F463130

General Info

Members Datasets Scaffolds Average Seq Length
555 337 539 220

Family's Representative Sequence

Representative Sequence 3300041505|Ga0451849_1366099|Ga0451849_1366099_534_1325
Length 263
Sequence LSKQCSGIIFKSLNDIAESGNTINKEDQQTVLINVIILDNHYMKIKAIITGASGMVGEGVLHECLLHPDVEEVLVIGRRTAGVIHPKLKEILHSDFFDLSAVKDQLKGYNACFFCLGVSSVGMNEKDYHHLTYDLTMHMATILADQDPDMTFCYVSGAGTDSSEHGKMMWARVKGQTENDLMRLPFKAAYMFRPGFMRPTKGLKNTLKGYKFIAWLYPVLRPMFPKFISTLQELGLAMINAAVKGYDKRVLEVKDIVKLAHTA

Samples

Sample ID Description Type Environment
1 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
2 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
5 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
6 2818991444 Filimonas endophytica 3197 Isolate Unclassified
7 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
8 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
9 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
10 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
11 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
12 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
13 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
14 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
15 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
16 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
193 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
223 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
224 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
225 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
226 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
294 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
295 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
296 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
297 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
298 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
299 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
313 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
318 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
319 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
320 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
321 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
322 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
323 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
324 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
327 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
328 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
329 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
330 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
331 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
334 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
335 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
336 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.29
Nodule 0.18
Rhizoplane 1.62
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1016866 3300002705 Bacteria 1406
2 JGI25406J46586_10013534 3300003203 Bacteria 3499
3 rootH1_10007168 3300003316 Bacteria 12241
4 rootH2_10010421 3300003320 Bacteria 28080
5 rootH2_10094573 3300003320 Unclassified 1132
6 rootL2_10035743 3300003322 Bacteria 3231
7 rootL2_10061803 3300003322 Bacteria 7572
