F463225

General Info

Members Datasets Scaffolds Average Seq Length
556 259 1112 289

Family's Representative Sequence

Representative Sequence 3300028558|Ga0265326_10010129|Ga0265326_100101292
Length 345
Sequence MMTRQSKRTPASSTIAPRLDKSGKKCELGAVSANKLEQLRTVLRHYGSCLVAYSGGVDSVFLARVAHEVLGDRALAVIADSPSLPRRELQEALAIAAQFHFPVRVVQTAEFDNPDYLSNPANRCYFCKHELFEHLTPIARAEKFAVIAYGENASDNGDFRPGAKAATEFQVRAPLKEAGLTKTDIRELSARLGLPTADKPQMACLSSRIPYGEPVTPEKLKMIEAAEYVLRDLGFHDVRVRHHELGVASDKWQVTGKPPAPGAVSATRHPSLVTHLARIELGPTEIPRFLEDGRPAQVAEALKKVGYAHVTLDLQGYRRGSLNEKIEKPDARLTAHDSRITKGTT

Samples

Sample ID Description Type Environment
1 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
161 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
175 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
176 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 19.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265326_10010129 3300028558 Unclassified 2805
2 JGI24737J22298_10042547 3300001990 Bacteria 1392
3 JGI25406J46586_10000252 3300003203 Bacteria 23827
4 rootL2_10317165 3300003322 Unclassified 1122
5 Ga0065715_10005921 3300005293 Bacteria 3590
6 Ga0065715_10018500 3300005293 Bacteria 3913
7 Ga0070683_100328102 3300005329 Bacteria 1457
8 Ga0070690_100008969 3300005330 Bacteria 5780
9 Ga0070690_100010952 3300005330 Bacteria 5293
10 Ga0070690_100030624 3300005330 Bacteria 3345
11 Ga0070670_100011745 3300005331 Bacteria 7491
12 Ga0070670_100077061 3300005331 Bacteria 2865
13 Ga0070666_10037030 3300005335 Bacteria 3242
14 Ga0070666_10046606 3300005335 Bacteria 2908
15 Ga0070680_100089080 3300005336 Unclassified 2553
16 Ga0070682_100038002 3300005337 Unclassified 2950
17 Ga0068868_100005366 3300005338 Bacteria 9002
18 Ga0068868_100009262 3300005338 Bacteria 7076
19 Ga0068868_100018252 3300005338 Bacteria 5241
20 Ga0070689_100029141 3300005340 Bacteria 4175
21 Ga0070689_100105558 3300005340 Bacteria 2234
22 Ga0070689_100415496 3300005340 Unclassified 1139
23 Ga0070691_10083984 3300005341 Unclassified 1563
24 Ga0070687_100136710 3300005343 Bacteria 1422
25 Ga0070661_100019772 3300005344 Bacteria 4800
26 Ga0070661_100033461 3300005344 Bacteria 3723
27 Ga0070668_100038128 3300005347 Bacteria 3672
28 Ga0070669_100286826 3300005353 Bacteria 1320
29 Ga0070675_100183668 3300005354 Bacteria 1809
30 Ga0070688_100005672 3300005365 Bacteria 6591
31 Ga0070688_100074653 3300005365 Bacteria 2178
32 Ga0070688_100118065 3300005365 Bacteria 1773
33 Ga0070667_100039945 3300005367 Bacteria 3933
34 Ga0070709_10026531 3300005434 Unclassified 3435
35 Ga0070709_10197323 3300005434 Unclassified 1423
36 Ga0070714_100003667 3300005435 Bacteria 11496
37 Ga0070714_100132920 3300005435 Unclassified 2225
38 Ga0070714_100173218 3300005435 Bacteria 1959
39 Ga0070713_100043767 3300005436 Bacteria 3663
40 Ga0070713_100049973 3300005436 Bacteria 3451
41 Ga0070713_100177236 3300005436 Unclassified 1913
42 Ga0070713_100376627 3300005436 Unclassified 1321
43 Ga0070710_10047169 3300005437 Unclassified 2402
44 Ga0070701_10011455 3300005438 Bacteria 3966
45 Ga0070701_10014994 3300005438 Bacteria 3566
46 Ga0070711_100015204 3300005439 Bacteria 4868
47 Ga0070711_100022841 3300005439 Bacteria 4059
48 Ga0070700_100398197 3300005441 Bacteria 1034
49 Ga0070694_100002556 3300005444 Bacteria 10751
50 Ga0070708_100030319 3300005445 Unclassified 4675
51 Ga0070708_100072556 3300005445 Bacteria 3102
52 Ga0070663_100071382 3300005455 Bacteria 2527
53 Ga0070678_100003365 3300005456 Bacteria 8911
54 Ga0070662_100075273 3300005457 Bacteria 2500
55 Ga0070662_100119377 3300005457 Bacteria 2019
56 Ga0070681_10000049 3300005458 Bacteria 82355
57 Ga0070681_10036240 3300005458 Bacteria 4953
58 Ga0068867_100227240 3300005459 Bacteria 1507
59 Ga0068867_100426688 3300005459 Unclassified 1124
60 Ga0070707_100123163 3300005468 Bacteria 2518
61 Ga0070698_100002069 3300005471 Bacteria 22295
62 Ga0070699_100018109 3300005518 Bacteria 6051
63 Ga0070679_100088782 3300005530 Bacteria 3078
64 Ga0070684_100090367 3300005535 Unclassified 2723
65 Ga0070684_100154647 3300005535 Unclassified 2079
66 Ga0070684_100166464 3300005535 Bacteria 2001
67 Ga0070684_100174868 3300005535 Unclassified 1951
68 Ga0070697_100167978 3300005536 Bacteria 1856
69 Ga0070697_100566600 3300005536 Unclassified 997
70 Ga0068853_100024956 3300005539 Bacteria 5016
71 Ga0070672_100288444 3300005543 Bacteria 1389
72 Ga0070686_100015739 3300005544 Bacteria 4388
73 Ga0070686_100035049 3300005544 Bacteria 3097
74 Ga0070686_100047853 3300005544 Bacteria 2706
75 Ga0070686_100057428 3300005544 Bacteria 2500
76 Ga0070686_100145144 3300005544 Unclassified 1656
77 Ga0070696_100295252 3300005546 Bacteria 1239
78 Ga0070693_100039730 3300005547 Unclassified 2637
79 Ga0070665_100018093 3300005548 Bacteria 7071
80 Ga0070704_100000899 3300005549 Bacteria 14895
81 Ga0070704_100094886 3300005549 Bacteria 2233
82 Ga0068855_100000397 3300005563 Bacteria 53677
83 Ga0068855_100002551 3300005563 Bacteria 22437
84 Ga0068855_100013146 3300005563 Bacteria 9984
85 Ga0068855_100070636 3300005563 Bacteria 4062
86 Ga0068855_100071452 3300005563 Unclassified 4036
87 Ga0068855_100149699 3300005563 Unclassified 2654
88 Ga0068855_100274231 3300005563 Bacteria 1875
89 Ga0070664_100000468 3300005564 Bacteria 30654
90 Ga0070664_100018413 3300005564 Bacteria 5737
