 7529 |
| 396 | Ga0451577_0020750 | 3300042876 | Bacteria | 6023 |
| 397 | Ga0451577_0202092 | 3300042876 | Bacteria | 1794 |
| 398 | Ga0466963_0061094 | 3300044694 | Unclassified | 2518 |
| 399 | Ga0453684_0002068 | 3300044712 | Bacteria | 51026 |
| 400 | Ga0453684_0006549 | 3300044712 | Bacteria | 22060 |
| 401 | Ga0453684_0020899 | 3300044712 | Bacteria | 9823 |
| 402 | Ga0453684_0077114 | 3300044712 | Bacteria | 4181 |
| 403 | Ga0453684_0096191 | 3300044712 | Unclassified | 3639 |
| 404 | Ga0453684_0355444 | 3300044712 | Bacteria | 1651 |
| 405 | Ga0466971_0029880 | 3300044719 | Unclassified | 2438 |
| 406 | Ga0466957_0069296 | 3300044842 | Unclassified | 2179 |
| 407 | Ga0451576_0010664 | 3300045051 | Bacteria | 10529 |
| 408 | Ga0451576_0070922 | 3300045051 | Bacteria | 3627 |
| 409 | Ga0451576_0104405 | 3300045051 | Unclassified | 2948 |
| 410 | Ga0451576_0164129 | 3300045051 | Bacteria | 2318 |
| 411 | Ga0451576_0169497 | 3300045051 | Bacteria | 2279 |
| 412 | Ga0451576_0313586 | 3300045051 | Bacteria | 1641 |
| 413 | Ga0451576_0369219 | 3300045051 | Unclassified | 1503 |
| 414 | Ga0451576_0488861 | 3300045051 | Bacteria | 1293 |
| 415 | Ga0451576_0901620 | 3300045051 | Unclassified | 928 |
| 416 | Ga0495592_0194191 | 3300046454 | Bacteria | 1374 |
| 417 | Ga0495629_0008758 | 3300046459 | Bacteria | 7440 |
| 418 | Ga0495580_0007065 | 3300046472 | Bacteria | 9048 |
| 419 | Ga0495582_0003008 | 3300046473 | Bacteria | 9447 |
| 420 | Ga0495662_0109302 | 3300046476 | Bacteria | 1354 |
| 421 | Ga0495628_0013552 | 3300046516 | Bacteria | 6857 |
| 422 | Ga0495628_0085662 | 3300046516 | Bacteria | 2444 |
| 423 | Ga0495630_0031924 | 3300046517 | Bacteria | 3922 |
| 424 | Ga0495630_0058802 | 3300046517 | Unclassified | 2882 |
| 425 | Ga0495630_0145664 | 3300046517 | Bacteria | 1801 |
| 426 | Ga0495630_0348812 | 3300046517 | Unclassified | 1133 |
| 427 | Ga0495630_0352236 | 3300046517 | Bacteria | 1127 |
| 428 | Ga0495666_0011845 | 3300046526 | Unclassified | 4350 |
| 429 | Ga0495652_0249240 | 3300046529 | Bacteria | 1317 |
| 430 | Ga0495665_0140754 | 3300046531 | Unclassified | 1261 |
| 431 | Ga0495640_0038940 | 3300046533 | Bacteria | 3340 |
| 432 | Ga0495586_0002871 | 3300046535 | Bacteria | 9309 |
| 433 | Ga0495587_0101552 | 3300046536 | Bacteria | 1657 |
| 434 | Ga0495621_0007103 | 3300046539 | Bacteria | 3302 |
| 435 | Ga0495645_0048766 | 3300046543 | Bacteria | 3084 |
| 436 | Ga0495633_0181075 | 3300046558 | Bacteria | 970 |
| 437 | Ga0495635_0165699 | 3300046663 | Unclassified | 1504 |
| 438 | Ga0495657_0039281 | 3300046675 | Bacteria | 3253 |
| 439 | Ga0495599_0158724 | 3300046678 | Bacteria | 1398 |
| 440 | Ga0495658_0065782 | 3300046683 | Bacteria | 2092 |
| 441 | Ga0495613_0015312 | 3300046689 | Bacteria | 5700 |
| 442 | Ga0495674_0136140 | 3300047319 | Bacteria | 2067 |
| 443 | Ga0495676_0036076 | 3300047321 | Bacteria | 4132 |
| 444 | Ga0495676_0121827 | 3300047321 | Bacteria | 1896 |
| 445 | Ga0495675_0116262 | 3300047444 | Bacteria | 1668 |
| 446 | Ga0495684_0093975 | 3300047471 | Bacteria | 2271 |
| 447 | Ga0495593_0034775 | 3300047673 | Bacteria | 2739 |
| 448 | Ga0496102_0082983 | 3300048905 | Bacteria | 2957 |
| 449 | Ga0496107_0049281 | 3300048910 | Unclassified | 3035 |
| 450 | Ga0496112_0002030 | 3300048915 | Bacteria | 16037 |
| 451 | Ga0496112_0176402 | 3300048915 | Unclassified | 2102 |
| 452 | Ga0501031_0000055 | 3300049568 | Bacteria | 61594 |
| 453 | Ga0501031_0033931 | 3300049568 | Bacteria | 3330 |
| 454 | Ga0501032_0038247 | 3300049569 | Bacteria | 3269 |
| 455 | Ga0501033_0002149 | 3300049570 | Bacteria | 17059 |
| 456 | Ga0501033_0006227 | 3300049570 | Bacteria | 9350 |
| 457 | Ga0501033_0017838 | 3300049570 | Bacteria | 5360 |