8 rootL2_10195108 3300003322 Unclassified 3695
9 rootL2_10206004 3300003322 Bacteria 4426
10 rootH1_10312291 3300003323 Bacteria 1808
11 Ga0055535_1000403 3300003761 Bacteria 40654
12 Ga0055529_1000195 3300003763 Bacteria 82315
13 Ga0055531_10000354 3300003794 Bacteria 44915
14 Ga0065712_10013630 3300005290 Bacteria 1970
15 Ga0065715_10089350 3300005293 Bacteria 10967
16 Ga0070658_10063567 3300005327 Bacteria 3009
17 Ga0070683_100083755 3300005329 Bacteria 2987
18 Ga0070670_100009312 3300005331 Bacteria 8390
19 Ga0070670_100377202 3300005331 Bacteria 1249
20 Ga0068869_100026153 3300005334 Unclassified 4060
21 Ga0068869_100252278 3300005334 Bacteria 1409
22 Ga0070666_10026815 3300005335 Unclassified 3768
23 Ga0068868_100034831 3300005338 Unclassified 3889
24 Ga0068868_100120953 3300005338 Bacteria 2135
25 Ga0068868_100419821 3300005338 Bacteria 1158
26 Ga0070660_100082318 3300005339 Bacteria 2527
27 Ga0070689_100000405 3300005340 Bacteria 25370
28 Ga0070689_100475685 3300005340 Bacteria 1066
29 Ga0070669_100066337 3300005353 Bacteria 2660
30 Ga0070669_100670907 3300005353 Bacteria 873
31 Ga0070675_100395322 3300005354 Bacteria 1232
32 Ga0070675_100404420 3300005354 Bacteria 1218
33 Ga0070675_100884961 3300005354 Bacteria 818
34 Ga0070671_100014853 3300005355 Bacteria 6291
35 Ga0070671_100127533 3300005355 Bacteria 2142
36 Ga0070674_100000708 3300005356 Bacteria 16973
37 Ga0070673_100003821 3300005364 Bacteria 9450
38 Ga0070673_100030671 3300005364 Bacteria 4028
39 Ga0070673_100114620 3300005364 Bacteria 2240
40 Ga0070673_100579038 3300005364 Bacteria 1022
41 Ga0070688_100000683 3300005365 Bacteria 16890
42 Ga0070688_100087414 3300005365 Bacteria 2030
43 Ga0070688_100134287 3300005365 Bacteria 1673
44 Ga0070659_100247317 3300005366 Bacteria 1477
45 Ga0070667_100007792 3300005367 Bacteria 8878
46 Ga0070667_100025827 3300005367 Bacteria 4885
47 Ga0070709_10003881 3300005434 Bacteria 8057
48 Ga0070714_100000097 3300005435 Bacteria 74184
49 Ga0070714_100774609 3300005435 Bacteria 928
50 Ga0070713_100000967 3300005436 Bacteria 18403
51 Ga0070710_10036855 3300005437 Bacteria 2676
52 Ga0070710_10076912 3300005437 Bacteria 1938
53 Ga0070711_100002923 3300005439 Bacteria 9845
54 Ga0070678_100016413 3300005456 Unclassified 4738
55 Ga0070662_100019588 3300005457 Bacteria 4595
56 Ga0070685_10000781 3300005466 Bacteria 17262
57 Ga0070698_100004733 3300005471 Bacteria 14948
58 Ga0070698_100038618 3300005471 Bacteria 4918
59 Ga0070698_100221929 3300005471 Bacteria 1823
60 Ga0070698_100759031 3300005471 Bacteria 913
61 Ga0070699_100564891 3300005518 Bacteria 1036
62 Ga0070684_100664856 3300005535 Bacteria 970
63 Ga0070684_100696572 3300005535 Bacteria 947
64 Ga0068853_100000646 3300005539 Bacteria 23892
65 Ga0068853_100273875 3300005539 Bacteria 1555
66 Ga0070672_100335002 3300005543 Bacteria 1288
67 Ga0070686_100029095 3300005544 Bacteria 3356
68 Ga0070696_100586616 3300005546 Bacteria 897
69 Ga0070693_100002460 3300005547 Bacteria 8532
70 Ga0070665_100012399 3300005548 Bacteria 8591
71 Ga0070664_100031918 3300005564 Bacteria 4405
72 Ga0068857_100171981 3300005577 Bacteria 1969
73 Ga0068854_100043287 3300005578 Bacteria 3191
74 Ga0070702_100024663 3300005615 Bacteria 3211
75 Ga0070702_100103989 3300005615 Bacteria 1747
76 Ga0068852_100034295 3300005616 Bacteria 4221