91 Ga0070664_100357758 3300005564 Unclassified 1329
92 Ga0068857_100000474 3300005577 Bacteria 28698
93 Ga0068857_100027934 3300005577 Unclassified 4975
94 Ga0068857_100092967 3300005577 Bacteria 2701
95 Ga0068854_100001866 3300005578 Bacteria 12844
96 Ga0068856_100000475 3300005614 Bacteria 44356
97 Ga0068856_100001356 3300005614 Bacteria 25733
98 Ga0068856_100026313 3300005614 Bacteria 5674
99 Ga0068856_100032831 3300005614 Bacteria 5083
100 Ga0068856_100040002 3300005614 Bacteria 4604
101 Ga0068856_100284481 3300005614 Bacteria 1670
102 Ga0070702_100023512 3300005615 Bacteria 3276
103 Ga0070702_100068527 3300005615 Bacteria 2088
104 Ga0068852_100067185 3300005616 Unclassified 3134
105 Ga0068852_100114783 3300005616 Bacteria 2454
106 Ga0068859_100000610 3300005617 Bacteria 35815
107 Ga0068859_100238302 3300005617 Unclassified 1908
108 Ga0068859_100286499 3300005617 Unclassified 1740
109 Ga0068859_100519100 3300005617 Bacteria 1286
110 Ga0068864_100000254 3300005618 Bacteria 47729
111 Ga0068864_100312048 3300005618 Bacteria 1474
112 Ga0068861_100061638 3300005719 Bacteria 2879
113 Ga0068870_10009722 3300005840 Unclassified 4385
114 Ga0068870_10060978 3300005840 Bacteria 2026
115 Ga0068863_100006753 3300005841 Bacteria 11250
116 Ga0068863_100013508 3300005841 Bacteria 7877
117 Ga0068863_100015155 3300005841 Bacteria 7405
118 Ga0068863_100100916 3300005841 Bacteria 2743
119 Ga0068863_100122001 3300005841 Bacteria 2486
120 Ga0068858_100001715 3300005842 Bacteria 22396
121 Ga0068858_100013396 3300005842 Bacteria 7740
122 Ga0068858_100042108 3300005842 Bacteria 4234
123 Ga0068860_100029683 3300005843 Bacteria 5261
124 Ga0068860_100032387 3300005843 Bacteria 5022
125 Ga0068860_100096204 3300005843 Bacteria 2822
126 Ga0081539_10000025 3300005985 Bacteria 340255
127 Ga0081539_10000134 3300005985 Bacteria 173625
128 Ga0070717_10003158 3300006028 Bacteria 11766
129 Ga0070717_10033928 3300006028 Unclassified 4121
130 Ga0070717_10173040 3300006028 Bacteria 1879
131 Ga0070717_10189909 3300006028 Bacteria 1795
132 Ga0070716_100002035 3300006173 Bacteria 9244
133 Ga0070712_100047824 3300006175 Bacteria 2962
134 Ga0097621_100000549 3300006237 Bacteria 26421
135 Ga0097621_100004628 3300006237 Bacteria 9601
136 Ga0097621_100018031 3300006237 Bacteria 5381
137 Ga0097621_100038175 3300006237 Bacteria 3854
138 Ga0068871_100000254 3300006358 Bacteria 37126
139 Ga0068871_100004051 3300006358 Bacteria 10130
140 Ga0068871_100019443 3300006358 Bacteria 5185
141 Ga0075428_100002152 3300006844 Bacteria 21278
142 Ga0075428_100008934 3300006844 Bacteria 11120
143 Ga0075428_100023694 3300006844 Bacteria 6794
144 Ga0075428_100218847 3300006844 Bacteria 2056
145 Ga0075430_100002081 3300006846 Bacteria 16524
146 Ga0075430_100041398 3300006846 Bacteria 3898
147 Ga0075431_100035674 3300006847 Bacteria 5120
148 Ga0075431_100162790 3300006847 Unclassified 2294
149 Ga0075431_100213944 3300006847 Bacteria 1968
150 Ga0075433_10001558 3300006852 Bacteria 16961
151 Ga0075434_100001885 3300006871 Bacteria 18146
152 Ga0075429_100027948 3300006880 Unclassified 4896
153 Ga0068865_100007187 3300006881 Bacteria 6839
154 Ga0068865_100169283 3300006881 Bacteria 1673
155 Ga0075436_100000519 3300006914 Bacteria 25057
156 Ga0097620_100000610 3300006931 Bacteria 35815
157 Ga0097620_100238287 3300006931 Unclassified 1908
158 Ga0097620_100286492 3300006931 Unclassified 1740
159 Ga0097620_100519013 3300006931 Bacteria 1286
160 Ga0075435_100013713 3300007076 Bacteria 6038
161 Ga0075435_100020723 3300007076 Bacteria 5045
162 Ga0105240_10003552 3300009093 Bacteria 24193
163 Ga0105240_10009159 3300009093 Bacteria 14045
164 Ga0105240_10075719 3300009093 Unclassified 4150
165 Ga0105240_10306025 3300009093 Bacteria 1817
166 Ga0111539_10008597 3300009094 Bacteria 12966
167 Ga0111539_10145495 3300009094 Bacteria 2775
168 Ga0111539_10395673 3300009094 Unclassified 1609
169 Ga0114129_10288334 3300009147 Unclassified 2191
170 Ga0114129_10309450 3300009147 Bacteria 2103
171 Ga0105243_10588142 3300009148 Bacteria 1069
172 Ga0105241_10022878 3300009174 Unclassified 4633
173 Ga0105242_10054137 3300009176 Bacteria 3279
174 Ga0105248_10006482 3300009177 Bacteria 12835
175 Ga0105248_10121524 3300009177 Unclassified 2946
176 Ga0105248_10256727 3300009177 Bacteria 1968
177 Ga0105237_10245317 3300009545 Bacteria 1793
178 Ga0105237_10310614 3300009545 Unclassified 1580
179 Ga0105238_10000330 3300009551 Bacteria 51705
180 Ga0105238_10030750 3300009551 Bacteria 5466
181 Ga0105238_10433110 3300009551 Unclassified 1311
182 Ga0099796_10073876 3300010159 Unclassified 1237
183 Ga0105239_10035623 3300010375 Bacteria 5465
184 Ga0105239_10442756 3300010375 Unclassified 1473
185 Ga0157373_10007960 3300013100 Bacteria 7880
186 Ga0157373_10017211 3300013100 Bacteria 5263
187 Ga0157373_10184285 3300013100 Bacteria 1470
188 Ga0157371_10015553 3300013102 Bacteria 5707
189 Ga0157371_10089432 3300013102 Unclassified 2181
190 Ga0157371_10098737 3300013102 Bacteria 2071
191 Ga0157370_10029559 3300013104 Bacteria 5374
192 Ga0157369_10000860 3300013105 Bacteria 38699
193 Ga0157369_10048209 3300013105 Unclassified 4623
194 Ga0157369_10064279 3300013105 Unclassified 3952
195 Ga0157369_10073705 3300013105 Unclassified 3662
196 Ga0157374_10000270 3300013296 Bacteria 48104
197 Ga0157374_10000488 3300013296 Bacteria 35893
