F463209

General Info

Members Datasets Scaffolds Average Seq Length
556 360 1112 154

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10193416|Ga0157380_101934162
Length 171
Sequence MSDRYEIAPPISIQEHSMSRPPLPPFTAEPAAQKVRLAEDGWNSRDPAKVALAYTPDSVWRNRAEFLQGRAAIEAVLTRKWGRELEYRLIKELWAFTGNRIAVRFAYEWHDDSGNWFRSYGNENWEFEADGLMRHRIASINDLPIAQADRKYHWPLGRRPDGHPGLSDLGL

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
192 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
193 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
272 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
289 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
292 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
293 2512875024
294 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
295 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
296 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
297 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
298 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
299 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
300 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
301 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
302 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
303 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
304 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
305 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
306 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
307 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
308 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
309 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
310 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
311 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
312 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
313 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
314 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
315 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
316 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
317 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
318 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
319 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
320 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
321 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
322 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
323 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
324 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
325 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
326 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
327 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
328 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
329 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
330 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
331 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
332 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
333 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
334 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
335 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
336 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
337 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
338 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
339 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
340 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
341 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
342 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
343 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
344 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
345 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
346 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
347 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
348 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
349 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
350 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
351 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
352 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
353 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
354 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
355 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
356 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
357 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
358 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
359 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
360 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.41
Metatranscriptomes 0
Isolates 12.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 10.43
Rhizoplane 5.4
Rhizosphere 75.36
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10193416 3300014326 Bacteria 1798
2 JGI24735J21928_10164319 3300002067 Bacteria 641
3 JGI24738J21930_10009252 3300002075 Bacteria 2222
4 Ga0055542_1000343 3300003762 Bacteria 49207
5 Ga0055529_1011581 3300003763 Bacteria 1135
6 Ga0070676_10001766 3300005328 Bacteria 10999
7 Ga0070676_10161604 3300005328 Bacteria 1442
8 Ga0070690_100014134 3300005330 Bacteria 4731
9 Ga0070670_100020159 3300005331 Bacteria 5728
10 Ga0068869_100018227 3300005334 Bacteria 4775
11 Ga0068869_100509171 3300005334 Bacteria 1006
12 Ga0070666_10001278 3300005335 Bacteria 15221
13 Ga0070666_10013594 3300005335 Bacteria 5169
14 Ga0070666_10881201 3300005335 Bacteria 661
15 Ga0070680_100018282 3300005336 Bacteria 5536
16 Ga0070682_100002453 3300005337 Bacteria 10242
17 Ga0068868_100068547 3300005338 Bacteria 2825