77 Ga0068852_100249772 3300005616 Bacteria 1699
78 Ga0068852_100376449 3300005616 Bacteria 1392
79 Ga0068859_100009913 3300005617 Bacteria 9622
80 Ga0068859_100059804 3300005617 Bacteria 3839
81 Ga0068859_100250225 3300005617 Bacteria 1863
82 Ga0068859_100558125 3300005617 Bacteria 1239
83 Ga0068864_100003963 3300005618 Bacteria 12193
84 Ga0068864_101037666 3300005618 Bacteria 814
85 Ga0068866_10003539 3300005718 Bacteria 6398
86 Ga0068866_10431738 3300005718 Bacteria 857
87 Ga0068861_100340420 3300005719 Bacteria 1312
88 Ga0068851_10524769 3300005834 Unclassified 713
89 Ga0068870_10119689 3300005840 Unclassified 1515
90 Ga0068863_100006358 3300005841 Bacteria 11585
91 Ga0068863_100009757 3300005841 Bacteria 9362
92 Ga0068863_100022841 3300005841 Bacteria 5976
93 Ga0068863_100772731 3300005841 Bacteria 957
94 Ga0068858_100027089 3300005842 Bacteria 5324
95 Ga0068858_100177274 3300005842 Bacteria 2011
96 Ga0068860_100043274 3300005843 Bacteria 4297
97 Ga0068860_100127227 3300005843 Unclassified 2442
98 Ga0068860_100276783 3300005843 Bacteria 1639
99 Ga0068860_100419440 3300005843 Bacteria 1326
100 Ga0068860_101196616 3300005843 Bacteria 780
101 Ga0081540_1016375 3300005983 Unclassified 4642
102 Ga0081539_10001260 3300005985 Bacteria 44845
103 Ga0081539_10023221 3300005985 Bacteria 4070
104 Ga0070715_10012733 3300006163 Unclassified 3071
105 Ga0070716_100013118 3300006173 Bacteria 4217
106 Ga0070716_100155378 3300006173 Bacteria 1476
107 Ga0070712_100004729 3300006175 Bacteria 8421
108 Ga0075369_10113311 3300006186 Bacteria 1223
109 Ga0075366_10085740 3300006195 Bacteria 1884
110 Ga0097621_100021134 3300006237 Bacteria 5026
111 Ga0097621_100149956 3300006237 Unclassified 1999
112 Ga0068871_100020140 3300006358 Bacteria 5105
113 Ga0068871_100086251 3300006358 Unclassified 2608
114 Ga0068871_100190328 3300006358 Unclassified 1767
115 Ga0068871_100474042 3300006358 Bacteria 1125
116 Ga0068871_100761050 3300006358 Bacteria 891
117 Ga0075428_100233698 3300006844 Bacteria 1984
118 Ga0075428_100375066 3300006844 Bacteria 1525
119 Ga0075428_100675792 3300006844 Bacteria 1100
120 Ga0075430_100053072 3300006846 Bacteria 3414
121 Ga0075430_100213910 3300006846 Unclassified 1599
122 Ga0075431_100062466 3300006847 Bacteria 3843
123 Ga0075434_101015993 3300006871 Unclassified 843
124 Ga0075429_100004703 3300006880 Bacteria 11747
125 Ga0075429_100159934 3300006880 Unclassified 1972
126 Ga0068865_100013441 3300006881 Bacteria 5171
127 Ga0068865_100285083 3300006881 Bacteria 1316
128 Ga0068865_100298407 3300006881 Bacteria 1289
129 Ga0097620_100009913 3300006931 Bacteria 9622
130 Ga0097620_100059798 3300006931 Bacteria 3839
131 Ga0097620_100250223 3300006931 Bacteria 1863
132 Ga0097620_100558105 3300006931 Bacteria 1239
133 Ga0075435_100109075 3300007076 Bacteria 2300
134 Ga0099794_10061020 3300007265 Bacteria 1832
135 Ga0099795_10003893 3300007788 Bacteria 3767
136 Ga0099795_10178596 3300007788 Bacteria 885
137 Ga0105240_10000086 3300009093 Bacteria 188623
138 Ga0105240_10000105 3300009093 Bacteria 172035
139 Ga0105240_10009554 3300009093 Bacteria 13730
140 Ga0105240_10147283 3300009093 Unclassified 2808
141 Ga0105240_10346613 3300009093 Bacteria 1686
142 Ga0111539_10007729 3300009094 Bacteria 13732