198 Ga0157374_10001096 3300013296 Bacteria 23321
199 Ga0157374_10034862 3300013296 Unclassified 4601
200 Ga0157378_10000668 3300013297 Bacteria 32294
201 Ga0157378_10002760 3300013297 Bacteria 15642
202 Ga0157378_10017669 3300013297 Bacteria 6261
203 Ga0157378_10049151 3300013297 Unclassified 3752
204 Ga0163162_10048602 3300013306 Bacteria 4251
205 Ga0157372_10000224 3300013307 Bacteria 62900
206 Ga0157372_10005618 3300013307 Bacteria 13336
207 Ga0157372_10011568 3300013307 Bacteria 9390
208 Ga0157372_10015190 3300013307 Bacteria 8244
209 Ga0157372_10021905 3300013307 Bacteria 6907
210 Ga0157372_10292770 3300013307 Bacteria 1893
211 Ga0157375_10000041 3300013308 Bacteria 162765
212 Ga0157375_10618986 3300013308 Unclassified 1241
213 Ga0163163_10000108 3300014325 Bacteria 87727
214 Ga0163163_10181003 3300014325 Unclassified 2155
215 Ga0163163_10212377 3300014325 Bacteria 1984
216 Ga0157376_10131193 3300014969 Unclassified 2236
217 Ga0163161_10012571 3300017792 Bacteria 5881
218 Ga0213872_10008719 3300021361 Bacteria 4897
219 Ga0213874_10072544 3300021377 Bacteria 1101
220 Ga0213876_10033838 3300021384 Unclassified 2694
221 Ga0207697_10002682 3300025315 Bacteria 9101
222 Ga0207682_10004219 3300025893 Bacteria 6070
223 Ga0207688_10002275 3300025901 Bacteria 10324
224 Ga0207699_10002243 3300025906 Bacteria 9116
225 Ga0207699_10072572 3300025906 Unclassified 2109
226 Ga0207645_10007866 3300025907 Bacteria 7497
227 Ga0207643_10000596 3300025908 Bacteria 22885
228 Ga0207705_10416858 3300025909 Unclassified 1039
229 Ga0207707_10000233 3300025912 Bacteria 60050
230 Ga0207707_10008255 3300025912 Bacteria 9039
231 Ga0207707_10169794 3300025912 Bacteria 1906
232 Ga0207695_10053035 3300025913 Unclassified 4244
233 Ga0207695_10058272 3300025913 Unclassified 4009
234 Ga0207695_10077083 3300025913 Unclassified 3387
235 Ga0207671_10284847 3300025914 Bacteria 1304
236 Ga0207663_10204356 3300025916 Bacteria 1427
237 Ga0207660_10002370 3300025917 Bacteria 12397
238 Ga0207662_10002749 3300025918 Bacteria 8884
239 Ga0207657_10244030 3300025919 Unclassified 1433
240 Ga0207649_10013888 3300025920 Bacteria 4505
241 Ga0207649_10034785 3300025920 Bacteria 3022
242 Ga0207646_10244053 3300025922 Unclassified 1622
243 Ga0207681_10297677 3300025923 Bacteria 1275
244 Ga0207694_10001856 3300025924 Bacteria 17584
245 Ga0207694_10438387 3300025924 Bacteria 1090
246 Ga0207650_10104242 3300025925 Bacteria 2188
247 Ga0207650_10174126 3300025925 Bacteria 1712
248 Ga0207659_10038353 3300025926 Unclassified 3332
249 Ga0207659_10191213 3300025926 Bacteria 1629
250 Ga0207700_10017937 3300025928 Bacteria 4740
251 Ga0207700_10267348 3300025928 Unclassified 1466
252 Ga0207700_10459491 3300025928 Bacteria 1123
253 Ga0207664_10424127 3300025929 Bacteria 1185
254 Ga0207706_10018285 3300025933 Bacteria 6306
255 Ga0207706_10111174 3300025933 Bacteria 2410
256 Ga0207686_10127467 3300025934 Bacteria 1741
257 Ga0207709_10356894 3300025935 Bacteria 1105
258 Ga0207670_10007729 3300025936 Bacteria 6027
259 Ga0207670_10023207 3300025936 Bacteria 3858
260 Ga0207670_10074067 3300025936 Bacteria 2363
261 Ga0207704_10138737 3300025938 Bacteria 1697
262 Ga0207665_10001680 3300025939 Bacteria 14896
263 Ga0207665_10160411 3300025939 Unclassified 1617
264 Ga0207691_10000690 3300025940 Bacteria 33386
265 Ga0207711_10003080 3300025941 Bacteria 14540
266 Ga0207689_10009863 3300025942 Bacteria 8232
267 Ga0207661_10120034 3300025944 Unclassified 2237
268 Ga0207679_10006950 3300025945 Bacteria 7171
269 Ga0207679_10153045 3300025945 Unclassified 1880
270 Ga0207679_10323106 3300025945 Unclassified 1337
271 Ga0207667_10000742 3300025949 Bacteria 42462
272 Ga0207667_10020801 3300025949 Bacteria 7287
273 Ga0207667_10038109 3300025949 Bacteria 5135
274 Ga0207667_10111572 3300025949 Unclassified 2820
275 Ga0207667_10152106 3300025949 Bacteria 2381
276 Ga0207667_10220795 3300025949 Unclassified 1942
277 Ga0207712_10037218 3300025961 Unclassified 3319
278 Ga0207640_10003040 3300025981 Bacteria 9030
279 Ga0207640_10038226 3300025981 Unclassified 3027
280 Ga0207658_10075194 3300025986 Bacteria 2569
281 Ga0207677_10014024 3300026023 Unclassified 4664
282 Ga0207677_10023103 3300026023 Bacteria 3834
283 Ga0207703_10008845 3300026035 Bacteria 7939
284 Ga0207639_10012295 3300026041 Bacteria 5961
285 Ga0207708_10016599 3300026075 Bacteria 5539
286 Ga0207702_10000770 3300026078 Bacteria 33957
287 Ga0207702_10008117 3300026078 Bacteria 8882
288 Ga0207702_10022693 3300026078 Bacteria 5204
289 Ga0207702_10082605 3300026078 Unclassified 2794
290 Ga0207702_10105138 3300026078 Bacteria 2500
291 Ga0207702_10175386 3300026078 Unclassified 1969
292 Ga0207702_10317834 3300026078 Bacteria 1482
293 Ga0207641_10042889 3300026088 Unclassified 3797
294 Ga0207641_10062311 3300026088 Bacteria 3182
295 Ga0207641_10065616 3300026088 Unclassified 3106
296 Ga0207648_10003120 3300026089 Bacteria 17501
297 Ga0207648_10079430 3300026089 Bacteria 2862
298 Ga0207676_10007081 3300026095 Bacteria 7952
299 Ga0207676_10087602 3300026095 Bacteria 2547
300 Ga0207674_10003389 3300026116 Bacteria 19553
301 Ga0207674_10040557 3300026116 Bacteria 4822
302 Ga0207674_10122319 3300026116 Unclassified 2568
303 Ga0207675_100011151 3300026118 Bacteria 8419
304 Ga0207675_100090416 3300026118 Bacteria 2878
305 Ga0207683_10034687 3300026121 Bacteria 4386