18 Ga0068868_100089349 3300005338 Bacteria 2480
19 Ga0068868_100611903 3300005338 Bacteria 966
20 Ga0070660_100003428 3300005339 Bacteria 10907
21 Ga0070660_100047578 3300005339 Bacteria 3292
22 Ga0070691_10002096 3300005341 Bacteria 8818
23 Ga0070687_100062496 3300005343 Bacteria 1972
24 Ga0070687_100884722 3300005343 Bacteria 639
25 Ga0070661_100436002 3300005344 Bacteria 1040
26 Ga0070692_10000327 3300005345 Bacteria 13720
27 Ga0070668_100002960 3300005347 Bacteria 12557
28 Ga0070668_101408060 3300005347 Bacteria 636
29 Ga0070669_100048669 3300005353 Bacteria 3095
30 Ga0070669_100371547 3300005353 Bacteria 1165
31 Ga0070669_101133944 3300005353 Bacteria 674
32 Ga0070675_100006229 3300005354 Bacteria 9150
33 Ga0070671_100019847 3300005355 Bacteria 5476
34 Ga0070674_100011040 3300005356 Bacteria 5481
35 Ga0070673_100067925 3300005364 Bacteria 2852
36 Ga0070688_100005650 3300005365 Bacteria 6601
37 Ga0070659_100023998 3300005366 Bacteria 4672
38 Ga0070667_100024325 3300005367 Bacteria 5030
39 Ga0070667_100075675 3300005367 Bacteria 2874
40 Ga0070703_10177746 3300005406 Bacteria 820
41 Ga0070709_10004115 3300005434 Bacteria 7844
42 Ga0070709_10025443 3300005434 Bacteria 3497
43 Ga0070714_100006341 3300005435 Bacteria 9121
44 Ga0070713_100150165 3300005436 Bacteria 2072
45 Ga0070713_100176497 3300005436 Bacteria 1917
46 Ga0070710_10003399 3300005437 Bacteria 7539
47 Ga0070701_10022326 3300005438 Bacteria 3032
48 Ga0070711_100005626 3300005439 Bacteria 7503
49 Ga0070711_100115161 3300005439 Bacteria 1979
50 Ga0070711_100394751 3300005439 Bacteria 1122
51 Ga0070705_100005427 3300005440 Bacteria 6212
52 Ga0070700_100091010 3300005441 Bacteria 1990
53 Ga0070700_101405606 3300005441 Bacteria 590
54 Ga0070694_100011405 3300005444 Bacteria 5503
55 Ga0070708_100186030 3300005445 Bacteria 1942
56 Ga0070663_100244557 3300005455 Bacteria 1418
57 Ga0070663_100302425 3300005455 Bacteria 1281
58 Ga0070663_100882434 3300005455 Bacteria 771
59 Ga0070662_100001370 3300005457 Bacteria 14974
60 Ga0070662_100002331 3300005457 Bacteria 11672
61 Ga0070681_10067898 3300005458 Bacteria 3533
62 Ga0070681_10111789 3300005458 Bacteria 2671
63 Ga0070681_10437236 3300005458 Bacteria 1220
64 Ga0068867_100018094 3300005459 Bacteria 5007
65 Ga0068867_100490227 3300005459 Bacteria 1054
66 Ga0070685_10036374 3300005466 Bacteria 2783
67 Ga0070706_100473237 3300005467 Bacteria 1165
68 Ga0070707_100025807 3300005468 Bacteria 5577
69 Ga0070707_101248858 3300005468 Bacteria 709
70 Ga0070698_100106762 3300005471 Bacteria 2768
71 Ga0070699_100123206 3300005518 Bacteria 2281
72 Ga0070679_100124567 3300005530 Bacteria 2560
73 Ga0070679_100384987 3300005530 Bacteria 1349
74 Ga0070684_100394274 3300005535 Bacteria 1276
75 Ga0070697_100012600 3300005536 Bacteria 6623
76 Ga0070697_100983846 3300005536 Bacteria 750
77 Ga0068853_100007887 3300005539 Bacteria 8538
78 Ga0068853_100176561 3300005539 Bacteria 1935
79 Ga0068853_100909417 3300005539 Bacteria 845
80 Ga0070672_100005844 3300005543 Bacteria 8208
81 Ga0070686_100044072 3300005544 Bacteria 2802
82 Ga0070695_100002099 3300005545 Bacteria 11411
83 Ga0070696_100012860 3300005546 Bacteria 5618
84 Ga0070693_100001183 3300005547 Bacteria 11732
85 Ga0070693_100899436 3300005547 Bacteria 663
86 Ga0070665_100000143 3300005548 Bacteria 133054
87 Ga0070665_100000949 3300005548 Bacteria 36967
88 Ga0070665_100051496 3300005548 Bacteria 4129
89 Ga0070665_100253764 3300005548 Bacteria 1759
90 Ga0070665_100502939 3300005548 Bacteria 1223
91 Ga0070665_101290894 3300005548 Bacteria 740
92 Ga0070704_100087499 3300005549 Bacteria 2312
93 Ga0068855_100030078 3300005563 Bacteria 6495
94 Ga0068855_100033590 3300005563 Bacteria 6121
95 Ga0068855_100052398 3300005563 Bacteria 4804
96 Ga0068855_100389575 3300005563 Bacteria 1529
97 Ga0068855_100787143 3300005563 Bacteria 1012
98 Ga0070664_100031096 3300005564 Bacteria 4457
99 Ga0070664_101614623 3300005564 Bacteria 614
100 Ga0068857_100032217 3300005577 Bacteria 4634
101 Ga0068857_100124760 3300005577 Bacteria 2320
102 Ga0068857_101384292 3300005577 Bacteria 684
103 Ga0068854_100004585 3300005578 Bacteria 8714
104 Ga0068854_100010287 3300005578 Bacteria 6063
105 Ga0068854_100458962 3300005578 Bacteria 1065
106 Ga0068854_100772699 3300005578 Bacteria 835
107 Ga0068856_100005159 3300005614 Bacteria 12896
108 Ga0068856_100035046 3300005614 Bacteria 4917
109 Ga0068856_101428914 3300005614 Bacteria 706
110 Ga0070702_100001546 3300005615 Bacteria 9477
111 Ga0068852_100016692 3300005616 Bacteria 5735
112 Ga0068852_100022493 3300005616 Bacteria 5056
113 Ga0068852_100106200 3300005616 Bacteria 2545
114 Ga0068852_100250096 3300005616 Bacteria 1698
115 Ga0068852_100352773 3300005616 Bacteria 1437
116 Ga0068859_100039390 3300005617 Bacteria 4741
117 Ga0068864_100089584 3300005618 Bacteria 2711
118 Ga0068861_100013222 3300005719 Bacteria 5774
119 Ga0068851_10012135 3300005834 Bacteria 4057
120 Ga0068851_10153870 3300005834 Bacteria 1259
121 Ga0068870_10098278 3300005840 Bacteria 1649
122 Ga0068863_100012615 3300005841 Bacteria 8152
123 Ga0068863_100273719 3300005841 Bacteria 1635
124 Ga0068858_100004863 3300005842 Bacteria 13176
125 Ga0068858_100004939 3300005842 Bacteria 13066
126 Ga0068858_100925011 3300005842 Bacteria 853
127 Ga0068860_100006650 3300005843 Bacteria 11609
128 Ga0068862_100009298 3300005844 Bacteria 8136
129 Ga0070717_11217329 3300006028 Bacteria 685
130 Ga0075365_10046570 3300006038 Bacteria 2849
131 Ga0075365_10728480 3300006038 Bacteria 700
132 Ga0070715_10002828 3300006163 Bacteria 5409
133 Ga0070716_100037619 3300006173 Bacteria 2675
134 Ga0070716_100584675 3300006173 Unclassified 838