143 Ga0111539_10215628 3300009094 Bacteria 2236
144 Ga0111539_10781835 3300009094 Bacteria 1111
145 Ga0111539_10956453 3300009094 Bacteria 996
146 Ga0105245_10044224 3300009098 Bacteria 3974
147 Ga0105247_10001753 3300009101 Bacteria 15274
148 Ga0114129_10050326 3300009147 Bacteria 5852
149 Ga0114129_10175389 3300009147 Bacteria 2920
150 Ga0114129_11645720 3300009147 Unclassified 785
151 Ga0105243_10357890 3300009148 Unclassified 1342
152 Ga0105241_10029415 3300009174 Bacteria 4099
153 Ga0105242_10003372 3300009176 Bacteria 12431
154 Ga0105242_10079663 3300009176 Bacteria 2736
155 Ga0105242_10085986 3300009176 Bacteria 2638
156 Ga0105242_10165742 3300009176 Unclassified 1938
157 Ga0105242_10711151 3300009176 Unclassified 984
158 Ga0105248_10176986 3300009177 Bacteria 2404
159 Ga0105248_10185042 3300009177 Bacteria 2347
160 Ga0105248_10468519 3300009177 Bacteria 1420
161 Ga0105237_10018159 3300009545 Bacteria 7282
162 Ga0105237_10042009 3300009545 Bacteria 4611
163 Ga0105237_10393039 3300009545 Bacteria 1391
164 Ga0105237_10450313 3300009545 Bacteria 1293
165 Ga0105237_10689220 3300009545 Bacteria 1028
166 Ga0105238_10052033 3300009551 Bacteria 4117
167 Ga0105238_10053458 3300009551 Bacteria 4058
168 Ga0105238_10161956 3300009551 Bacteria 2213
169 Ga0105249_10025511 3300009553 Bacteria 5322
170 Ga0105249_10093571 3300009553 Unclassified 2816
171 Ga0105249_11374990 3300009553 Bacteria 778
172 Ga0105239_10000313 3300010375 Bacteria 71404
173 Ga0105239_10001195 3300010375 Bacteria 35500
174 Ga0105239_10029591 3300010375 Bacteria 6022
175 Ga0105239_10758576 3300010375 Unclassified 1111
176 Ga0105246_10032100 3300011119 Bacteria 3480
177 Ga0157373_10005182 3300013100 Bacteria 9795
178 Ga0157370_10015764 3300013104 Bacteria 7670
179 Ga0157370_10333403 3300013104 Bacteria 1398
180 Ga0157374_10000002 3300013296 Bacteria 1054226
181 Ga0157374_10004115 3300013296 Bacteria 12209
182 Ga0157374_10076001 3300013296 Bacteria 3175
183 Ga0157374_10160388 3300013296 Bacteria 2190
184 Ga0157374_10374559 3300013296 Bacteria 1417
185 Ga0157374_10821754 3300013296 Bacteria 946
186 Ga0157374_10825432 3300013296 Unclassified 943
187 Ga0157378_10043739 3300013297 Unclassified 3976
188 Ga0157378_10097786 3300013297 Bacteria 2676
189 Ga0157378_10376281 3300013297 Bacteria 1394
190 Ga0157378_11365322 3300013297 Bacteria 751
191 Ga0163162_10000109 3300013306 Bacteria 74550
192 Ga0163162_10009385 3300013306 Bacteria 9517
193 Ga0163162_10123692 3300013306 Unclassified 2692
194 Ga0163162_10123909 3300013306 Bacteria 2690
195 Ga0163162_10143214 3300013306 Bacteria 2504
196 Ga0163162_11619759 3300013306 Unclassified 739
197 Ga0157372_10000617 3300013307 Bacteria 38817
198 Ga0157372_11435024 3300013307 Bacteria 795
199 Ga0157375_10110636 3300013308 Bacteria 2844
200 Ga0157375_10189997 3300013308 Bacteria 2208
201 Ga0157375_10253028 3300013308 Unclassified 1922
202 Ga0163163_10014607 3300014325 Bacteria 7223
203 Ga0157380_10100131 3300014326 Bacteria 2412
204 Ga0157380_10212465 3300014326 Bacteria 1725
205 Ga0157380_10223294 3300014326 Bacteria 1687
206 Ga0157380_10451450 3300014326 Bacteria 1235
207 Ga0157380_10589861 3300014326 Bacteria 1097
208 Ga0157380_11242165 3300014326 Bacteria 790
209 Ga0157377_10033329 3300014745 Bacteria 2811
210 Ga0157379_10000468 3300014968 Bacteria 32782