306 Ga0209974_10017927 3300027876 Bacteria 2348
307 Ga0207428_10022650 3300027907 Bacteria 5298
308 Ga0207428_10065559 3300027907 Bacteria 2864
309 Ga0268266_10285653 3300028379 Bacteria 1535
310 Ga0268265_10050532 3300028380 Bacteria 3133
311 Ga0268265_10173833 3300028380 Unclassified 1844
312 Ga0268264_10168353 3300028381 Bacteria 1980
313 Ga0265337_1001683 3300028556 Bacteria 10731
314 Ga0265337_1004002 3300028556 Bacteria 6234
315 Ga0265337_1009597 3300028556 Unclassified 3444
316 Ga0265337_1015556 3300028556 Unclassified 2487
317 Ga0265337_1020319 3300028556 Bacteria 2080
318 Ga0265337_1066231 3300028556 Bacteria 996
319 Ga0265326_10003592 3300028558 Bacteria 5073
320 Ga0265334_10033283 3300028573 Unclassified 2052
321 Ga0265334_10040028 3300028573 Bacteria 1837
322 Ga0265323_10000147 3300028653 Bacteria 41074
323 Ga0265323_10030654 3300028653 Unclassified 2002
324 Ga0265323_10031374 3300028653 Bacteria 1975
325 Ga0265323_10043951 3300028653 Unclassified 1611
326 Ga0265336_10000776 3300028666 Bacteria 16918
327 Ga0265336_10058262 3300028666 Bacteria 1159
328 Ga0265338_10000208 3300028800 Bacteria 109817
329 Ga0265338_10000282 3300028800 Bacteria 91694
330 Ga0265338_10002054 3300028800 Bacteria 31147
331 Ga0265338_10002629 3300028800 Bacteria 26496
332 Ga0265338_10003122 3300028800 Bacteria 23683
333 Ga0265338_10005169 3300028800 Bacteria 17145
334 Ga0265338_10005911 3300028800 Bacteria 15772
335 Ga0265338_10007596 3300028800 Bacteria 13393
336 Ga0265338_10013151 3300028800 Bacteria 9372
337 Ga0265338_10046998 3300028800 Unclassified 3947
338 Ga0265338_10059100 3300028800 Bacteria 3379
339 Ga0265338_10104478 3300028800 Unclassified 2299
340 Ga0265338_10111680 3300028800 Unclassified 2199
341 Ga0265338_10118612 3300028800 Bacteria 2114
342 Ga0265338_10198541 3300028800 Unclassified 1514
343 Ga0265324_10000279 3300029957 Bacteria 37760
344 Ga0265324_10000455 3300029957 Bacteria 28816
345 Ga0265324_10004055 3300029957 Bacteria 6732
346 Ga0265324_10004924 3300029957 Bacteria 5876
347 Ga0265324_10010902 3300029957 Bacteria 3484
348 Ga0265324_10012171 3300029957 Bacteria 3253
349 Ga0265324_10012897 3300029957 Bacteria 3136
350 Ga0265324_10015474 3300029957 Unclassified 2806
351 Ga0265324_10019975 3300029957 Bacteria 2410
352 Ga0265324_10072503 3300029957 Unclassified 1173
353 Ga0265330_10023226 3300031235 Unclassified 2818
354 Ga0265320_10000378 3300031240 Bacteria 36023
355 Ga0265320_10007638 3300031240 Bacteria 6692
356 Ga0265320_10155561 3300031240 Bacteria 1031
357 Ga0265331_10070064 3300031250 Bacteria 1642
358 Ga0265331_10116319 3300031250 Unclassified 1224
359 Ga0265327_10001043 3300031251 Bacteria 38982
360 Ga0265327_10050065 3300031251 Bacteria 2188
361 Ga0265327_10126867 3300031251 Bacteria 1204
362 Ga0265316_10001466 3300031344 Bacteria 25278
363 Ga0265316_10018471 3300031344 Bacteria 5990
364 Ga0265316_10031614 3300031344 Bacteria 4326
365 Ga0265316_10053988 3300031344 Bacteria 3146
366 Ga0265316_10195092 3300031344 Bacteria 1503
367 Ga0265316_10214850 3300031344 Bacteria 1421
368 Ga0265314_10015190 3300031711 Bacteria 6118
369 Ga0265314_10028688 3300031711 Bacteria 4146
370 Ga0265314_10031061 3300031711 Bacteria 3948
371 Ga0316576_10000158 3300031727 Bacteria 27353
372 Ga0316576_10000489 3300031727 Bacteria 18595
373 Ga0373934_0075653 3300035086 Bacteria 1350
374 Ga0373954_0009821 3300035118 Unclassified 4211
375 Ga0373943_0016682 3300035170 Bacteria 3352
376 Ga0373946_0012410 3300035171 Unclassified 3190
377 Ga0373946_0126586 3300035171 Unclassified 1171
378 Ga0316574_0119645 3300035398 Bacteria 1691
379 Ga0373924_0080144 3300035410 Bacteria 1388
380 Ga0373935_0004792 3300035692 Bacteria 7956
381 Ga0373927_0011638 3300035695 Bacteria 5855
382 Ga0373927_0052848 3300035695 Bacteria 2627
383 Ga0373947_0003737 3300035725 Bacteria 8985
384 Ga0373947_0035643 3300035725 Bacteria 2946
385 Ga0373937_0010675 3300036401 Bacteria 8034
386 Ga0373937_0018069 3300036401 Bacteria 6290
387 Ga0373925_0005942 3300037068 Bacteria 9042
388 Ga0373925_0106429 3300037068 Bacteria 2162
389 Ga0436364_0266987 3300037853 Bacteria 1064
390 Ga0436365_1596478 3300039437 Bacteria 92213
391 Ga0436361_0408373 3300039447 Bacteria 9614
392 Ga0436363_0800850 3300039450 Bacteria 6284
393 Ga0450893_0032895 3300042532 Bacteria 929
394 Ga0451577_0010144 3300042876 Bacteria 9023
395 Ga0451577_0013861 3300042876 Bacteria 7529
396 Ga0451577_0020750 3300042876 Bacteria 6023
397 Ga0451577_0202092 3300042876 Bacteria 1794
398 Ga0466963_0061094 3300044694 Unclassified 2518
399 Ga0453684_0002068 3300044712 Bacteria 51026
400 Ga0453684_0006549 3300044712 Bacteria 22060
401 Ga0453684_0020899 3300044712 Bacteria 9823
402 Ga0453684_0077114 3300044712 Bacteria 4181
403 Ga0453684_0096191 3300044712 Unclassified 3639
404 Ga0453684_0355444 3300044712 Bacteria 1651
405 Ga0466971_0029880 3300044719 Unclassified 2438
406 Ga0466957_0069296 3300044842 Unclassified 2179
407 Ga0451576_0010664 3300045051 Bacteria 10529
408 Ga0451576_0070922 3300045051 Bacteria 3627
409 Ga0451576_0104405 3300045051 Unclassified 2948
410 Ga0451576_0164129 3300045051 Bacteria 2318
411 Ga0451576_0169497 3300045051 Bacteria 2279
412 Ga0451576_0313586 3300045051 Bacteria 1641
413 Ga0451576_0369219 3300045051 Unclassified 1503
414 Ga0451576_0488861 3300045051 Bacteria 1293