135 Ga0070712_100082738 3300006175 Bacteria 2329
136 Ga0070712_100140443 3300006175 Bacteria 1842
137 Ga0075367_10014902 3300006178 Bacteria 4214
138 Ga0097621_100203222 3300006237 Bacteria 1721
139 Ga0075370_10005271 3300006353 Bacteria 6404
140 Ga0068871_100040161 3300006358 Bacteria 3747
141 Ga0075430_100591949 3300006846 Bacteria 915
142 Ga0075431_100958063 3300006847 Bacteria 824
143 Ga0075431_101307581 3300006847 Bacteria 686
144 Ga0075434_100078978 3300006871 Bacteria 3287
145 Ga0075434_101745221 3300006871 Bacteria 630
146 Ga0068865_100030795 3300006881 Bacteria 3572
147 Ga0068865_100045106 3300006881 Bacteria 3021
148 Ga0068865_100455495 3300006881 Bacteria 1059
149 Ga0075436_100000401 3300006914 Bacteria 27885
150 Ga0097620_100039389 3300006931 Bacteria 4741
151 Ga0105240_10002155 3300009093 Bacteria 32154
152 Ga0105240_10042253 3300009093 Bacteria 5810
153 Ga0105240_10042268 3300009093 Bacteria 5809
154 Ga0105240_10064780 3300009093 Bacteria 4539
155 Ga0105240_10239410 3300009093 Bacteria 2104
156 Ga0111539_11096887 3300009094 Bacteria 925
157 Ga0105245_10008398 3300009098 Bacteria 9020
158 Ga0105245_11925164 3300009098 Bacteria 644
159 Ga0105247_10009460 3300009101 Bacteria 5914
160 Ga0114129_10004052 3300009147 Bacteria 20681
161 Ga0114129_10199216 3300009147 Bacteria 2713
162 Ga0114129_10228516 3300009147 Bacteria 2507
163 Ga0105243_10002048 3300009148 Bacteria 17091
164 Ga0105241_10005402 3300009174 Bacteria 9445
165 Ga0105241_10178097 3300009174 Bacteria 1761
166 Ga0105242_10047189 3300009176 Bacteria 3497
167 Ga0105242_10327362 3300009176 Bacteria 1407
168 Ga0105248_10001024 3300009177 Bacteria 30912
169 Ga0105248_10444378 3300009177 Bacteria 1461
170 Ga0105248_10748149 3300009177 Bacteria 1103
171 Ga0105248_11701900 3300009177 Bacteria 715
172 Ga0105237_10004355 3300009545 Bacteria 16406
173 Ga0105237_10057910 3300009545 Bacteria 3877
174 Ga0105237_10159068 3300009545 Bacteria 2257
175 Ga0105238_10014990 3300009551 Bacteria 7847
176 Ga0105238_10130742 3300009551 Bacteria 2489
177 Ga0105249_10003828 3300009553 Bacteria 12982
178 Ga0105249_10092287 3300009553 Bacteria 2835
179 Ga0105239_10178376 3300010375 Bacteria 2376
180 Ga0105246_10010023 3300011119 Bacteria 5845
181 Ga0105246_10269570 3300011119 Bacteria 1360
182 Ga0157373_10050714 3300013100 Bacteria 2955
183 Ga0157371_10024695 3300013102 Bacteria 4385
184 Ga0157370_10102248 3300013104 Bacteria 2683
185 Ga0157370_10231920 3300013104 Bacteria 1708
186 Ga0157370_10424558 3300013104 Bacteria 1223
187 Ga0157369_10011857 3300013105 Bacteria 9900
188 Ga0157369_10031580 3300013105 Bacteria 5830
189 Ga0157369_10040731 3300013105 Bacteria 5071
190 Ga0157369_10393307 3300013105 Bacteria 1438
191 Ga0157369_11077031 3300013105 Bacteria 822
192 Ga0157374_10087917 3300013296 Bacteria 2959
193 Ga0157374_10122263 3300013296 Bacteria 2513
194 Ga0157374_10546296 3300013296 Bacteria 1166
195 Ga0157374_11162417 3300013296 Bacteria 793
196 Ga0157374_12791966 3300013296 Bacteria 516
197 Ga0157378_10010205 3300013297 Bacteria 8196
198 Ga0157372_10028531 3300013307 Bacteria 6091
199 Ga0157372_10045242 3300013307 Bacteria 4882
200 Ga0157375_10036326 3300013308 Bacteria 4712
201 Ga0163163_10011496 3300014325 Bacteria 8034
202 Ga0163163_10014200 3300014325 Bacteria 7316
203 Ga0157380_10013915 3300014326 Bacteria 5876
204 Ga0157380_10017387 3300014326 Bacteria 5322
205 Ga0157377_10009129 3300014745 Bacteria 4855
206 Ga0157377_10548677 3300014745 Bacteria 816
207 Ga0157379_10002372 3300014968 Bacteria 15742
208 Ga0157379_10205991 3300014968 Bacteria 1779
209 Ga0157379_10319493 3300014968 Bacteria 1417
210 Ga0157379_12659164 3300014968 Bacteria 502
211 Ga0157376_10013405 3300014969 Bacteria 6114
212 Ga0157376_10515202 3300014969 Bacteria 1178
213 Ga0182006_1038300 3300015261 Bacteria 1896
214 Ga0183369_1003 3300015685 Bacteria 726443
215 Ga0163161_10009287 3300017792 Bacteria 6803
216 Ga0213872_10003606 3300021361 Bacteria 8509
217 Ga0213872_10006369 3300021361 Bacteria 5941
218 Ga0213872_10007468 3300021361 Bacteria 5378
219 Ga0213872_10034617 3300021361 Bacteria 2311
220 Ga0213872_10088834 3300021361 Bacteria 1384
221 Ga0213872_10151245 3300021361 Bacteria 1014
222 Ga0213872_10330615 3300021361 Bacteria 628
223 Ga0213875_10213821 3300021388 Bacteria 908
224 Ga0209677_120818 3300025253 Bacteria 760
225 Ga0209148_1000069 3300025254 Bacteria 334444
226 Ga0209455_1000161 3300025272 Bacteria 117353
227 Ga0209758_1003632 3300025297 Bacteria 13781
228 Ga0209257_1002052 3300025304 Bacteria 21376
229 Ga0207697_10050145 3300025315 Bacteria 1723
230 Ga0207697_10198124 3300025315 Bacteria 883
231 Ga0207653_10194995 3300025885 Bacteria 762
232 Ga0207692_10041727 3300025898 Bacteria 2274
233 Ga0207692_10144661 3300025898 Bacteria 1355
234 Ga0207688_10002778 3300025901 Bacteria 9493
235 Ga0207680_10001576 3300025903 Bacteria 10740
236 Ga0207680_10106505 3300025903 Bacteria 1810
237 Ga0207647_10004184 3300025904 Bacteria 10700
238 Ga0207647_10016858 3300025904 Bacteria 4977
239 Ga0207647_10061098 3300025904 Bacteria 2301
240 Ga0207685_10013665 3300025905 Bacteria 2519
241 Ga0207645_10159081 3300025907 Bacteria 1477
242 Ga0207643_10737601 3300025908 Bacteria 637
243 Ga0207705_10067202 3300025909 Bacteria 2594
244 Ga0207654_10103976 3300025911 Bacteria 1755
245 Ga0207707_10673476 3300025912 Bacteria 870
246 Ga0207707_10726946 3300025912 Bacteria 832
247 Ga0207695_10009670 3300025913 Bacteria 11877
248 Ga0207695_10052945 3300025913 Bacteria 4249
249 Ga0207695_10173287 3300025913 Bacteria 2082
250 Ga0207695_10303103 3300025913 Bacteria 1489