| 458 | Ga0501033_0018552 | 3300049570 | Bacteria | 5257 |
| 459 | Ga0501034_0004803 | 3300049571 | Bacteria | 14940 |
| 460 | Ga0501034_0005502 | 3300049571 | Bacteria | 13822 |
| 461 | Ga0501034_0045696 | 3300049571 | Bacteria | 4424 |
| 462 | Ga0501034_0071483 | 3300049571 | Bacteria | 3479 |
| 463 | Ga0501034_0413417 | 3300049571 | Bacteria | 1271 |
| 464 | Ga0501034_0430377 | 3300049571 | Bacteria | 1239 |
| 465 | Ga0501034_0480695 | 3300049571 | Unclassified | 1157 |
| 466 | Ga0501036_0020800 | 3300049572 | Bacteria | 5511 |
| 467 | Ga0501036_0088884 | 3300049572 | Bacteria | 2610 |
| 468 | Ga0501037_0001032 | 3300049573 | Bacteria | 20587 |
| 469 | Ga0501037_0016586 | 3300049573 | Bacteria | 5420 |
| 470 | Ga0501038_0003114 | 3300049574 | Bacteria | 15471 |
| 471 | Ga0501038_0095480 | 3300049574 | Bacteria | 2483 |
| 472 | Ga0501039_0028998 | 3300049575 | Bacteria | 4262 |
| 473 | Ga0501039_0042576 | 3300049575 | Bacteria | 3507 |
| 474 | Ga0501039_0050932 | 3300049575 | Bacteria | 3204 |
| 475 | Ga0501042_0058461 | 3300049578 | Bacteria | 2752 |
| 476 | Ga0501042_0085798 | 3300049578 | Bacteria | 2258 |
| 477 | Ga0501043_0001097 | 3300049579 | Bacteria | 23794 |
| 478 | Ga0501043_0005731 | 3300049579 | Bacteria | 10006 |
| 479 | Ga0501043_0009456 | 3300049579 | Bacteria | 7649 |
| 480 | Ga0501043_0030003 | 3300049579 | Bacteria | 4272 |
| 481 | Ga0501043_0043588 | 3300049579 | Bacteria | 3526 |
| 482 | Ga0501046_0021001 | 3300049580 | Bacteria | 5392 |
| 483 | Ga0501046_0022751 | 3300049580 | Bacteria | 5160 |
| 484 | Ga0501046_0116385 | 3300049580 | Bacteria | 2037 |
| 485 | Ga0501046_0189142 | 3300049580 | Bacteria | 1536 |
| 486 | Ga0501047_0000303 | 3300049581 | Bacteria | 56793 |
| 487 | Ga0501047_0003047 | 3300049581 | Bacteria | 15901 |
| 488 | Ga0501047_0005641 | 3300049581 | Bacteria | 11792 |
| 489 | Ga0501047_0073425 | 3300049581 | Bacteria | 3293 |
| 490 | Ga0501047_0140933 | 3300049581 | Bacteria | 2289 |
| 491 | Ga0501048_0000351 | 3300049582 | Bacteria | 31886 |
| 492 | Ga0501048_0022585 | 3300049582 | Bacteria | 4600 |
| 493 | Ga0501048_0031769 | 3300049582 | Bacteria | 3818 |
| 494 | Ga0501048_0100159 | 3300049582 | Bacteria | 2044 |
| 495 | Ga0501048_0284582 | 3300049582 | Bacteria | 1175 |
| 496 | Ga0501067_0004407 | 3300049583 | Bacteria | 7762 |
| 497 | Ga0501067_0024013 | 3300049583 | Bacteria | 3381 |
| 498 | Ga0501067_0030325 | 3300049583 | Bacteria | 2999 |
| 499 | Ga0501068_0014775 | 3300049584 | Bacteria | 4468 |
| 500 | Ga0501068_0019434 | 3300049584 | Bacteria | 3945 |
| 501 | Ga0501068_0063891 | 3300049584 | Unclassified | 2239 |
| 502 | Ga0501069_0030480 | 3300049585 | Bacteria | 2962 |
| 503 | Ga0501069_0044358 | 3300049585 | Bacteria | 2461 |
| 504 | Ga0501069_0073665 | 3300049585 | Bacteria | 1915 |
| 505 | Ga0501070_0014034 | 3300049586 | Bacteria | 6743 |
| 506 | Ga0501070_0055802 | 3300049586 | Bacteria | 3274 |
| 507 | Ga0501070_0064555 | 3300049586 | Bacteria | 3031 |
| 508 | Ga0501071_0015504 | 3300049587 | Bacteria | 5233 |
| 509 | Ga0501072_0187756 | 3300049588 | Bacteria | 1648 |
| 510 | Ga0501073_0001127 | 3300049589 | Bacteria | 19389 |
| 511 | Ga0501073_0007966 | 3300049589 | Bacteria | 7863 |
| 512 | Ga0501073_0011827 | 3300049589 | Bacteria | 6370 |
| 513 | Ga0501073_0014122 | 3300049589 | Bacteria | 5800 |
| 514 | Ga0501073_0031792 | 3300049589 | Bacteria | 3765 |
| 515 | Ga0501073_0033178 | 3300049589 | Bacteria | 3677 |
| 516 | Ga0501074_0003980 | 3300049590 | Bacteria | 10530 |
| 517 | Ga0501075_0446626 | 3300049591 | Bacteria | 986 |
| 518 | Ga0501079_0023369 | 3300049741 | Bacteria | 4745 |
| 519 | Ga0501079_0084901 | 3300049741 | Bacteria | 2449 |
| 520 | Ga0501080_0027937 | 3300049742 | Bacteria | 5246 |