415 Ga0451576_0901620 3300045051 Unclassified 928
416 Ga0495592_0194191 3300046454 Bacteria 1374
417 Ga0495629_0008758 3300046459 Bacteria 7440
418 Ga0495580_0007065 3300046472 Bacteria 9048
419 Ga0495582_0003008 3300046473 Bacteria 9447
420 Ga0495662_0109302 3300046476 Bacteria 1354
421 Ga0495628_0013552 3300046516 Bacteria 6857
422 Ga0495628_0085662 3300046516 Bacteria 2444
423 Ga0495630_0031924 3300046517 Bacteria 3922
424 Ga0495630_0058802 3300046517 Unclassified 2882
425 Ga0495630_0145664 3300046517 Bacteria 1801
426 Ga0495630_0348812 3300046517 Unclassified 1133
427 Ga0495630_0352236 3300046517 Bacteria 1127
428 Ga0495666_0011845 3300046526 Unclassified 4350
429 Ga0495652_0249240 3300046529 Bacteria 1317
430 Ga0495665_0140754 3300046531 Unclassified 1261
431 Ga0495640_0038940 3300046533 Bacteria 3340
432 Ga0495586_0002871 3300046535 Bacteria 9309
433 Ga0495587_0101552 3300046536 Bacteria 1657
434 Ga0495621_0007103 3300046539 Bacteria 3302
435 Ga0495645_0048766 3300046543 Bacteria 3084
436 Ga0495633_0181075 3300046558 Bacteria 970
437 Ga0495635_0165699 3300046663 Unclassified 1504
438 Ga0495657_0039281 3300046675 Bacteria 3253
439 Ga0495599_0158724 3300046678 Bacteria 1398
440 Ga0495658_0065782 3300046683 Bacteria 2092
441 Ga0495613_0015312 3300046689 Bacteria 5700
442 Ga0495674_0136140 3300047319 Bacteria 2067
443 Ga0495676_0036076 3300047321 Bacteria 4132
444 Ga0495676_0121827 3300047321 Bacteria 1896
445 Ga0495675_0116262 3300047444 Bacteria 1668
446 Ga0495684_0093975 3300047471 Bacteria 2271
447 Ga0495593_0034775 3300047673 Bacteria 2739
448 Ga0496102_0082983 3300048905 Bacteria 2957
449 Ga0496107_0049281 3300048910 Unclassified 3035
450 Ga0496112_0002030 3300048915 Bacteria 16037
451 Ga0496112_0176402 3300048915 Unclassified 2102
452 Ga0501031_0000055 3300049568 Bacteria 61594
453 Ga0501031_0033931 3300049568 Bacteria 3330
454 Ga0501032_0038247 3300049569 Bacteria 3269
455 Ga0501033_0002149 3300049570 Bacteria 17059
456 Ga0501033_0006227 3300049570 Bacteria 9350
457 Ga0501033_0017838 3300049570 Bacteria 5360
458 Ga0501033_0018552 3300049570 Bacteria 5257
459 Ga0501034_0004803 3300049571 Bacteria 14940
460 Ga0501034_0005502 3300049571 Bacteria 13822
461 Ga0501034_0045696 3300049571 Bacteria 4424
462 Ga0501034_0071483 3300049571 Bacteria 3479
463 Ga0501034_0413417 3300049571 Bacteria 1271
464 Ga0501034_0430377 3300049571 Bacteria 1239
465 Ga0501034_0480695 3300049571 Unclassified 1157
466 Ga0501036_0020800 3300049572 Bacteria 5511
467 Ga0501036_0088884 3300049572 Bacteria 2610
468 Ga0501037_0001032 3300049573 Bacteria 20587
469 Ga0501037_0016586 3300049573 Bacteria 5420
470 Ga0501038_0003114 3300049574 Bacteria 15471
471 Ga0501038_0095480 3300049574 Bacteria 2483
472 Ga0501039_0028998 3300049575 Bacteria 4262
473 Ga0501039_0042576 3300049575 Bacteria 3507
474 Ga0501039_0050932 3300049575 Bacteria 3204
475 Ga0501042_0058461 3300049578 Bacteria 2752
476 Ga0501042_0085798 3300049578 Bacteria 2258
477 Ga0501043_0001097 3300049579 Bacteria 23794
478 Ga0501043_0005731 3300049579 Bacteria 10006
479 Ga0501043_0009456 3300049579 Bacteria 7649
480 Ga0501043_0030003 3300049579 Bacteria 4272
481 Ga0501043_0043588 3300049579 Bacteria 3526
482 Ga0501046_0021001 3300049580 Bacteria 5392
483 Ga0501046_0022751 3300049580 Bacteria 5160
484 Ga0501046_0116385 3300049580 Bacteria 2037
485 Ga0501046_0189142 3300049580 Bacteria 1536
486 Ga0501047_0000303 3300049581 Bacteria 56793
487 Ga0501047_0003047 3300049581 Bacteria 15901
488 Ga0501047_0005641 3300049581 Bacteria 11792
489 Ga0501047_0073425 3300049581 Bacteria 3293
490 Ga0501047_0140933 3300049581 Bacteria 2289
491 Ga0501048_0000351 3300049582 Bacteria 31886
492 Ga0501048_0022585 3300049582 Bacteria 4600
493 Ga0501048_0031769 3300049582 Bacteria 3818
494 Ga0501048_0100159 3300049582 Bacteria 2044
495 Ga0501048_0284582 3300049582 Bacteria 1175
496 Ga0501067_0004407 3300049583 Bacteria 7762
497 Ga0501067_0024013 3300049583 Bacteria 3381
498 Ga0501067_0030325 3300049583 Bacteria 2999
499 Ga0501068_0014775 3300049584 Bacteria 4468
500 Ga0501068_0019434 3300049584 Bacteria 3945
501 Ga0501068_0063891 3300049584 Unclassified 2239
502 Ga0501069_0030480 3300049585 Bacteria 2962
503 Ga0501069_0044358 3300049585 Bacteria 2461
504 Ga0501069_0073665 3300049585 Bacteria 1915
505 Ga0501070_0014034 3300049586 Bacteria 6743
506 Ga0501070_0055802 3300049586 Bacteria 3274
507 Ga0501070_0064555 3300049586 Bacteria 3031
508 Ga0501071_0015504 3300049587 Bacteria 5233
509 Ga0501072_0187756 3300049588 Bacteria 1648
510 Ga0501073_0001127 3300049589 Bacteria 19389
511 Ga0501073_0007966 3300049589 Bacteria 7863
512 Ga0501073_0011827 3300049589 Bacteria 6370
513 Ga0501073_0014122 3300049589 Bacteria 5800
514 Ga0501073_0031792 3300049589 Bacteria 3765
515 Ga0501073_0033178 3300049589 Bacteria 3677
516 Ga0501074_0003980 3300049590 Bacteria 10530
517 Ga0501075_0446626 3300049591 Bacteria 986
518 Ga0501079_0023369 3300049741 Bacteria 4745
519 Ga0501079_0084901 3300049741 Bacteria 2449
520 Ga0501080_0027937 3300049742 Bacteria 5246
521 Ga0501080_0028314 3300049742 Bacteria 5211
522 Ga0501080_0082901 3300049742 Bacteria 2979
523 Ga0501083_0025994 3300049744 Bacteria 4049
524 Ga0501083_0028823 3300049744 Bacteria 3824
525 Ga0501035_0029574 3300049822 Bacteria 4996