251 Ga0207671_10074541 3300025914 Bacteria 2536
252 Ga0207693_10000935 3300025915 Bacteria 26217
253 Ga0207693_10090410 3300025915 Bacteria 2400
254 Ga0207693_10251257 3300025915 Bacteria 1387
255 Ga0207663_10379087 3300025916 Bacteria 1077
256 Ga0207660_10025587 3300025917 Bacteria 4008
257 Ga0207662_10002324 3300025918 Bacteria 9527
258 Ga0207657_10001282 3300025919 Bacteria 26750
259 Ga0207657_10058981 3300025919 Bacteria 3301
260 Ga0207657_10795109 3300025919 Bacteria 731
261 Ga0207649_10033417 3300025920 Bacteria 3073
262 Ga0207649_10543116 3300025920 Bacteria 888
263 Ga0207649_10616330 3300025920 Bacteria 836
264 Ga0207649_10935463 3300025920 Bacteria 680
265 Ga0207652_10322881 3300025921 Bacteria 1394
266 Ga0207646_10008138 3300025922 Bacteria 10550
267 Ga0207681_10807015 3300025923 Bacteria 784
268 Ga0207694_10074952 3300025924 Bacteria 2648
269 Ga0207694_10083506 3300025924 Bacteria 2512
270 Ga0207650_10105437 3300025925 Bacteria 2176
271 Ga0207650_10116853 3300025925 Bacteria 2072
272 Ga0207659_10020326 3300025926 Bacteria 4388
273 Ga0207687_10092165 3300025927 Bacteria 2212
274 Ga0207687_10686676 3300025927 Bacteria 868
275 Ga0207700_10348774 3300025928 Bacteria 1288
276 Ga0207700_10695724 3300025928 Bacteria 907
277 Ga0207664_10011425 3300025929 Bacteria 6312
278 Ga0207664_10033388 3300025929 Bacteria 3953
279 Ga0207706_10000247 3300025933 Bacteria 59079
280 Ga0207706_10004588 3300025933 Bacteria 12964
281 Ga0207706_10084067 3300025933 Bacteria 2798
282 Ga0207706_10302757 3300025933 Bacteria 1393
283 Ga0207706_10344685 3300025933 Bacteria 1296
284 Ga0207706_11334976 3300025933 Bacteria 591
285 Ga0207686_10066038 3300025934 Bacteria 2309
286 Ga0207709_10059896 3300025935 Bacteria 2372
287 Ga0207669_10022184 3300025937 Bacteria 3367
288 Ga0207704_10003522 3300025938 Bacteria 7125
289 Ga0207704_10045173 3300025938 Bacteria 2615
290 Ga0207665_10000262 3300025939 Bacteria 36575
291 Ga0207691_10008915 3300025940 Bacteria 9630
292 Ga0207691_10119987 3300025940 Bacteria 2332
293 Ga0207711_10045037 3300025941 Bacteria 3769
294 Ga0207711_11520710 3300025941 Bacteria 612
295 Ga0207689_10008603 3300025942 Bacteria 8887
296 Ga0207661_10148768 3300025944 Bacteria 2023
297 Ga0207679_10092841 3300025945 Bacteria 2339
298 Ga0207679_10479524 3300025945 Bacteria 1107
299 Ga0207667_10001254 3300025949 Bacteria 31816
300 Ga0207667_10046885 3300025949 Bacteria 4576
301 Ga0207667_10110760 3300025949 Bacteria 2832
302 Ga0207667_10188055 3300025949 Bacteria 2119
303 Ga0207651_10202014 3300025960 Bacteria 1593
304 Ga0207712_10000245 3300025961 Bacteria 53285
305 Ga0207668_10006151 3300025972 Bacteria 7080
306 Ga0207640_10008201 3300025981 Bacteria 5791
307 Ga0207640_10020818 3300025981 Bacteria 3898
308 Ga0207640_10248123 3300025981 Bacteria 1380
309 Ga0207640_10896810 3300025981 Bacteria 774
310 Ga0207677_10041629 3300026023 Bacteria 3039
311 Ga0207677_10748367 3300026023 Bacteria 871
312 Ga0207703_10003852 3300026035 Bacteria 12464
313 Ga0207703_10013073 3300026035 Bacteria 6470
314 Ga0207639_10003247 3300026041 Bacteria 10941
315 Ga0207639_10022379 3300026041 Bacteria 4553
316 Ga0207639_11585386 3300026041 Bacteria 614
317 Ga0207678_10069671 3300026067 Bacteria 3016
318 Ga0207678_10596542 3300026067 Bacteria 968
319 Ga0207708_10004287 3300026075 Bacteria 10500
320 Ga0207708_10607387 3300026075 Bacteria 927
321 Ga0207708_11353408 3300026075 Bacteria 624
322 Ga0207708_11533098 3300026075 Bacteria 586
323 Ga0207702_10055509 3300026078 Bacteria 3359
324 Ga0207702_10150979 3300026078 Bacteria 2113
325 Ga0207641_10201950 3300026088 Bacteria 1833
326 Ga0207648_10004871 3300026089 Bacteria 13686
327 Ga0207648_10092074 3300026089 Bacteria 2651
328 Ga0207676_10054307 3300026095 Bacteria 3139
329 Ga0207674_10003409 3300026116 Bacteria 19483
330 Ga0207674_10761869 3300026116 Bacteria 934
331 Ga0207674_10842683 3300026116 Bacteria 884
332 Ga0207675_100000047 3300026118 Bacteria 85113
333 Ga0207675_102421541 3300026118 Bacteria 537
334 Ga0207683_10000127 3300026121 Bacteria 62271
335 Ga0207683_10166314 3300026121 Bacteria 1996
336 Ga0207698_10041817 3300026142 Bacteria 3419
337 Ga0207698_10138969 3300026142 Bacteria 2089
338 Ga0207698_10175125 3300026142 Bacteria 1894
339 Ga0207428_10533293 3300027907 Bacteria 850
340 Ga0268266_10000006 3300028379 Bacteria 1410021
341 Ga0268266_10000150 3300028379 Bacteria 132906
342 Ga0268266_10000275 3300028379 Bacteria 85106
343 Ga0268266_10478270 3300028379 Bacteria 1187
344 Ga0268266_11107329 3300028379 Bacteria 766
345 Ga0268265_10717881 3300028380 Bacteria 967
346 Ga0268264_10878632 3300028381 Bacteria 899
347 Ga0307511_10006250 3300030521 Bacteria 12012
348 Ga0307511_10008979 3300030521 Bacteria 9975
349 Ga0307513_10328276 3300031456 Bacteria 1285
350 Ga0307408_100669561 3300031548 Bacteria 930
351 Ga0373930_0065487 3300034816 Bacteria 818
352 Ga0373948_0038975 3300034817 Bacteria 987
353 Ga0373938_0044345 3300034957 Bacteria 998
354 Ga0373929_0044553 3300035085 Bacteria 997
355 Ga0373932_0004898 3300035112 Bacteria 3155
356 Ga0373941_0344239 3300035115 Bacteria 605
357 Ga0373955_0110772 3300035172 Bacteria 1587
358 Ga0373942_0049863 3300035207 Bacteria 1170
359 Ga0373961_0028292 3300035241 Bacteria 1545
360 Ga0373962_0067352 3300035242 Bacteria 1063
361 Ga0316574_0026570 3300035398 Bacteria 3482
362 Ga0373931_0112143 3300035691 Bacteria 1549
363 Ga0373947_0691389 3300035725 Bacteria 696
364 Ga0373937_1683979 3300036401 Bacteria 581
365 Ga0316582_0742146 3300036647 Bacteria 674
366 Ga0316582_0799657 3300036647 Bacteria 646
367 Ga0373925_0178652 3300037068 Bacteria 1679
368 Ga0373925_0913855 3300037068 Bacteria 723