| 521 | Ga0501080_0028314 | 3300049742 | Bacteria | 5211 |
| 522 | Ga0501080_0082901 | 3300049742 | Bacteria | 2979 |
| 523 | Ga0501083_0025994 | 3300049744 | Bacteria | 4049 |
| 524 | Ga0501083_0028823 | 3300049744 | Bacteria | 3824 |
| 525 | Ga0501035_0029574 | 3300049822 | Bacteria | 4996 |
| 526 | Ga0501035_0042283 | 3300049822 | Bacteria | 4110 |
| 527 | Ga0501035_0042908 | 3300049822 | Bacteria | 4077 |
| 528 | Ga0501035_0229185 | 3300049822 | Bacteria | 1583 |
| 529 | Ga0501035_0350689 | 3300049822 | Bacteria | 1235 |
| 530 | Ga0501044_0000032 | 3300049823 | Bacteria | 169439 |
| 531 | Ga0501044_0037772 | 3300049823 | Bacteria | 5046 |
| 532 | Ga0501044_0057381 | 3300049823 | Bacteria | 3995 |
| 533 | Ga0501044_0064284 | 3300049823 | Bacteria | 3746 |
| 534 | Ga0501044_0068136 | 3300049823 | Bacteria | 3625 |
| 535 | Ga0501044_0322554 | 3300049823 | Unclassified | 1469 |
| 536 | Ga0501044_0377721 | 3300049823 | Bacteria | 1332 |
| 537 | Ga0501045_0080578 | 3300049824 | Bacteria | 2400 |
| 538 | nmdc:mga05p37_211327_c1 | 3300050507 | Unclassified | 2345 |
| 539 | nmdc:mga09592_822_c1 | 3300050508 | Bacteria | 24008 |
| 540 | nmdc:mga0qj67_167088_c1 | 3300050509 | Bacteria | 1786 |
| 541 | nmdc:mga06r32_133055_c1 | 3300050510 | Bacteria | 2460 |
| 542 | nmdc:mga06r32_250831_c1 | 3300050510 | Bacteria | 1757 |
| 543 | nmdc:mga06r32_30666_c1 | 3300050510 | Bacteria | 5047 |
| 544 | nmdc:mga06r32_95181_c1 | 3300050510 | Bacteria | 2914 |
| 545 | nmdc:mga08y16_200362_c1 | 3300050511 | Bacteria | 2069 |
| 546 | nmdc:mga0rr50_19645_c1 | 3300050513 | Bacteria | 4567 |
| 547 | nmdc:mga08x19_21857_c1 | 3300050514 | Bacteria | 3955 |
| 548 | Ga0501084_0012209 | 3300054114 | Bacteria | 7108 |
| 549 | Ga0501084_0020083 | 3300054114 | Bacteria | 5571 |
| 550 | Ga0501084_0038306 | 3300054114 | Bacteria | 4008 |
| 551 | Ga0501084_0182898 | 3300054114 | Bacteria | 1769 |
| 552 | Ga0587066_030654 | 3300059490 | Unclassified | 957 |
| 553 | Ga0501082_0020196 | 3300060353 | Bacteria | 5741 |
| 554 | Ga0501082_0020958 | 3300060353 | Bacteria | 5638 |
| 555 | Ga0501082_0026684 | 3300060353 | Bacteria | 4979 |
| 556 | Ga0501082_0044758 | 3300060353 | Bacteria | 3817 |
| 557 | Ga0265326_10010129 | |||
| 558 | JGI24737J22298_10042547 | |||
| 559 | JGI25406J46586_10000252 | |||
| 560 | rootL2_10317165 | |||
| 561 | Ga0065715_10005921 | |||
| 562 | Ga0065715_10018500 | |||
| 563 | Ga0070683_100328102 | |||
| 564 | Ga0070690_100008969 | |||
| 565 | Ga0070690_100010952 | |||
| 566 | Ga0070690_100030624 | |||
| 567 | Ga0070670_100011745 | |||
| 568 | Ga0070670_100077061 | |||
| 569 | Ga0070666_10037030 | |||
| 570 | Ga0070666_10046606 | |||
| 571 | Ga0070680_100089080 | |||
| 572 | Ga0070682_100038002 | |||
| 573 | Ga0068868_100005366 | |||
| 574 | Ga0068868_100009262 | |||
| 575 | Ga0068868_100018252 | |||
| 576 | Ga0070689_100029141 | |||
| 577 | Ga0070689_100105558 | |||
| 578 | Ga0070689_100415496 | |||
| 579 | Ga0070691_10083984 | |||
| 580 | Ga0070687_100136710 | |||
| 581 | Ga0070661_100019772 | |||
| 582 | Ga0070661_100033461 | |||
| 583 | Ga0070668_100038128 | |||
| 584 | Ga0070669_100286826 | |||
| 585 | Ga0070675_100183668 | |||
| 586 | Ga0070688_100005672 | |||
| 587 | Ga0070688_100074653 | |||
| 588 | Ga0070688_100118065 | |||
| 589 | Ga0070667_100039945 | |||
| 590 | Ga0070709_10026531 | |||
| 591 | Ga0070709_10197323 | |||
| 592 | Ga0070714_100003667 | |||
| 593 | Ga0070714_100132920 | |||
| 594 | Ga0070714_100173218 | |||
| 595 | Ga0070713_100043767 | |||
| 596 | Ga0070713_100049973 | |||
| 597 | Ga0070713_100177236 | |||
| 598 | Ga0070713_100376627 | |||
| 599 | Ga0070710_10047169 | |||
| 600 | Ga0070701_10011455 | |||
| 601 | Ga0070701_10014994 | |||
| 602 | Ga0070711_100015204 | |||