526 Ga0501035_0042283 3300049822 Bacteria 4110
527 Ga0501035_0042908 3300049822 Bacteria 4077
528 Ga0501035_0229185 3300049822 Bacteria 1583
529 Ga0501035_0350689 3300049822 Bacteria 1235
530 Ga0501044_0000032 3300049823 Bacteria 169439
531 Ga0501044_0037772 3300049823 Bacteria 5046
532 Ga0501044_0057381 3300049823 Bacteria 3995
533 Ga0501044_0064284 3300049823 Bacteria 3746
534 Ga0501044_0068136 3300049823 Bacteria 3625
535 Ga0501044_0322554 3300049823 Unclassified 1469
536 Ga0501044_0377721 3300049823 Bacteria 1332
537 Ga0501045_0080578 3300049824 Bacteria 2400
538 nmdc:mga05p37_211327_c1 3300050507 Unclassified 2345
539 nmdc:mga09592_822_c1 3300050508 Bacteria 24008
540 nmdc:mga0qj67_167088_c1 3300050509 Bacteria 1786
541 nmdc:mga06r32_133055_c1 3300050510 Bacteria 2460
542 nmdc:mga06r32_250831_c1 3300050510 Bacteria 1757
543 nmdc:mga06r32_30666_c1 3300050510 Bacteria 5047
544 nmdc:mga06r32_95181_c1 3300050510 Bacteria 2914
545 nmdc:mga08y16_200362_c1 3300050511 Bacteria 2069
546 nmdc:mga0rr50_19645_c1 3300050513 Bacteria 4567
547 nmdc:mga08x19_21857_c1 3300050514 Bacteria 3955
548 Ga0501084_0012209 3300054114 Bacteria 7108
549 Ga0501084_0020083 3300054114 Bacteria 5571
550 Ga0501084_0038306 3300054114 Bacteria 4008
551 Ga0501084_0182898 3300054114 Bacteria 1769
552 Ga0587066_030654 3300059490 Unclassified 957
553 Ga0501082_0020196 3300060353 Bacteria 5741
554 Ga0501082_0020958 3300060353 Bacteria 5638
555 Ga0501082_0026684 3300060353 Bacteria 4979
556 Ga0501082_0044758 3300060353 Bacteria 3817
557 Ga0265326_10010129
558 JGI24737J22298_10042547
559 JGI25406J46586_10000252
560 rootL2_10317165
561 Ga0065715_10005921
562 Ga0065715_10018500
563 Ga0070683_100328102
564 Ga0070690_100008969
565 Ga0070690_100010952
566 Ga0070690_100030624
567 Ga0070670_100011745
568 Ga0070670_100077061
569 Ga0070666_10037030
570 Ga0070666_10046606
571 Ga0070680_100089080
572 Ga0070682_100038002
573 Ga0068868_100005366
574 Ga0068868_100009262
575 Ga0068868_100018252
576 Ga0070689_100029141
577 Ga0070689_100105558
578 Ga0070689_100415496
579 Ga0070691_10083984
580 Ga0070687_100136710
581 Ga0070661_100019772
582 Ga0070661_100033461
583 Ga0070668_100038128
584 Ga0070669_100286826
585 Ga0070675_100183668
586 Ga0070688_100005672
587 Ga0070688_100074653
588 Ga0070688_100118065
589 Ga0070667_100039945
590 Ga0070709_10026531
591 Ga0070709_10197323
592 Ga0070714_100003667
593 Ga0070714_100132920
594 Ga0070714_100173218
595 Ga0070713_100043767
596 Ga0070713_100049973
597 Ga0070713_100177236
598 Ga0070713_100376627
599 Ga0070710_10047169
600 Ga0070701_10011455
601 Ga0070701_10014994
602 Ga0070711_100015204
603 Ga0070711_100022841
604 Ga0070700_100398197
605 Ga0070694_100002556
606 Ga0070708_100030319
607 Ga0070708_100072556
608 Ga0070663_100071382
609 Ga0070678_100003365
610 Ga0070662_100075273
611 Ga0070662_100119377
612 Ga0070681_10000049
613 Ga0070681_10036240
614 Ga0068867_100227240
615 Ga0068867_100426688
616 Ga0070707_100123163
617 Ga0070698_100002069
618 Ga0070699_100018109
619 Ga0070679_100088782
620 Ga0070684_100090367
621 Ga0070684_100154647
622 Ga0070684_100166464
623 Ga0070684_100174868
624 Ga0070697_100167978
625 Ga0070697_100566600
626 Ga0068853_100024956
627 Ga0070672_100288444
628 Ga0070686_100015739
629 Ga0070686_100035049
630 Ga0070686_100047853
631 Ga0070686_100057428
632 Ga0070686_100145144
633 Ga0070696_100295252
634 Ga0070693_100039730
635 Ga0070665_100018093
636 Ga0070704_100000899
637 Ga0070704_100094886
638 Ga0068855_100000397
639 Ga0068855_100002551
640 Ga0068855_100013146
641 Ga0068855_100070636
642 Ga0068855_100071452
643 Ga0068855_100149699
644 Ga0068855_100274231
645 Ga0070664_100000468
646 Ga0070664_100018413
647 Ga0070664_100357758
648 Ga0068857_100000474
649 Ga0068857_100027934
650 Ga0068857_100092967
651 Ga0068854_100001866
652 Ga0068856_100000475
653 Ga0068856_100001356
654 Ga0068856_100026313
655 Ga0068856_100032831
656 Ga0068856_100040002
657 Ga0068856_100284481
658 Ga0070702_100023512
659 Ga0070702_100068527
660 Ga0068852_100067185
661 Ga0068852_100114783
662 Ga0068859_100000610
663 Ga0068859_100238302
664 Ga0068859_100286499
665 Ga0068859_100519100
666 Ga0068864_100000254
667 Ga0068864_100312048
668 Ga0068861_100061638
669 Ga0068870_10009722
670 Ga0068870_10060978
671 Ga0068863_100006753
672 Ga0068863_100013508
673 Ga0068863_100015155
674 Ga0068863_100100916
675 Ga0068863_100122001
676 Ga0068858_100001715
677 Ga0068858_100013396
678 Ga0068858_100042108
679 Ga0068860_100029683
680 Ga0068860_100032387
681 Ga0068860_100096204
682 Ga0081539_10000025
683 Ga0081539_10000134
684 Ga0070717_10003158
685 Ga0070717_10033928
686 Ga0070717_10173040
687 Ga0070717_10189909
688 Ga0070716_100002035
689 Ga0070712_100047824
690 Ga0097621_100000549
691 Ga0097621_100004628
692 Ga0097621_100018031
693 Ga0097621_100038175
694 Ga0068871_100000254
695 Ga0068871_100004051
696 Ga0068871_100019443
697 Ga0075428_100002152
698 Ga0075428_100008934
699 Ga0075428_100023694
700 Ga0075428_100218847
701 Ga0075430_100002081
702 Ga0075430_100041398
703 Ga0075431_100035674
704 Ga0075431_100162790
705 Ga0075431_100213944
706 Ga0075433_10001558
707 Ga0075434_100001885
708 Ga0075429_100027948
709 Ga0068865_100007187
710 Ga0068865_100169283
711 Ga0075436_100000519
712 Ga0097620_100000610
713 Ga0097620_100238287
714 Ga0097620_100286492
715 Ga0097620_100519013