369 Ga0395899_0331465 3300037312 Bacteria 1023
370 Ga0395898_0000252 3300037466 Bacteria 132492
371 Ga0395905_1007814 3300037471 Bacteria 736
372 Ga0436364_0633122 3300037853 Bacteria 775
373 Ga0395901_0032990 3300038443 Bacteria 5342
374 Ga0436365_0115486 3300039437 Bacteria 562
375 Ga0436360_0569625 3300039438 Bacteria 575
376 Ga0436361_0210005 3300039447 Bacteria 7812
377 Ga0436361_0326437 3300039447 Bacteria 7750
378 Ga0436361_0416523 3300039447 Bacteria 1468
379 Ga0436361_0625481 3300039447 Bacteria 8506
380 Ga0436361_0705916 3300039447 Bacteria 2706
381 Ga0436361_0718690 3300039447 Bacteria 10851
382 Ga0436361_0832376 3300039447 Bacteria 3159
383 Ga0436361_0992750 3300039447 Bacteria 1823
384 Ga0436361_1162768 3300039447 Bacteria 946
385 Ga0436363_0073413 3300039450 Bacteria 863
386 Ga0436362_0939163 3300039453 Bacteria 830
387 Ga0451807_0905444 3300041486 Bacteria 1529
388 Ga0451843_0974761 3300041509 Bacteria 693
389 Ga0451853_1780405 3300041512 Bacteria 651
390 Ga0439446_0015178 3300042156 Bacteria 2135
391 Ga0450909_059413 3300042185 Bacteria 603
392 Ga0439434_0171353 3300042435 Bacteria 724
393 Ga0450918_085147 3300042531 Bacteria 606
394 Ga0466965_0186720 3300044683 Bacteria 1095
395 Ga0466966_0446267 3300044684 Bacteria 778
396 Ga0453684_0058104 3300044712 Bacteria 4999
397 Ga0466960_0280011 3300044901 Bacteria 934
398 Ga0495594_0650335 3300046499 Bacteria 597
399 Ga0495596_0420709 3300046500 Bacteria 521
400 Ga0495610_0000019 3300046512 Bacteria 351524
401 Ga0495610_0030172 3300046512 Bacteria 2845
402 Ga0495620_0020540 3300046515 Bacteria 3224
403 Ga0495643_0058234 3300046522 Bacteria 2056
404 Ga0495654_0018318 3300046530 Bacteria 3671
405 Ga0495621_0053297 3300046539 Bacteria 1452
406 Ga0495621_0272510 3300046539 Bacteria 696
407 Ga0495622_0239011 3300046557 Bacteria 801
408 Ga0495613_0529036 3300046689 Bacteria 791
409 Ga0495624_0366634 3300046690 Bacteria 866
410 Ga0495649_0005425 3300046694 Bacteria 8114
411 Ga0495649_0358785 3300046694 Bacteria 736
412 Ga0495672_0330522 3300047320 Bacteria 713
413 Ga0495676_0175373 3300047321 Bacteria 1506
414 Ga0495680_0030415 3300047322 Bacteria 4409
415 Ga0495679_157181 3300047446 Bacteria 609
416 Ga0495686_0271774 3300047472 Bacteria 945
417 Ga0495626_0036784 3300048091 Bacteria 2330
418 Ga0496100_0040923 3300048903 Bacteria 2951
419 Ga0496101_0156724 3300048904 Bacteria 1744
420 Ga0496101_0344407 3300048904 Bacteria 1171
421 Ga0496102_0198117 3300048905 Bacteria 1893
422 Ga0496102_0752934 3300048905 Bacteria 897
423 Ga0496103_0048461 3300048906 Bacteria 2625
424 Ga0496104_0026483 3300048907 Bacteria 5355
425 Ga0496104_0208210 3300048907 Bacteria 1867
426 Ga0496104_0500038 3300048907 Bacteria 1127
427 Ga0496105_0047479 3300048908 Bacteria 3543
428 Ga0496105_0228532 3300048908 Bacteria 1512
429 Ga0496106_0647293 3300048909 Bacteria 844
430 Ga0496107_0074752 3300048910 Bacteria 2465
431 Ga0496107_1050065 3300048910 Bacteria 590
432 Ga0496108_0007882 3300048911 Bacteria 8634
433 Ga0496108_0037013 3300048911 Bacteria 4062
434 Ga0496109_0009304 3300048912 Bacteria 8371
435 Ga0496109_0383090 3300048912 Bacteria 1328
436 Ga0496110_0155195 3300048913 Bacteria 2073
437 Ga0496112_0025714 3300048915 Bacteria 5653
438 Ga0496112_0043867 3300048915 Bacteria 4379
439 Ga0496113_0036046 3300048916 Bacteria 3622
440 Ga0496113_0102866 3300048916 Bacteria 2215
441 Ga0496113_0183808 3300048916 Bacteria 1657
442 Ga0496114_0015989 3300048917 Bacteria 6038
443 Ga0496114_0086348 3300048917 Bacteria 2659
444 Ga0496115_0009437 3300048918 Bacteria 7249
445 Ga0496115_0032454 3300048918 Bacteria 4119
446 Ga0496115_0617472 3300048918 Bacteria 860
447 Ga0496120_0032148 3300048923 Bacteria 3167
448 Ga0496122_0224880 3300048925 Bacteria 1073
449 Ga0496124_0136965 3300048927 Bacteria 1937
450 Ga0496125_0001879 3300048928 Bacteria 28856
451 Ga0496125_0121746 3300048928 Bacteria 1859
452 Ga0496125_0438078 3300048928 Bacteria 752
453 Ga0496126_0064370 3300048929 Bacteria 3285
454 Ga0496126_1371574 3300048929 Bacteria 511
455 Ga0501298_057944 3300049521 Bacteria 815
456 Ga0501033_0513656 3300049570 Unclassified 828
457 Ga0501034_0711082 3300049571 Bacteria 903
458 Ga0501037_0374943 3300049573 Bacteria 979
459 Ga0501073_0085787 3300049589 Bacteria 2190
460 Ga0501073_0466586 3300049589 Bacteria 873
461 Ga0501217_033007 3300049661 Bacteria 1284
462 Ga0501253_081393 3300049683 Bacteria 731
463 Ga0501283_015325 3300049779 Bacteria 1179
464 nmdc:mga0yw44_450685_c1 3300050492 Bacteria 872
465 nmdc:mga0yw44_68456_c1 3300050492 Bacteria 2196
466 nmdc:mga06z11_667584_c1 3300050494 Bacteria 633
467 nmdc:mga04h51_486127_c1 3300050495 Bacteria 526
468 nmdc:mga07m45_50450_c1 3300050496 Bacteria 2345
469 nmdc:mga05p37_69776_c1 3300050507 Bacteria 4323
470 nmdc:mga05p37_857009_c1 3300050507 Bacteria 986
471 nmdc:mga0qj67_507071_c1 3300050509 Bacteria 970
472 nmdc:mga06r32_551598_c1 3300050510 Bacteria 1126
473 nmdc:mga08y16_780116_c1 3300050511 Bacteria 950
474 nmdc:mga0n895_1602853_c1 3300050512 Bacteria 615
475 nmdc:mga0sz30_197461_c1 3300050516 Bacteria 893
476 Ga0495601_0001123 3300053077 Bacteria 14673
477 Ga0495601_0173235 3300053077 Bacteria 1411
478 Ga0500610_0008970 3300053079 Bacteria 4395
479 Ga0495655_0011541 3300053083 Bacteria 1778
480 Ga0495595_0071336 3300053084 Bacteria 1642
481 Ga0495619_0006046 3300053085 Bacteria 7667
482 Ga0500562_010485 3300053108 Bacteria 2348
483 Ga0500595_005040 3300053119 Bacteria 5810
484 Ga0500595_076000 3300053119 Bacteria 990
485 Ga0500658_0081365 3300053134 Bacteria 1386
486 Ga0500588_0078614 3300053146 Bacteria 1098