| 603 | Ga0070711_100022841 | |||
| 604 | Ga0070700_100398197 | |||
| 605 | Ga0070694_100002556 | |||
| 606 | Ga0070708_100030319 | |||
| 607 | Ga0070708_100072556 | |||
| 608 | Ga0070663_100071382 | |||
| 609 | Ga0070678_100003365 | |||
| 610 | Ga0070662_100075273 | |||
| 611 | Ga0070662_100119377 | |||
| 612 | Ga0070681_10000049 | |||
| 613 | Ga0070681_10036240 | |||
| 614 | Ga0068867_100227240 | |||
| 615 | Ga0068867_100426688 | |||
| 616 | Ga0070707_100123163 | |||
| 617 | Ga0070698_100002069 | |||
| 618 | Ga0070699_100018109 | |||
| 619 | Ga0070679_100088782 | |||
| 620 | Ga0070684_100090367 | |||
| 621 | Ga0070684_100154647 | |||
| 622 | Ga0070684_100166464 | |||
| 623 | Ga0070684_100174868 | |||
| 624 | Ga0070697_100167978 | |||
| 625 | Ga0070697_100566600 | |||
| 626 | Ga0068853_100024956 | |||
| 627 | Ga0070672_100288444 | |||
| 628 | Ga0070686_100015739 | |||
| 629 | Ga0070686_100035049 | |||
| 630 | Ga0070686_100047853 | |||
| 631 | Ga0070686_100057428 | |||
| 632 | Ga0070686_100145144 | |||
| 633 | Ga0070696_100295252 | |||
| 634 | Ga0070693_100039730 | |||
| 635 | Ga0070665_100018093 | |||
| 636 | Ga0070704_100000899 | |||
| 637 | Ga0070704_100094886 | |||
| 638 | Ga0068855_100000397 | |||
| 639 | Ga0068855_100002551 | |||
| 640 | Ga0068855_100013146 | |||
| 641 | Ga0068855_100070636 | |||
| 642 | Ga0068855_100071452 | |||
| 643 | Ga0068855_100149699 | |||
| 644 | Ga0068855_100274231 | |||
| 645 | Ga0070664_100000468 | |||
| 646 | Ga0070664_100018413 | |||
| 647 | Ga0070664_100357758 | |||
| 648 | Ga0068857_100000474 | |||
| 649 | Ga0068857_100027934 | |||
| 650 | Ga0068857_100092967 | |||
| 651 | Ga0068854_100001866 | |||
| 652 | Ga0068856_100000475 | |||
| 653 | Ga0068856_100001356 | |||
| 654 | Ga0068856_100026313 | |||
| 655 | Ga0068856_100032831 | |||
| 656 | Ga0068856_100040002 | |||
| 657 | Ga0068856_100284481 | |||
| 658 | Ga0070702_100023512 | |||
| 659 | Ga0070702_100068527 | |||
| 660 | Ga0068852_100067185 | |||
| 661 | Ga0068852_100114783 | |||
| 662 | Ga0068859_100000610 | |||
| 663 | Ga0068859_100238302 | |||
| 664 | Ga0068859_100286499 | |||
| 665 | Ga0068859_100519100 | |||
| 666 | Ga0068864_100000254 | |||
| 667 | Ga0068864_100312048 | |||
| 668 | Ga0068861_100061638 | |||
| 669 | Ga0068870_10009722 | |||
| 670 | Ga0068870_10060978 | |||
| 671 | Ga0068863_100006753 | |||
| 672 | Ga0068863_100013508 | |||
| 673 | Ga0068863_100015155 | |||
| 674 | Ga0068863_100100916 | |||
| 675 | Ga0068863_100122001 | |||
| 676 | Ga0068858_100001715 | |||
| 677 | Ga0068858_100013396 | |||
| 678 | Ga0068858_100042108 | |||
| 679 | Ga0068860_100029683 | |||
| 680 | Ga0068860_100032387 | |||
| 681 | Ga0068860_100096204 | |||
| 682 | Ga0081539_10000025 | |||
| 683 | Ga0081539_10000134 | |||
| 684 | Ga0070717_10003158 | |||
| 685 | Ga0070717_10033928 | |||
| 686 | Ga0070717_10173040 | |||
| 687 | Ga0070717_10189909 | |||
| 688 | Ga0070716_100002035 | |||
| 689 | Ga0070712_100047824 | |||
| 690 | Ga0097621_100000549 | |||
| 691 | Ga0097621_100004628 | |||
| 692 | Ga0097621_100018031 | |||
| 693 | Ga0097621_100038175 | |||
| 694 | Ga0068871_100000254 | |||
| 695 | Ga0068871_100004051 | |||
| 696 | Ga0068871_100019443 | |||
| 697 | Ga0075428_100002152 | |||
| 698 | Ga0075428_100008934 | |||
| 699 | Ga0075428_100023694 | |||
| 700 | Ga0075428_100218847 | |||
| 701 | Ga0075430_100002081 | |||
| 702 | Ga0075430_100041398 | |||
| 703 | Ga0075431_100035674 | |||
| 704 | Ga0075431_100162790 | |||
| 705 | Ga0075431_100213944 | |||
| 706 | Ga0075433_10001558 | |||
| 707 | Ga0075434_100001885 | |||
| 708 | Ga0075429_100027948 | |||
| 709 | Ga0068865_100007187 | |||
| 710 | Ga0068865_100169283 | |||
| 711 | Ga0075436_100000519 | |||
| 712 | Ga0097620_100000610 | |||