211 Ga0157376_10042301 3300014969 Bacteria 3735
212 Ga0157376_10087384 3300014969 Bacteria 2690
213 Ga0157376_10198456 3300014969 Bacteria 1844
214 Ga0157376_10419978 3300014969 Bacteria 1298
215 Ga0163161_10083506 3300017792 Bacteria 2354
216 Ga0209672_102553 3300025228 Bacteria 4371
217 Ga0209258_100291 3300025242 Bacteria 82373
218 Ga0209759_1000522 3300025256 Bacteria 41349
219 Ga0209759_1000641 3300025256 Bacteria 32625
220 Ga0209233_1020811 3300025261 Unclassified 1712
221 Ga0209455_1000208 3300025272 Bacteria 83420
222 Ga0209676_1000425 3300025292 Bacteria 74151
223 Ga0209050_1034118 3300025298 Bacteria 1530
224 Ga0209257_1000008 3300025304 Bacteria 1294570
225 Ga0207682_10285115 3300025893 Bacteria 773
226 Ga0207692_10017644 3300025898 Unclassified 3187
227 Ga0207692_10065866 3300025898 Bacteria 1892
228 Ga0207642_10003460 3300025899 Bacteria 4985
229 Ga0207642_10443876 3300025899 Bacteria 785
230 Ga0207710_10050580 3300025900 Bacteria 1865
231 Ga0207680_10005875 3300025903 Bacteria 5893
232 Ga0207680_10048250 3300025903 Bacteria 2528
233 Ga0207643_10237953 3300025908 Bacteria 1118
234 Ga0207705_10045960 3300025909 Bacteria 3137
235 Ga0207654_10011755 3300025911 Unclassified 4469
236 Ga0207695_10000175 3300025913 Bacteria 188658
237 Ga0207695_10000193 3300025913 Bacteria 172070
238 Ga0207695_10021408 3300025913 Bacteria 7376
239 Ga0207671_10007762 3300025914 Bacteria 9241
240 Ga0207671_10285179 3300025914 Bacteria 1303
241 Ga0207693_10000325 3300025915 Bacteria 44161
242 Ga0207663_10053307 3300025916 Bacteria 2526
243 Ga0207662_10052953 3300025918 Bacteria 2417
244 Ga0207681_10025840 3300025923 Bacteria 3782
245 Ga0207681_10088041 3300025923 Unclassified 2211
246 Ga0207694_10061757 3300025924 Bacteria 2916
247 Ga0207694_10070493 3300025924 Bacteria 2731
248 Ga0207694_10267824 3300025924 Bacteria 1401
249 Ga0207650_10038163 3300025925 Bacteria 3506
250 Ga0207650_10058175 3300025925 Bacteria 2877
251 Ga0207650_10451561 3300025925 Bacteria 1070
252 Ga0207687_10002556 3300025927 Bacteria 12360
253 Ga0207687_10065545 3300025927 Bacteria 2579
254 Ga0207700_10003146 3300025928 Bacteria 9525
255 Ga0207664_10000078 3300025929 Bacteria 97308
256 Ga0207644_10032020 3300025931 Bacteria 3666
257 Ga0207644_10157747 3300025931 Unclassified 1761
258 Ga0207706_10008355 3300025933 Bacteria 9550
259 Ga0207686_10001142 3300025934 Bacteria 15331
260 Ga0207686_10002988 3300025934 Bacteria 9116
261 Ga0207686_10121214 3300025934 Bacteria 1780
262 Ga0207709_10133420 3300025935 Bacteria 1696
263 Ga0207670_10024025 3300025936 Unclassified 3804
264 Ga0207670_10236185 3300025936 Bacteria 1406
265 Ga0207704_10011323 3300025938 Unclassified 4386
266 Ga0207704_10233293 3300025938 Unclassified 1370
267 Ga0207704_10357423 3300025938 Bacteria 1139
268 Ga0207691_10011173 3300025940 Bacteria 8618
269 Ga0207691_10420193 3300025940 Bacteria 1139
270 Ga0207711_10000206 3300025941 Bacteria 62928
271 Ga0207689_10581395 3300025942 Bacteria 942
272 Ga0207661_10076557 3300025944 Bacteria 2748
273 Ga0207667_10048420 3300025949 Bacteria 4495
274 Ga0207667_10180715 3300025949 Unclassified 2167
275 Ga0207651_10003757 3300025960 Bacteria 7512
276 Ga0207651_10006731 3300025960 Bacteria 6053
277 Ga0207651_10085620 3300025960 Bacteria 2287
278 Ga0207712_10023889 3300025961 Bacteria 4041