487 2509394528 2509276022 Bacteria 6200534
488 2512961013 2512875024 Bacteria 7195110
489 2643950413 2643221588 Bacteria 3692460
490 2687582164 2687453130 Bacteria 4227172
491 2694628369 2693429783 Bacteria 7019804
492 2694640774 2693429784 Bacteria 7241525
493 2791925245 2791354903 Bacteria 4937680
494 2829747326 2829745981 Bacteria 5406054
495 2856328843 2856328259 Bacteria 6528202
496 2856357251 2856356410 Bacteria 6297484
497 2869273856 2869271264 Bacteria 6908218
498 2869285797 2869278585 Bacteria 7077053
499 2871441829 2871435913 Bacteria 6880295
500 2871490934 2871488783 Bacteria 6929816
501 2874167611 2874162495 Bacteria 6174670
502 2876371608 2876369609 Bacteria 6807521
503 2876377143 2876369609 Bacteria 6807521
504 2876405879 2876399893 Bacteria 6927900
505 2876408712 2876406927 Bacteria 6191900
506 2878739372 2878738818 Bacteria 7136951
507 2878755338 2878753008 Bacteria 6922523
508 2878780960 2878774303 Bacteria 6108671
509 2878786200 2878781027 Bacteria 6834456
510 2881849869 2881845957 Bacteria 6611900
511 2881862159 2881861095 Bacteria 7128710
512 2882916073 2882912400 Bacteria 6801539
513 2888337975 2888337043 Bacteria 6629336
514 2894417353 2894414249 Bacteria 4405451
515 2903499181 2903492973 Bacteria 13473544
516 2906386841 2906386501 Bacteria 5977019
517 2906411392 2906408224 Bacteria 6162342
518 2922155733 2922151315 Bacteria 6902399
519 2922173332 2922172374 Bacteria 6167644
520 2922179043 2922178524 Bacteria 6025201
521 2924721343 2924718760 Bacteria 6331356
522 2924749846 2924748358 Bacteria 6154725
523 2924763096 2924762789 Bacteria 6561353
524 2924776893 2924776078 Bacteria 7492003
525 2924791679 2924784321 Bacteria 7416538
526 2958041813 2958034702 Bacteria 6989922
527 2958050344 2958041894 Bacteria 13082850
528 2958092691 2958092219 Bacteria 6861151
529 2958141949 2958137437 Bacteria 6050276
530 2958147756 2958144490 Bacteria 6677056
531 2958163914 2958158011 Bacteria 6058449
532 2961172341 2961170736 Bacteria 7072258
533 2965025683 2965025482 Bacteria 6532201
534 2965054951 2965047637 Bacteria 6623551
535 2965109791 2965102966 Bacteria 6800987
536 2965111870 2965110997 Bacteria 6693150
537 2968001272 2967996073 Bacteria 6787468
538 2968007325 2968003550 Bacteria 6929263
539 2968016690 2968016561 Bacteria 7022047
540 2970470032 2970469710 Bacteria 6969209
541 2970504936 2970503327 Bacteria 7099517
542 2970515173 2970510686 Bacteria 7006402
543 2970552763 2970547951 Bacteria 6931819
544 2970600414 2970593180 Bacteria 7073582
545 2977824478 2977821940 Bacteria 6906439
546 2977836353 2977828996 Bacteria 7007971
547 2977940530 2977935797 Bacteria 6252826
548 2979796051 2979793036 Bacteria 6808957
549 2979809574 2979808191 Bacteria 7179355
550 2987647239 2987645492 Bacteria 6117018
551 2987667181 2987666974 Bacteria 6509233
552 2987679812 2987673487 Bacteria 6884027
553 2996389656 2996386984 Bacteria 6978667
554 3004336201 3004334049 Bacteria 8449246
555 8004302119 8004300914 Bacteria 6132239
556 8004376918 8004374579 Bacteria 6898112
557 Ga0157380_10193416
558 JGI24735J21928_10164319
559 JGI24738J21930_10009252
560 Ga0055542_1000343
561 Ga0055529_1011581
562 Ga0070676_10001766
563 Ga0070676_10161604
564 Ga0070690_100014134
565 Ga0070670_100020159
566 Ga0068869_100018227
567 Ga0068869_100509171
568 Ga0070666_10001278
569 Ga0070666_10013594
570 Ga0070666_10881201
571 Ga0070680_100018282
572 Ga0070682_100002453
573 Ga0068868_100068547
574 Ga0068868_100089349
575 Ga0068868_100611903
576 Ga0070660_100003428
577 Ga0070660_100047578
578 Ga0070691_10002096
579 Ga0070687_100062496
580 Ga0070687_100884722
581 Ga0070661_100436002
582 Ga0070692_10000327
583 Ga0070668_100002960
584 Ga0070668_101408060
585 Ga0070669_100048669
586 Ga0070669_100371547
587 Ga0070669_101133944
588 Ga0070675_100006229
589 Ga0070671_100019847
590 Ga0070674_100011040
591 Ga0070673_100067925
592 Ga0070688_100005650
593 Ga0070659_100023998
594 Ga0070667_100024325
595 Ga0070667_100075675
596 Ga0070703_10177746
597 Ga0070709_10004115
598 Ga0070709_10025443
599 Ga0070714_100006341
600 Ga0070713_100150165
601 Ga0070713_100176497
602 Ga0070710_10003399
603 Ga0070701_10022326
604 Ga0070711_100005626
605 Ga0070711_100115161
606 Ga0070711_100394751
607 Ga0070705_100005427
608 Ga0070700_100091010
609 Ga0070700_101405606
610 Ga0070694_100011405
611 Ga0070708_100186030
612 Ga0070663_100244557
613 Ga0070663_100302425
614 Ga0070663_100882434
615 Ga0070662_100001370
616 Ga0070662_100002331
617 Ga0070681_10067898
618 Ga0070681_10111789
619 Ga0070681_10437236
620 Ga0068867_100018094
621 Ga0068867_100490227
622 Ga0070685_10036374
623 Ga0070706_100473237
624 Ga0070707_100025807
625 Ga0070707_101248858
626 Ga0070698_100106762
627 Ga0070699_100123206
628 Ga0070679_100124567
629 Ga0070679_100384987
630 Ga0070684_100394274
631 Ga0070697_100012600
632 Ga0070697_100983846
633 Ga0068853_100007887
634 Ga0068853_100176561
635 Ga0068853_100909417
636 Ga0070672_100005844
637 Ga0070686_100044072
638 Ga0070695_100002099
639 Ga0070696_100012860
640 Ga0070693_100001183
641 Ga0070693_100899436
642 Ga0070665_100000143
643 Ga0070665_100000949
644 Ga0070665_100051496
645 Ga0070665_100253764
646 Ga0070665_100502939
647 Ga0070665_101290894
648 Ga0070704_100087499
649 Ga0068855_100030078
650 Ga0068855_100033590
651 Ga0068855_100052398
652 Ga0068855_100389575
653 Ga0068855_100787143
654 Ga0070664_100031096
655 Ga0070664_101614623
656 Ga0068857_100032217
657 Ga0068857_100124760
658 Ga0068857_101384292
659 Ga0068854_100004585
660 Ga0068854_100010287
661 Ga0068854_100458962
662 Ga0068854_100772699
663 Ga0068856_100005159
664 Ga0068856_100035046
665 Ga0068856_101428914