| 713 | Ga0097620_100238287 | |||
| 714 | Ga0097620_100286492 | |||
| 715 | Ga0097620_100519013 | |||
| 716 | Ga0075435_100013713 | |||
| 717 | Ga0075435_100020723 | |||
| 718 | Ga0105240_10003552 | |||
| 719 | Ga0105240_10009159 | |||
| 720 | Ga0105240_10075719 | |||
| 721 | Ga0105240_10306025 | |||
| 722 | Ga0111539_10008597 | |||
| 723 | Ga0111539_10145495 | |||
| 724 | Ga0111539_10395673 | |||
| 725 | Ga0114129_10288334 | |||
| 726 | Ga0114129_10309450 | |||
| 727 | Ga0105243_10588142 | |||
| 728 | Ga0105241_10022878 | |||
| 729 | Ga0105242_10054137 | |||
| 730 | Ga0105248_10006482 | |||
| 731 | Ga0105248_10121524 | |||
| 732 | Ga0105248_10256727 | |||
| 733 | Ga0105237_10245317 | |||
| 734 | Ga0105237_10310614 | |||
| 735 | Ga0105238_10000330 | |||
| 736 | Ga0105238_10030750 | |||
| 737 | Ga0105238_10433110 | |||
| 738 | Ga0099796_10073876 | |||
| 739 | Ga0105239_10035623 | |||
| 740 | Ga0105239_10442756 | |||
| 741 | Ga0157373_10007960 | |||
| 742 | Ga0157373_10017211 | |||
| 743 | Ga0157373_10184285 | |||
| 744 | Ga0157371_10015553 | |||
| 745 | Ga0157371_10089432 | |||
| 746 | Ga0157371_10098737 | |||
| 747 | Ga0157370_10029559 | |||
| 748 | Ga0157369_10000860 | |||
| 749 | Ga0157369_10048209 | |||
| 750 | Ga0157369_10064279 | |||
| 751 | Ga0157369_10073705 | |||
| 752 | Ga0157374_10000270 | |||
| 753 | Ga0157374_10000488 | |||
| 754 | Ga0157374_10001096 | |||
| 755 | Ga0157374_10034862 | |||
| 756 | Ga0157378_10000668 | |||
| 757 | Ga0157378_10002760 | |||
| 758 | Ga0157378_10017669 | |||
| 759 | Ga0157378_10049151 | |||
| 760 | Ga0163162_10048602 | |||
| 761 | Ga0157372_10000224 | |||
| 762 | Ga0157372_10005618 | |||
| 763 | Ga0157372_10011568 | |||
| 764 | Ga0157372_10015190 | |||
| 765 | Ga0157372_10021905 | |||
| 766 | Ga0157372_10292770 | |||
| 767 | Ga0157375_10000041 | |||
| 768 | Ga0157375_10618986 | |||
| 769 | Ga0163163_10000108 | |||
| 770 | Ga0163163_10181003 | |||
| 771 | Ga0163163_10212377 | |||
| 772 | Ga0157376_10131193 | |||
| 773 | Ga0163161_10012571 | |||
| 774 | Ga0213872_10008719 | |||
| 775 | Ga0213874_10072544 | |||
| 776 | Ga0213876_10033838 | |||
| 777 | Ga0207697_10002682 | |||
| 778 | Ga0207682_10004219 | |||
| 779 | Ga0207688_10002275 | |||
| 780 | Ga0207699_10002243 | |||
| 781 | Ga0207699_10072572 | |||
| 782 | Ga0207645_10007866 | |||
| 783 | Ga0207643_10000596 | |||
| 784 | Ga0207705_10416858 | |||
| 785 | Ga0207707_10000233 | |||
| 786 | Ga0207707_10008255 | |||
| 787 | Ga0207707_10169794 | |||
| 788 | Ga0207695_10053035 | |||
| 789 | Ga0207695_10058272 | |||
| 790 | Ga0207695_10077083 | |||
| 791 | Ga0207671_10284847 | |||
| 792 | Ga0207663_10204356 | |||
| 793 | Ga0207660_10002370 | |||
| 794 | Ga0207662_10002749 | |||
| 795 | Ga0207657_10244030 | |||
| 796 | Ga0207649_10013888 | |||
| 797 | Ga0207649_10034785 | |||
| 798 | Ga0207646_10244053 | |||
| 799 | Ga0207681_10297677 | |||
| 800 | Ga0207694_10001856 | |||
| 801 | Ga0207694_10438387 | |||
| 802 | Ga0207650_10104242 | |||
| 803 | Ga0207650_10174126 | |||
| 804 | Ga0207659_10038353 | |||
| 805 | Ga0207659_10191213 | |||
| 806 | Ga0207700_10017937 | |||
| 807 | Ga0207700_10267348 | |||
| 808 | Ga0207700_10459491 | |||
| 809 | Ga0207664_10424127 | |||
| 810 | Ga0207706_10018285 | |||
| 811 | Ga0207706_10111174 | |||
| 812 | Ga0207686_10127467 | |||
| 813 | Ga0207709_10356894 | |||
| 814 | Ga0207670_10007729 | |||
| 815 | Ga0207670_10023207 | |||
| 816 | Ga0207670_10074067 | |||
| 817 | Ga0207704_10138737 | |||
| 818 | Ga0207665_10001680 | |||
| 819 | Ga0207665_10160411 | |||
| 820 | Ga0207691_10000690 | |||
| 821 | Ga0207711_10003080 | |||
| 822 | Ga0207689_10009863 | |||
| 823 | Ga0207661_10120034 | |||
| 824 | Ga0207679_10006950 | |||
| 825 | Ga0207679_10153045 | |||