279 Ga0207712_10060602 3300025961 Bacteria 2683
280 Ga0207640_10020548 3300025981 Unclassified 3922
281 Ga0207658_10027193 3300025986 Bacteria 4017
282 Ga0207658_10215972 3300025986 Bacteria 1610
283 Ga0207658_10346847 3300025986 Bacteria 1292
284 Ga0207677_10003774 3300026023 Bacteria 8044
285 Ga0207703_10023517 3300026035 Bacteria 4841
286 Ga0207703_10355711 3300026035 Bacteria 1349
287 Ga0207639_10012557 3300026041 Bacteria 5902
288 Ga0207678_10027859 3300026067 Bacteria 4933
289 Ga0207708_10466111 3300026075 Bacteria 1054
290 Ga0207702_10015550 3300026078 Bacteria 6298
291 Ga0207702_10075404 3300026078 Unclassified 2914
292 Ga0207702_10294169 3300026078 Bacteria 1539
293 Ga0207641_10000371 3300026088 Bacteria 53368
294 Ga0207641_10041694 3300026088 Bacteria 3847
295 Ga0207641_10051358 3300026088 Unclassified 3491
296 Ga0207648_10046070 3300026089 Unclassified 3824
297 Ga0207648_10205080 3300026089 Bacteria 1749
298 Ga0207676_10006383 3300026095 Bacteria 8329
299 Ga0207676_10080013 3300026095 Bacteria 2652
300 Ga0207674_10099645 3300026116 Bacteria 2888
301 Ga0207674_10368114 3300026116 Bacteria 1389
302 Ga0207674_10739851 3300026116 Unclassified 949
303 Ga0207675_100308155 3300026118 Bacteria 1543
304 Ga0207675_100310286 3300026118 Bacteria 1538
305 Ga0207683_10000671 3300026121 Bacteria 31464
306 Ga0207683_10092375 3300026121 Bacteria 2697
307 Ga0207698_10189854 3300026142 Bacteria 1829
308 Ga0207698_10421763 3300026142 Bacteria 1280
309 Ga0207698_10586629 3300026142 Bacteria 1097
310 Ga0268266_10000088 3300028379 Bacteria 199029
311 Ga0268266_10039461 3300028379 Unclassified 4022
312 Ga0268265_10098247 3300028380 Bacteria 2358
313 Ga0268264_10406590 3300028381 Bacteria 1309
314 Ga0265337_1035008 3300028556 Bacteria 1473
315 Ga0265337_1047038 3300028556 Bacteria 1224
316 Ga0265334_10011973 3300028573 Bacteria 3644
317 Ga0265334_10106084 3300028573 Bacteria 1013
318 Ga0265336_10000003 3300028666 Bacteria 423158
319 Ga0265336_10032732 3300028666 Bacteria 1612
320 Ga0307515_10000044 3300028794 Bacteria 303041
321 Ga0307515_10000251 3300028794 Bacteria 132970
322 Ga0307515_10000724 3300028794 Bacteria 75975
323 Ga0307515_10118212 3300028794 Bacteria 3027
324 Ga0265338_10003080 3300028800 Bacteria 23928
325 Ga0265338_10057130 3300028800 Bacteria 3454
326 Ga0265338_10180041 3300028800 Bacteria 1612
327 Ga0265338_10378283 3300028800 Bacteria 1013
328 Ga0265324_10001536 3300029957 Bacteria 12971
329 Ga0265331_10115906 3300031250 Bacteria 1227
330 Ga0265327_10000743 3300031251 Bacteria 50644
331 Ga0265316_10000246 3300031344 Bacteria 62474
332 Ga0265316_10005277 3300031344 Bacteria 12607
333 Ga0265316_10183976 3300031344 Bacteria 1555
334 Ga0307513_10014229 3300031456 Bacteria 9728
335 Ga0307513_10040771 3300031456 Bacteria 5131
336 Ga0307513_10098540 3300031456 Bacteria 2954
337 Ga0307509_10224400 3300031507 Bacteria 1688
338 Ga0307408_100001708 3300031548 Bacteria 16126
339 Ga0307408_100884888 3300031548 Bacteria 816
340 Ga0265342_10124039 3300031712 Bacteria 1452
341 Ga0316576_10267488 3300031727 Bacteria 1282
342 Ga0316578_10155415 3300031728 Unclassified 1379
343 Ga0307516_10235549 3300031730 Bacteria 1532
344 Ga0307405_10805817 3300031731 Bacteria 787
345 Ga0307406_10411655 3300031901 Bacteria 1075