666 Ga0070702_100001546
667 Ga0068852_100016692
668 Ga0068852_100022493
669 Ga0068852_100106200
670 Ga0068852_100250096
671 Ga0068852_100352773
672 Ga0068859_100039390
673 Ga0068864_100089584
674 Ga0068861_100013222
675 Ga0068851_10012135
676 Ga0068851_10153870
677 Ga0068870_10098278
678 Ga0068863_100012615
679 Ga0068863_100273719
680 Ga0068858_100004863
681 Ga0068858_100004939
682 Ga0068858_100925011
683 Ga0068860_100006650
684 Ga0068862_100009298
685 Ga0070717_11217329
686 Ga0075365_10046570
687 Ga0075365_10728480
688 Ga0070715_10002828
689 Ga0070716_100037619
690 Ga0070716_100584675
691 Ga0070712_100082738
692 Ga0070712_100140443
693 Ga0075367_10014902
694 Ga0097621_100203222
695 Ga0075370_10005271
696 Ga0068871_100040161
697 Ga0075430_100591949
698 Ga0075431_100958063
699 Ga0075431_101307581
700 Ga0075434_100078978
701 Ga0075434_101745221
702 Ga0068865_100030795
703 Ga0068865_100045106
704 Ga0068865_100455495
705 Ga0075436_100000401
706 Ga0097620_100039389
707 Ga0105240_10002155
708 Ga0105240_10042253
709 Ga0105240_10042268
710 Ga0105240_10064780
711 Ga0105240_10239410
712 Ga0111539_11096887
713 Ga0105245_10008398
714 Ga0105245_11925164
715 Ga0105247_10009460
716 Ga0114129_10004052
717 Ga0114129_10199216
718 Ga0114129_10228516
719 Ga0105243_10002048
720 Ga0105241_10005402
721 Ga0105241_10178097
722 Ga0105242_10047189
723 Ga0105242_10327362
724 Ga0105248_10001024
725 Ga0105248_10444378
726 Ga0105248_10748149
727 Ga0105248_11701900
728 Ga0105237_10004355
729 Ga0105237_10057910
730 Ga0105237_10159068
731 Ga0105238_10014990
732 Ga0105238_10130742
733 Ga0105249_10003828
734 Ga0105249_10092287
735 Ga0105239_10178376
736 Ga0105246_10010023
737 Ga0105246_10269570
738 Ga0157373_10050714
739 Ga0157371_10024695
740 Ga0157370_10102248
741 Ga0157370_10231920
742 Ga0157370_10424558
743 Ga0157369_10011857
744 Ga0157369_10031580
745 Ga0157369_10040731
746 Ga0157369_10393307
747 Ga0157369_11077031
748 Ga0157374_10087917
749 Ga0157374_10122263
750 Ga0157374_10546296
751 Ga0157374_11162417
752 Ga0157374_12791966
753 Ga0157378_10010205
754 Ga0157372_10028531
755 Ga0157372_10045242
756 Ga0157375_10036326
757 Ga0163163_10011496
758 Ga0163163_10014200
759 Ga0157380_10013915
760 Ga0157380_10017387
761 Ga0157377_10009129
762 Ga0157377_10548677
763 Ga0157379_10002372
764 Ga0157379_10205991
765 Ga0157379_10319493
766 Ga0157379_12659164
767 Ga0157376_10013405
768 Ga0157376_10515202
769 Ga0182006_1038300
770 Ga0183369_1003
771 Ga0163161_10009287
772 Ga0213872_10003606
773 Ga0213872_10006369
774 Ga0213872_10007468
775 Ga0213872_10034617
776 Ga0213872_10088834
777 Ga0213872_10151245
778 Ga0213872_10330615
779 Ga0213875_10213821
780 Ga0209677_120818
781 Ga0209148_1000069
782 Ga0209455_1000161
783 Ga0209758_1003632
784 Ga0209257_1002052
785 Ga0207697_10050145
786 Ga0207697_10198124
787 Ga0207653_10194995
788 Ga0207692_10041727
789 Ga0207692_10144661
790 Ga0207688_10002778
791 Ga0207680_10001576
792 Ga0207680_10106505
793 Ga0207647_10004184
794 Ga0207647_10016858
795 Ga0207647_10061098
796 Ga0207685_10013665
797 Ga0207645_10159081
798 Ga0207643_10737601
799 Ga0207705_10067202
800 Ga0207654_10103976
801 Ga0207707_10673476
802 Ga0207707_10726946
803 Ga0207695_10009670
804 Ga0207695_10052945
805 Ga0207695_10173287
806 Ga0207695_10303103
807 Ga0207671_10074541
808 Ga0207693_10000935
809 Ga0207693_10090410
810 Ga0207693_10251257
811 Ga0207663_10379087
812 Ga0207660_10025587
813 Ga0207662_10002324
814 Ga0207657_10001282
815 Ga0207657_10058981
816 Ga0207657_10795109
817 Ga0207649_10033417
818 Ga0207649_10543116
819 Ga0207649_10616330
820 Ga0207649_10935463
821 Ga0207652_10322881
822 Ga0207646_10008138
823 Ga0207681_10807015
824 Ga0207694_10074952
825 Ga0207694_10083506
826 Ga0207650_10105437
827 Ga0207650_10116853
828 Ga0207659_10020326
829 Ga0207687_10092165
830 Ga0207687_10686676
831 Ga0207700_10348774
832 Ga0207700_10695724
833 Ga0207664_10011425
834 Ga0207664_10033388
835 Ga0207706_10000247
836 Ga0207706_10004588
837 Ga0207706_10084067
838 Ga0207706_10302757
839 Ga0207706_10344685
840 Ga0207706_11334976
841 Ga0207686_10066038
842 Ga0207709_10059896
843 Ga0207669_10022184
844 Ga0207704_10003522
845 Ga0207704_10045173
846 Ga0207665_10000262
847 Ga0207691_10008915
848 Ga0207691_10119987
849 Ga0207711_10045037
850 Ga0207711_11520710
851 Ga0207689_10008603
852 Ga0207661_10148768
853 Ga0207679_10092841
854 Ga0207679_10479524
855 Ga0207667_10001254
856 Ga0207667_10046885
857 Ga0207667_10110760
858 Ga0207667_10188055
859 Ga0207651_10202014
860 Ga0207712_10000245
861 Ga0207668_10006151
862 Ga0207640_10008201
863 Ga0207640_10020818
864 Ga0207640_10248123
865 Ga0207640_10896810
866 Ga0207677_10041629
867 Ga0207677_10748367
868 Ga0207703_10003852
869 Ga0207703_10013073
870 Ga0207639_10003247
871 Ga0207639_10022379
872 Ga0207639_11585386
873 Ga0207678_10069671
874 Ga0207678_10596542
875 Ga0207708_10004287
876 Ga0207708_10607387
877 Ga0207708_11353408
878 Ga0207708_11533098
879 Ga0207702_10055509
880 Ga0207702_10150979
881 Ga0207641_10201950
882 Ga0207648_10004871
883 Ga0207648_10092074
884 Ga0207676_10054307
885 Ga0207674_10003409
886 Ga0207674_10761869
887 Ga0207674_10842683
888 Ga0207675_100000047
889 Ga0207675_102421541
890 Ga0207683_10000127
891 Ga0207683_10166314
892 Ga0207698_10041817
893 Ga0207698_10138969
894 Ga0207698_10175125
895 Ga0207428_10533293
896 Ga0268266_10000006
897 Ga0268266_10000150
898 Ga0268266_10000275
899 Ga0268266_10478270
900 Ga0268266_11107329
901 Ga0268265_10717881
902 Ga0268264_10878632
903 Ga0307511_10006250
904 Ga0307511_10008979
905 Ga0307513_10328276
906 Ga0307408_100669561
907 Ga0373930_0065487