| 826 | Ga0207679_10323106 | |||
| 827 | Ga0207667_10000742 | |||
| 828 | Ga0207667_10020801 | |||
| 829 | Ga0207667_10038109 | |||
| 830 | Ga0207667_10111572 | |||
| 831 | Ga0207667_10152106 | |||
| 832 | Ga0207667_10220795 | |||
| 833 | Ga0207712_10037218 | |||
| 834 | Ga0207640_10003040 | |||
| 835 | Ga0207640_10038226 | |||
| 836 | Ga0207658_10075194 | |||
| 837 | Ga0207677_10014024 | |||
| 838 | Ga0207677_10023103 | |||
| 839 | Ga0207703_10008845 | |||
| 840 | Ga0207639_10012295 | |||
| 841 | Ga0207708_10016599 | |||
| 842 | Ga0207702_10000770 | |||
| 843 | Ga0207702_10008117 | |||
| 844 | Ga0207702_10022693 | |||
| 845 | Ga0207702_10082605 | |||
| 846 | Ga0207702_10105138 | |||
| 847 | Ga0207702_10175386 | |||
| 848 | Ga0207702_10317834 | |||
| 849 | Ga0207641_10042889 | |||
| 850 | Ga0207641_10062311 | |||
| 851 | Ga0207641_10065616 | |||
| 852 | Ga0207648_10003120 | |||
| 853 | Ga0207648_10079430 | |||
| 854 | Ga0207676_10007081 | |||
| 855 | Ga0207676_10087602 | |||
| 856 | Ga0207674_10003389 | |||
| 857 | Ga0207674_10040557 | |||
| 858 | Ga0207674_10122319 | |||
| 859 | Ga0207675_100011151 | |||
| 860 | Ga0207675_100090416 | |||
| 861 | Ga0207683_10034687 | |||
| 862 | Ga0209974_10017927 | |||
| 863 | Ga0207428_10022650 | |||
| 864 | Ga0207428_10065559 | |||
| 865 | Ga0268266_10285653 | |||
| 866 | Ga0268265_10050532 | |||
| 867 | Ga0268265_10173833 | |||
| 868 | Ga0268264_10168353 | |||
| 869 | Ga0265337_1001683 | |||
| 870 | Ga0265337_1004002 | |||
| 871 | Ga0265337_1009597 | |||
| 872 | Ga0265337_1015556 | |||
| 873 | Ga0265337_1020319 | |||
| 874 | Ga0265337_1066231 | |||
| 875 | Ga0265326_10003592 | |||
| 876 | Ga0265334_10033283 | |||
| 877 | Ga0265334_10040028 | |||
| 878 | Ga0265323_10000147 | |||
| 879 | Ga0265323_10030654 | |||
| 880 | Ga0265323_10031374 | |||
| 881 | Ga0265323_10043951 | |||
| 882 | Ga0265336_10000776 | |||
| 883 | Ga0265336_10058262 | |||
| 884 | Ga0265338_10000208 | |||
| 885 | Ga0265338_10000282 | |||
| 886 | Ga0265338_10002054 | |||
| 887 | Ga0265338_10002629 | |||
| 888 | Ga0265338_10003122 | |||
| 889 | Ga0265338_10005169 | |||
| 890 | Ga0265338_10005911 | |||
| 891 | Ga0265338_10007596 | |||
| 892 | Ga0265338_10013151 | |||
| 893 | Ga0265338_10046998 | |||
| 894 | Ga0265338_10059100 | |||
| 895 | Ga0265338_10104478 | |||
| 896 | Ga0265338_10111680 | |||
| 897 | Ga0265338_10118612 | |||
| 898 | Ga0265338_10198541 | |||
| 899 | Ga0265324_10000279 | |||
| 900 | Ga0265324_10000455 | |||
| 901 | Ga0265324_10004055 | |||
| 902 | Ga0265324_10004924 | |||
| 903 | Ga0265324_10010902 | |||
| 904 | Ga0265324_10012171 | |||
| 905 | Ga0265324_10012897 | |||
| 906 | Ga0265324_10015474 | |||
| 907 | Ga0265324_10019975 | |||
| 908 | Ga0265324_10072503 | |||
| 909 | Ga0265330_10023226 | |||
| 910 | Ga0265320_10000378 | |||
| 911 | Ga0265320_10007638 | |||
| 912 | Ga0265320_10155561 | |||
| 913 | Ga0265331_10070064 | |||
| 914 | Ga0265331_10116319 | |||
| 915 | Ga0265327_10001043 | |||
| 916 | Ga0265327_10050065 | |||
| 917 | Ga0265327_10126867 | |||
| 918 | Ga0265316_10001466 | |||
| 919 | Ga0265316_10018471 | |||
| 920 | Ga0265316_10031614 | |||
| 921 | Ga0265316_10053988 | |||
| 922 | Ga0265316_10195092 | |||
| 923 | Ga0265316_10214850 | |||
| 924 | Ga0265314_10015190 | |||
| 925 | Ga0265314_10028688 | |||
| 926 | Ga0265314_10031061 | |||
| 927 | Ga0316576_10000158 | |||
| 928 | Ga0316576_10000489 | |||
| 929 | Ga0373934_0075653 | |||
| 930 | Ga0373954_0009821 | |||
| 931 | Ga0373943_0016682 | |||
| 932 | Ga0373946_0012410 | |||
| 933 | Ga0373946_0126586 | |||
| 934 | Ga0316574_0119645 | |||
| 935 | Ga0373924_0080144 | |||
| 936 | Ga0373935_0004792 | |||
| 937 | Ga0373927_0011638 | |||
| 938 | Ga0373927_0052848 | |||
| 939 | Ga0373947_0003737 | |||