716 Ga0075435_100013713
717 Ga0075435_100020723
718 Ga0105240_10003552
719 Ga0105240_10009159
720 Ga0105240_10075719
721 Ga0105240_10306025
722 Ga0111539_10008597
723 Ga0111539_10145495
724 Ga0111539_10395673
725 Ga0114129_10288334
726 Ga0114129_10309450
727 Ga0105243_10588142
728 Ga0105241_10022878
729 Ga0105242_10054137
730 Ga0105248_10006482
731 Ga0105248_10121524
732 Ga0105248_10256727
733 Ga0105237_10245317
734 Ga0105237_10310614
735 Ga0105238_10000330
736 Ga0105238_10030750
737 Ga0105238_10433110
738 Ga0099796_10073876
739 Ga0105239_10035623
740 Ga0105239_10442756
741 Ga0157373_10007960
742 Ga0157373_10017211
743 Ga0157373_10184285
744 Ga0157371_10015553
745 Ga0157371_10089432
746 Ga0157371_10098737
747 Ga0157370_10029559
748 Ga0157369_10000860
749 Ga0157369_10048209
750 Ga0157369_10064279
751 Ga0157369_10073705
752 Ga0157374_10000270
753 Ga0157374_10000488
754 Ga0157374_10001096
755 Ga0157374_10034862
756 Ga0157378_10000668
757 Ga0157378_10002760
758 Ga0157378_10017669
759 Ga0157378_10049151
760 Ga0163162_10048602
761 Ga0157372_10000224
762 Ga0157372_10005618
763 Ga0157372_10011568
764 Ga0157372_10015190
765 Ga0157372_10021905
766 Ga0157372_10292770
767 Ga0157375_10000041
768 Ga0157375_10618986
769 Ga0163163_10000108
770 Ga0163163_10181003
771 Ga0163163_10212377
772 Ga0157376_10131193
773 Ga0163161_10012571
774 Ga0213872_10008719
775 Ga0213874_10072544
776 Ga0213876_10033838
777 Ga0207697_10002682
778 Ga0207682_10004219
779 Ga0207688_10002275
780 Ga0207699_10002243
781 Ga0207699_10072572
782 Ga0207645_10007866
783 Ga0207643_10000596
784 Ga0207705_10416858
785 Ga0207707_10000233
786 Ga0207707_10008255
787 Ga0207707_10169794
788 Ga0207695_10053035
789 Ga0207695_10058272
790 Ga0207695_10077083
791 Ga0207671_10284847
792 Ga0207663_10204356
793 Ga0207660_10002370
794 Ga0207662_10002749
795 Ga0207657_10244030
796 Ga0207649_10013888
797 Ga0207649_10034785
798 Ga0207646_10244053
799 Ga0207681_10297677
800 Ga0207694_10001856
801 Ga0207694_10438387
802 Ga0207650_10104242
803 Ga0207650_10174126
804 Ga0207659_10038353
805 Ga0207659_10191213
806 Ga0207700_10017937
807 Ga0207700_10267348
808 Ga0207700_10459491
809 Ga0207664_10424127
810 Ga0207706_10018285
811 Ga0207706_10111174
812 Ga0207686_10127467
813 Ga0207709_10356894
814 Ga0207670_10007729
815 Ga0207670_10023207
816 Ga0207670_10074067
817 Ga0207704_10138737
818 Ga0207665_10001680
819 Ga0207665_10160411
820 Ga0207691_10000690
821 Ga0207711_10003080
822 Ga0207689_10009863
823 Ga0207661_10120034
824 Ga0207679_10006950
825 Ga0207679_10153045
826 Ga0207679_10323106
827 Ga0207667_10000742
828 Ga0207667_10020801
829 Ga0207667_10038109
830 Ga0207667_10111572
831 Ga0207667_10152106
832 Ga0207667_10220795
833 Ga0207712_10037218
834 Ga0207640_10003040
835 Ga0207640_10038226
836 Ga0207658_10075194
837 Ga0207677_10014024
838 Ga0207677_10023103
839 Ga0207703_10008845
840 Ga0207639_10012295
841 Ga0207708_10016599
842 Ga0207702_10000770
843 Ga0207702_10008117
844 Ga0207702_10022693
845 Ga0207702_10082605
846 Ga0207702_10105138
847 Ga0207702_10175386
848 Ga0207702_10317834
849 Ga0207641_10042889
850 Ga0207641_10062311
851 Ga0207641_10065616
852 Ga0207648_10003120
853 Ga0207648_10079430
854 Ga0207676_10007081
855 Ga0207676_10087602
856 Ga0207674_10003389
857 Ga0207674_10040557
858 Ga0207674_10122319
859 Ga0207675_100011151
860 Ga0207675_100090416
861 Ga0207683_10034687
862 Ga0209974_10017927
863 Ga0207428_10022650
864 Ga0207428_10065559
865 Ga0268266_10285653
866 Ga0268265_10050532
867 Ga0268265_10173833
868 Ga0268264_10168353
869 Ga0265337_1001683
870 Ga0265337_1004002
871 Ga0265337_1009597
872 Ga0265337_1015556
873 Ga0265337_1020319
874 Ga0265337_1066231
875 Ga0265326_10003592
876 Ga0265334_10033283
877 Ga0265334_10040028
878 Ga0265323_10000147
879 Ga0265323_10030654
880 Ga0265323_10031374
881 Ga0265323_10043951
882 Ga0265336_10000776
883 Ga0265336_10058262
884 Ga0265338_10000208
885 Ga0265338_10000282
886 Ga0265338_10002054
887 Ga0265338_10002629
888 Ga0265338_10003122
889 Ga0265338_10005169
890 Ga0265338_10005911
891 Ga0265338_10007596
892 Ga0265338_10013151
893 Ga0265338_10046998
894 Ga0265338_10059100
895 Ga0265338_10104478
896 Ga0265338_10111680
897 Ga0265338_10118612
898 Ga0265338_10198541
899 Ga0265324_10000279
900 Ga0265324_10000455
901 Ga0265324_10004055
902 Ga0265324_10004924
903 Ga0265324_10010902
904 Ga0265324_10012171
905 Ga0265324_10012897
906 Ga0265324_10015474
907 Ga0265324_10019975
908 Ga0265324_10072503
909 Ga0265330_10023226
910 Ga0265320_10000378
911 Ga0265320_10007638
912 Ga0265320_10155561
913 Ga0265331_10070064
914 Ga0265331_10116319
915 Ga0265327_10001043
916 Ga0265327_10050065
917 Ga0265327_10126867
918 Ga0265316_10001466
919 Ga0265316_10018471
920 Ga0265316_10031614
921 Ga0265316_10053988
922 Ga0265316_10195092
923 Ga0265316_10214850
924 Ga0265314_10015190
925 Ga0265314_10028688
926 Ga0265314_10031061
927 Ga0316576_10000158
928 Ga0316576_10000489
929 Ga0373934_0075653
930 Ga0373954_0009821
931 Ga0373943_0016682
932 Ga0373946_0012410
933 Ga0373946_0126586
934 Ga0316574_0119645
935 Ga0373924_0080144
936 Ga0373935_0004792
937 Ga0373927_0011638
938 Ga0373927_0052848
939 Ga0373947_0003737
940 Ga0373947_0035643
941 Ga0373937_0010675
942 Ga0373937_0018069
943 Ga0373925_0005942
944 Ga0373925_0106429
945 Ga0436364_0266987
946 Ga0436365_1596478