908 Ga0373948_0038975
909 Ga0373938_0044345
910 Ga0373929_0044553
911 Ga0373932_0004898
912 Ga0373941_0344239
913 Ga0373955_0110772
914 Ga0373942_0049863
915 Ga0373961_0028292
916 Ga0373962_0067352
917 Ga0316574_0026570
918 Ga0373931_0112143
919 Ga0373947_0691389
920 Ga0373937_1683979
921 Ga0316582_0742146
922 Ga0316582_0799657
923 Ga0373925_0178652
924 Ga0373925_0913855
925 Ga0395899_0331465
926 Ga0395898_0000252
927 Ga0395905_1007814
928 Ga0436364_0633122
929 Ga0395901_0032990
930 Ga0436365_0115486
931 Ga0436360_0569625
932 Ga0436361_0210005
933 Ga0436361_0326437
934 Ga0436361_0416523
935 Ga0436361_0625481
936 Ga0436361_0705916
937 Ga0436361_0718690
938 Ga0436361_0832376
939 Ga0436361_0992750
940 Ga0436361_1162768
941 Ga0436363_0073413
942 Ga0436362_0939163
943 Ga0451807_0905444
944 Ga0451843_0974761
945 Ga0451853_1780405
946 Ga0439446_0015178
947 Ga0450909_059413
948 Ga0439434_0171353
949 Ga0450918_085147
950 Ga0466965_0186720
951 Ga0466966_0446267
952 Ga0453684_0058104
953 Ga0466960_0280011
954 Ga0495594_0650335
955 Ga0495596_0420709
956 Ga0495610_0000019
957 Ga0495610_0030172
958 Ga0495620_0020540
959 Ga0495643_0058234
960 Ga0495654_0018318
961 Ga0495621_0053297
962 Ga0495621_0272510
963 Ga0495622_0239011
964 Ga0495613_0529036
965 Ga0495624_0366634
966 Ga0495649_0005425
967 Ga0495649_0358785
968 Ga0495672_0330522
969 Ga0495676_0175373
970 Ga0495680_0030415
971 Ga0495679_157181
972 Ga0495686_0271774
973 Ga0495626_0036784
974 Ga0496100_0040923
975 Ga0496101_0156724
976 Ga0496101_0344407
977 Ga0496102_0198117
978 Ga0496102_0752934
979 Ga0496103_0048461
980 Ga0496104_0026483
981 Ga0496104_0208210
982 Ga0496104_0500038
983 Ga0496105_0047479
984 Ga0496105_0228532
985 Ga0496106_0647293
986 Ga0496107_0074752
987 Ga0496107_1050065
988 Ga0496108_0007882
989 Ga0496108_0037013
990 Ga0496109_0009304
991 Ga0496109_0383090
992 Ga0496110_0155195
993 Ga0496112_0025714
994 Ga0496112_0043867
995 Ga0496113_0036046
996 Ga0496113_0102866
997 Ga0496113_0183808
998 Ga0496114_0015989
999 Ga0496114_0086348
1000 Ga0496115_0009437
1001 Ga0496115_0032454
1002 Ga0496115_0617472
1003 Ga0496120_0032148
1004 Ga0496122_0224880
1005 Ga0496124_0136965
1006 Ga0496125_0001879
1007 Ga0496125_0121746
1008 Ga0496125_0438078
1009 Ga0496126_0064370
1010 Ga0496126_1371574
1011 Ga0501298_057944
1012 Ga0501033_0513656
1013 Ga0501034_0711082
1014 Ga0501037_0374943
1015 Ga0501073_0085787
1016 Ga0501073_0466586
1017 Ga0501217_033007
1018 Ga0501253_081393
1019 Ga0501283_015325
1020 nmdc:mga0yw44_450685_c1
1021 nmdc:mga0yw44_68456_c1
1022 nmdc:mga06z11_667584_c1
1023 nmdc:mga04h51_486127_c1
1024 nmdc:mga07m45_50450_c1
1025 nmdc:mga05p37_69776_c1
1026 nmdc:mga05p37_857009_c1
1027 nmdc:mga0qj67_507071_c1
1028 nmdc:mga06r32_551598_c1
1029 nmdc:mga08y16_780116_c1
1030 nmdc:mga0n895_1602853_c1
1031 nmdc:mga0sz30_197461_c1
1032 Ga0495601_0001123
1033 Ga0495601_0173235
1034 Ga0500610_0008970
1035 Ga0495655_0011541
1036 Ga0495595_0071336
1037 Ga0495619_0006046
1038 Ga0500562_010485
1039 Ga0500595_005040
1040 Ga0500595_076000
1041 Ga0500658_0081365
1042 Ga0500588_0078614
1043 2509394528
1044 2512961013
1045 2643950413
1046 2687582164
1047 2694628369
1048 2694640774
1049 2791925245
1050 2829747326
1051 2856328843
1052 2856357251
1053 2869273856
1054 2869285797
1055 2871441829
1056 2871490934
1057 2874167611
1058 2876371608
1059 2876377143
1060 2876405879
1061 2876408712
1062 2878739372
1063 2878755338
1064 2878780960
1065 2878786200
1066 2881849869
1067 2881862159
1068 2882916073
1069 2888337975
1070 2894417353
1071 2903499181
1072 2906386841
1073 2906411392
1074 2922155733
1075 2922173332
1076 2922179043
1077 2924721343
1078 2924749846
1079 2924763096
1080 2924776893
1081 2924791679
1082 2958041813
1083 2958050344
1084 2958092691
1085 2958141949
1086 2958147756
1087 2958163914
1088 2961172341
1089 2965025683
1090 2965054951
1091 2965109791
1092 2965111870
1093 2968001272
1094 2968007325
1095 2968016690
1096 2970470032
1097 2970504936
1098 2970515173
1099 2970552763
1100 2970600414
1101 2977824478
1102 2977836353
1103 2977940530
1104 2979796051
1105 2979809574
1106 2987647239
1107 2987667181
1108 2987679812
1109 2996389656
1110 3004336201
1111 8004302119
1112 8004376918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

24

153

0.99

PF12680

SnoaL_2

SnoaL-like domain

35

136

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9943 3 150
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9556 3 150
6f4y-assembly2.cif.gz_B crystal structure of ketosteroid isomerase variant d103s 0.8885 10 121
6c1j-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase y32f/y57f/d40n mutant from pseudomonas putida (pksi) bound to 3,4-dinitrophenol 0.885 10 121
7ry4-assembly1.cif.gz_A multi-conformer model of ketosteroid isomerase y57f/d40n mutant from pseudomonas putida (pksi) bound to a transition state analog at 250 k 0.8788 10 124
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9993 10 150 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9852 10 150 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8979 37 124 3.10.450.50
5aigB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8662 14 124 3.10.450.50
3ebtA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8622 14 124 3.10.450.50
ID Description Score Start End GO Terms
AF-J8V0J8-F1-model_v4 deleted 1.005 66 154
AF-A0A1H7CD02-F1-model_v4 DUF1348 domain-containing protein 1.004 58 154
AF-A0A512HQ28-F1-model_v4 50S ribosomal protein L21 1.004 53 154
AF-A0A6P0YZ24-F1-model_v4 Nuclear transport factor 2 family protein 1.003 16 154
AF-A0A1J5SV73-F1-model_v4 SnoaL-like domain protein 1.003 16 154

Map