| 940 | Ga0373947_0035643 | |||
| 941 | Ga0373937_0010675 | |||
| 942 | Ga0373937_0018069 | |||
| 943 | Ga0373925_0005942 | |||
| 944 | Ga0373925_0106429 | |||
| 945 | Ga0436364_0266987 | |||
| 946 | Ga0436365_1596478 | |||
| 947 | Ga0436361_0408373 | |||
| 948 | Ga0436363_0800850 | |||
| 949 | Ga0450893_0032895 | |||
| 950 | Ga0451577_0010144 | |||
| 951 | Ga0451577_0013861 | |||
| 952 | Ga0451577_0020750 | |||
| 953 | Ga0451577_0202092 | |||
| 954 | Ga0466963_0061094 | |||
| 955 | Ga0453684_0002068 | |||
| 956 | Ga0453684_0006549 | |||
| 957 | Ga0453684_0020899 | |||
| 958 | Ga0453684_0077114 | |||
| 959 | Ga0453684_0096191 | |||
| 960 | Ga0453684_0355444 | |||
| 961 | Ga0466971_0029880 | |||
| 962 | Ga0466957_0069296 | |||
| 963 | Ga0451576_0010664 | |||
| 964 | Ga0451576_0070922 | |||
| 965 | Ga0451576_0104405 | |||
| 966 | Ga0451576_0164129 | |||
| 967 | Ga0451576_0169497 | |||
| 968 | Ga0451576_0313586 | |||
| 969 | Ga0451576_0369219 | |||
| 970 | Ga0451576_0488861 | |||
| 971 | Ga0451576_0901620 | |||
| 972 | Ga0495592_0194191 | |||
| 973 | Ga0495629_0008758 | |||
| 974 | Ga0495580_0007065 | |||
| 975 | Ga0495582_0003008 | |||
| 976 | Ga0495662_0109302 | |||
| 977 | Ga0495628_0013552 | |||
| 978 | Ga0495628_0085662 | |||
| 979 | Ga0495630_0031924 | |||
| 980 | Ga0495630_0058802 | |||
| 981 | Ga0495630_0145664 | |||
| 982 | Ga0495630_0348812 | |||
| 983 | Ga0495630_0352236 | |||
| 984 | Ga0495666_0011845 | |||
| 985 | Ga0495652_0249240 | |||
| 986 | Ga0495665_0140754 | |||
| 987 | Ga0495640_0038940 | |||
| 988 | Ga0495586_0002871 | |||
| 989 | Ga0495587_0101552 | |||
| 990 | Ga0495621_0007103 | |||
| 991 | Ga0495645_0048766 | |||
| 992 | Ga0495633_0181075 | |||
| 993 | Ga0495635_0165699 | |||
| 994 | Ga0495657_0039281 | |||
| 995 | Ga0495599_0158724 | |||
| 996 | Ga0495658_0065782 | |||
| 997 | Ga0495613_0015312 | |||
| 998 | Ga0495674_0136140 | |||
| 999 | Ga0495676_0036076 | |||
| 1000 | Ga0495676_0121827 | |||
| 1001 | Ga0495675_0116262 | |||
| 1002 | Ga0495684_0093975 | |||
| 1003 | Ga0495593_0034775 | |||
| 1004 | Ga0496102_0082983 | |||
| 1005 | Ga0496107_0049281 | |||
| 1006 | Ga0496112_0002030 | |||
| 1007 | Ga0496112_0176402 | |||
| 1008 | Ga0501031_0000055 | |||
| 1009 | Ga0501031_0033931 | |||
| 1010 | Ga0501032_0038247 | |||
| 1011 | Ga0501033_0002149 | |||
| 1012 | Ga0501033_0006227 | |||
| 1013 | Ga0501033_0017838 | |||
| 1014 | Ga0501033_0018552 | |||
| 1015 | Ga0501034_0004803 | |||
| 1016 | Ga0501034_0005502 | |||
| 1017 | Ga0501034_0045696 | |||
| 1018 | Ga0501034_0071483 | |||
| 1019 | Ga0501034_0413417 | |||
| 1020 | Ga0501034_0430377 | |||
| 1021 | Ga0501034_0480695 | |||
| 1022 | Ga0501036_0020800 | |||
| 1023 | Ga0501036_0088884 | |||
| 1024 | Ga0501037_0001032 | |||
| 1025 | Ga0501037_0016586 | |||
| 1026 | Ga0501038_0003114 | |||
| 1027 | Ga0501038_0095480 | |||
| 1028 | Ga0501039_0028998 | |||
| 1029 | Ga0501039_0042576 | |||
| 1030 | Ga0501039_0050932 | |||
| 1031 | Ga0501042_0058461 | |||
| 1032 | Ga0501042_0085798 | |||
| 1033 | Ga0501043_0001097 | |||
| 1034 | Ga0501043_0005731 | |||
| 1035 | Ga0501043_0009456 | |||
| 1036 | Ga0501043_0030003 | |||
| 1037 | Ga0501043_0043588 | |||
| 1038 | Ga0501046_0021001 | |||
| 1039 | Ga0501046_0022751 | |||
| 1040 | Ga0501046_0116385 | |||
| 1041 | Ga0501046_0189142 | |||
| 1042 | Ga0501047_0000303 | |||
| 1043 | Ga0501047_0003047 | |||
| 1044 | Ga0501047_0005641 | |||
| 1045 | Ga0501047_0073425 | |||
| 1046 | Ga0501047_0140933 | |||
| 1047 | Ga0501048_0000351 | |||
| 1048 | Ga0501048_0022585 | |||
| 1049 | Ga0501048_0031769 | |||
| 1050 | Ga0501048_0100159 | |||
| 1051 | Ga0501048_0284582 | |||
| 1052 | Ga0501067_0004407 | |||
| 1053 | Ga0501067_0024013 | |||
| 1054 | Ga0501067_0030325 | |||