947 Ga0436361_0408373
948 Ga0436363_0800850
949 Ga0450893_0032895
950 Ga0451577_0010144
951 Ga0451577_0013861
952 Ga0451577_0020750
953 Ga0451577_0202092
954 Ga0466963_0061094
955 Ga0453684_0002068
956 Ga0453684_0006549
957 Ga0453684_0020899
958 Ga0453684_0077114
959 Ga0453684_0096191
960 Ga0453684_0355444
961 Ga0466971_0029880
962 Ga0466957_0069296
963 Ga0451576_0010664
964 Ga0451576_0070922
965 Ga0451576_0104405
966 Ga0451576_0164129
967 Ga0451576_0169497
968 Ga0451576_0313586
969 Ga0451576_0369219
970 Ga0451576_0488861
971 Ga0451576_0901620
972 Ga0495592_0194191
973 Ga0495629_0008758
974 Ga0495580_0007065
975 Ga0495582_0003008
976 Ga0495662_0109302
977 Ga0495628_0013552
978 Ga0495628_0085662
979 Ga0495630_0031924
980 Ga0495630_0058802
981 Ga0495630_0145664
982 Ga0495630_0348812
983 Ga0495630_0352236
984 Ga0495666_0011845
985 Ga0495652_0249240
986 Ga0495665_0140754
987 Ga0495640_0038940
988 Ga0495586_0002871
989 Ga0495587_0101552
990 Ga0495621_0007103
991 Ga0495645_0048766
992 Ga0495633_0181075
993 Ga0495635_0165699
994 Ga0495657_0039281
995 Ga0495599_0158724
996 Ga0495658_0065782
997 Ga0495613_0015312
998 Ga0495674_0136140
999 Ga0495676_0036076
1000 Ga0495676_0121827
1001 Ga0495675_0116262
1002 Ga0495684_0093975
1003 Ga0495593_0034775
1004 Ga0496102_0082983
1005 Ga0496107_0049281
1006 Ga0496112_0002030
1007 Ga0496112_0176402
1008 Ga0501031_0000055
1009 Ga0501031_0033931
1010 Ga0501032_0038247
1011 Ga0501033_0002149
1012 Ga0501033_0006227
1013 Ga0501033_0017838
1014 Ga0501033_0018552
1015 Ga0501034_0004803
1016 Ga0501034_0005502
1017 Ga0501034_0045696
1018 Ga0501034_0071483
1019 Ga0501034_0413417
1020 Ga0501034_0430377
1021 Ga0501034_0480695
1022 Ga0501036_0020800
1023 Ga0501036_0088884
1024 Ga0501037_0001032
1025 Ga0501037_0016586
1026 Ga0501038_0003114
1027 Ga0501038_0095480
1028 Ga0501039_0028998
1029 Ga0501039_0042576
1030 Ga0501039_0050932
1031 Ga0501042_0058461
1032 Ga0501042_0085798
1033 Ga0501043_0001097
1034 Ga0501043_0005731
1035 Ga0501043_0009456
1036 Ga0501043_0030003
1037 Ga0501043_0043588
1038 Ga0501046_0021001
1039 Ga0501046_0022751
1040 Ga0501046_0116385
1041 Ga0501046_0189142
1042 Ga0501047_0000303
1043 Ga0501047_0003047
1044 Ga0501047_0005641
1045 Ga0501047_0073425
1046 Ga0501047_0140933
1047 Ga0501048_0000351
1048 Ga0501048_0022585
1049 Ga0501048_0031769
1050 Ga0501048_0100159
1051 Ga0501048_0284582
1052 Ga0501067_0004407
1053 Ga0501067_0024013
1054 Ga0501067_0030325
1055 Ga0501068_0014775
1056 Ga0501068_0019434
1057 Ga0501068_0063891
1058 Ga0501069_0030480
1059 Ga0501069_0044358
1060 Ga0501069_0073665
1061 Ga0501070_0014034
1062 Ga0501070_0055802
1063 Ga0501070_0064555
1064 Ga0501071_0015504
1065 Ga0501072_0187756
1066 Ga0501073_0001127
1067 Ga0501073_0007966
1068 Ga0501073_0011827
1069 Ga0501073_0014122
1070 Ga0501073_0031792
1071 Ga0501073_0033178
1072 Ga0501074_0003980
1073 Ga0501075_0446626
1074 Ga0501079_0023369
1075 Ga0501079_0084901
1076 Ga0501080_0027937
1077 Ga0501080_0028314
1078 Ga0501080_0082901
1079 Ga0501083_0025994
1080 Ga0501083_0028823
1081 Ga0501035_0029574
1082 Ga0501035_0042283
1083 Ga0501035_0042908
1084 Ga0501035_0229185
1085 Ga0501035_0350689
1086 Ga0501044_0000032
1087 Ga0501044_0037772
1088 Ga0501044_0057381
1089 Ga0501044_0064284
1090 Ga0501044_0068136
1091 Ga0501044_0322554
1092 Ga0501044_0377721
1093 Ga0501045_0080578
1094 nmdc:mga05p37_211327_c1
1095 nmdc:mga09592_822_c1
1096 nmdc:mga0qj67_167088_c1
1097 nmdc:mga06r32_133055_c1
1098 nmdc:mga06r32_250831_c1
1099 nmdc:mga06r32_30666_c1
1100 nmdc:mga06r32_95181_c1
1101 nmdc:mga08y16_200362_c1
1102 nmdc:mga0rr50_19645_c1
1103 nmdc:mga08x19_21857_c1
1104 Ga0501084_0012209
1105 Ga0501084_0020083
1106 Ga0501084_0038306
1107 Ga0501084_0182898
1108 Ga0587066_030654
1109 Ga0501082_0020196
1110 Ga0501082_0020958
1111 Ga0501082_0026684
1112 Ga0501082_0044758

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

33

114

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9339 6 261
6dg3-assembly1.cif.gz_K-2 lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.929 6 261
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.927 6 262
6dg3-assembly2.cif.gz_D lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9266 6 261
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.9239 6 262
ID Description Score Start End Superfamily
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.936 5 170 3.40.50.620
af_Q58240_5_163_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9247 5 170 3.40.50.620
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.752 4 177 3.40.50.620
3uz0C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Stage III sporulation protein AH-like 0.7495 195 262 1.10.287.4300
2dplA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7396 1 173 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A349K7C3-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.994 6 189 GO:0016783
AF-A0A350I4H1-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.9872 9 218 GO:0016783
AF-A0A383APJ5-F1-model_v4 NAD/GMP synthase domain-containing protein 0.9867 4 217 GO:0016783
AF-A0A354BF41-F1-model_v4 ATP-dependent sacrificial sulfur transferase LarE 0.983 1 206 GO:0004066
GO:0006529
GO:0016783
AF-A0A382P008-F1-model_v4 Asparagine synthetase domain-containing protein 0.9829 17 193 GO:0004066
GO:0006529
GO:0016783

Map