| 1055 | Ga0501068_0014775 | |||
| 1056 | Ga0501068_0019434 | |||
| 1057 | Ga0501068_0063891 | |||
| 1058 | Ga0501069_0030480 | |||
| 1059 | Ga0501069_0044358 | |||
| 1060 | Ga0501069_0073665 | |||
| 1061 | Ga0501070_0014034 | |||
| 1062 | Ga0501070_0055802 | |||
| 1063 | Ga0501070_0064555 | |||
| 1064 | Ga0501071_0015504 | |||
| 1065 | Ga0501072_0187756 | |||
| 1066 | Ga0501073_0001127 | |||
| 1067 | Ga0501073_0007966 | |||
| 1068 | Ga0501073_0011827 | |||
| 1069 | Ga0501073_0014122 | |||
| 1070 | Ga0501073_0031792 | |||
| 1071 | Ga0501073_0033178 | |||
| 1072 | Ga0501074_0003980 | |||
| 1073 | Ga0501075_0446626 | |||
| 1074 | Ga0501079_0023369 | |||
| 1075 | Ga0501079_0084901 | |||
| 1076 | Ga0501080_0027937 | |||
| 1077 | Ga0501080_0028314 | |||
| 1078 | Ga0501080_0082901 | |||
| 1079 | Ga0501083_0025994 | |||
| 1080 | Ga0501083_0028823 | |||
| 1081 | Ga0501035_0029574 | |||
| 1082 | Ga0501035_0042283 | |||
| 1083 | Ga0501035_0042908 | |||
| 1084 | Ga0501035_0229185 | |||
| 1085 | Ga0501035_0350689 | |||
| 1086 | Ga0501044_0000032 | |||
| 1087 | Ga0501044_0037772 | |||
| 1088 | Ga0501044_0057381 | |||
| 1089 | Ga0501044_0064284 | |||
| 1090 | Ga0501044_0068136 | |||
| 1091 | Ga0501044_0322554 | |||
| 1092 | Ga0501044_0377721 | |||
| 1093 | Ga0501045_0080578 | |||
| 1094 | nmdc:mga05p37_211327_c1 | |||
| 1095 | nmdc:mga09592_822_c1 | |||
| 1096 | nmdc:mga0qj67_167088_c1 | |||
| 1097 | nmdc:mga06r32_133055_c1 | |||
| 1098 | nmdc:mga06r32_250831_c1 | |||
| 1099 | nmdc:mga06r32_30666_c1 | |||
| 1100 | nmdc:mga06r32_95181_c1 | |||
| 1101 | nmdc:mga08y16_200362_c1 | |||
| 1102 | nmdc:mga0rr50_19645_c1 | |||
| 1103 | nmdc:mga08x19_21857_c1 | |||
| 1104 | Ga0501084_0012209 | |||
| 1105 | Ga0501084_0020083 | |||
| 1106 | Ga0501084_0038306 | |||
| 1107 | Ga0501084_0182898 | |||
| 1108 | Ga0587066_030654 | |||
| 1109 | Ga0501082_0020196 | |||
| 1110 | Ga0501082_0020958 | |||
| 1111 | Ga0501082_0026684 | |||
| 1112 | Ga0501082_0044758 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dg3-assembly2.cif.gz_D | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium | 0.9339 | 6 | 261 |
| 6dg3-assembly1.cif.gz_K-2 | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium | 0.929 | 6 | 261 |
| 6utq-assembly1.cif.gz_E | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium | 0.927 | 6 | 262 |
| 6dg3-assembly2.cif.gz_D | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium | 0.9266 | 6 | 261 |
| 5udw-assembly1.cif.gz_B | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel | 0.9239 | 6 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58240_5_163_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.936 | 5 | 170 | 3.40.50.620 |
| af_Q58240_5_163_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9247 | 5 | 170 | 3.40.50.620 |
| 1xnhA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.752 | 4 | 177 | 3.40.50.620 |
| 3uz0C00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Stage III sporulation protein AH-like | 0.7495 | 195 | 262 | 1.10.287.4300 |
| 2dplA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7396 | 1 | 173 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349K7C3-F1-model_v4 | ATP-dependent sacrificial sulfur transferase LarE | 0.994 | 6 | 189 |
GO:0016783
|
| AF-A0A350I4H1-F1-model_v4 | ATP-dependent sacrificial sulfur transferase LarE | 0.9872 | 9 | 218 |
GO:0016783
|
| AF-A0A383APJ5-F1-model_v4 | NAD/GMP synthase domain-containing protein | 0.9867 | 4 | 217 |
GO:0016783
|
| AF-A0A354BF41-F1-model_v4 | ATP-dependent sacrificial sulfur transferase LarE | 0.983 | 1 | 206 |
GO:0004066
GO:0006529 GO:0016783 |
| AF-A0A382P008-F1-model_v4 | Asparagine synthetase domain-containing protein | 0.9829 | 17 | 193 |
GO:0004066
GO:0006529 GO:0016783 |