346 Ga0307416_100368847 3300032002 Bacteria 1461
347 Ga0307414_10082631 3300032004 Bacteria 2356
348 Ga0307415_100343776 3300032126 Bacteria 1253
349 Ga0316583_10025580 3300032133 Bacteria 2108
350 Ga0316583_10079002 3300032133 Bacteria 1150
351 Ga0307510_10064887 3300033180 Bacteria 3704
352 Ga0373926_0038629 3300035083 Unclassified 1701
353 Ga0373934_0007255 3300035086 Bacteria 4110
354 Ga0373923_0001540 3300035111 Bacteria 6667
355 Ga0373945_0051252 3300035116 Bacteria 1518
356 Ga0373945_0055299 3300035116 Unclassified 1469
357 Ga0373954_0001962 3300035118 Bacteria 8532
358 Ga0373957_0014603 3300035120 Unclassified 2688
359 Ga0373943_0011742 3300035170 Unclassified 3943
360 Ga0373943_0022831 3300035170 Bacteria 2904
361 Ga0373943_0318462 3300035170 Bacteria 886
362 Ga0373955_0039012 3300035172 Bacteria 2532
363 Ga0316574_0102859 3300035398 Unclassified 1829
364 Ga0373924_0006655 3300035410 Bacteria 4146
365 Ga0373931_0139433 3300035691 Unclassified 1403
366 Ga0373935_0019528 3300035692 Bacteria 4133
367 Ga0373935_0045754 3300035692 Bacteria 2762
368 Ga0373927_0032592 3300035695 Bacteria 3394
369 Ga0373927_0132854 3300035695 Unclassified 1626
370 Ga0373927_0137867 3300035695 Bacteria 1595
371 Ga0373927_0428472 3300035695 Bacteria 873
372 Ga0373933_0040262 3300035724 Unclassified 2752
373 Ga0373937_0007866 3300036401 Bacteria 9241
374 Ga0373937_0031181 3300036401 Bacteria 4828
375 Ga0316582_0178355 3300036647 Bacteria 1445
376 Ga0316584_0094211 3300036712 Bacteria 2242
377 Ga0373925_0114800 3300037068 Unclassified 2084
378 Ga0395900_0046658 3300037418 Bacteria 4462
379 Ga0395898_0440741 3300037466 Bacteria 1241
380 Ga0439439_0001900 3300041406 Bacteria 4315
381 Ga0451787_341172 3300041441 Bacteria 820
382 Ga0451839_0695238 3300041496 Bacteria 1118
383 Ga0451849_1366099 3300041505 Bacteria 1560
384 Ga0451843_1210020 3300041509 Bacteria 941
385 Ga0451853_0693207 3300041512 Unclassified 1425
386 Ga0451853_2023802 3300041512 Bacteria 906
387 Ga0439457_001015 3300042014 Bacteria 8459
388 Ga0451577_0016862 3300042876 Bacteria 6756
389 Ga0451577_0292794 3300042876 Unclassified 1475
390 Ga0451577_0599973 3300042876 Bacteria 999
391 Ga0466969_0000371 3300044656 Bacteria 24624
392 Ga0466972_0000075 3300044658 Bacteria 94290
393 Ga0466972_0012429 3300044658 Bacteria 4279
394 Ga0453683_0000162 3300044673 Bacteria 97997
395 Ga0453683_0020950 3300044673 Bacteria 4175
396 Ga0453683_0073693 3300044673 Bacteria 2137
397 Ga0466966_0000131 3300044684 Bacteria 48304
398 Ga0466966_0174210 3300044684 Bacteria 1307
399 Ga0466961_0060382 3300044693 Bacteria 2411
400 Ga0466964_0133460 3300044706 Bacteria 1133
401 Ga0453684_0000604 3300044712 Bacteria 132335
402 Ga0453684_0004825 3300044712 Bacteria 27702
403 Ga0453684_0011388 3300044712 Bacteria 14935
404 Ga0453684_0063998 3300044712 Bacteria 4700
405 Ga0466971_0010042 3300044719 Bacteria 4136
406 Ga0466970_0008141 3300044765 Bacteria 5264
407 Ga0466970_0033032 3300044765 Unclassified 2735
408 Ga0466970_0103862 3300044765 Bacteria 1549
409 Ga0466957_0008518 3300044842 Bacteria 5836
410 Ga0466959_0000003 3300045049 Bacteria 285164
411 Ga0466959_0052730 3300045049 Unclassified 2978
412 Ga0451576_0000299 3300045051 Bacteria 120013
413 Ga0451576_0000913 3300045051 Bacteria 55976
414 Ga0451576_0002946 3300045051 Bacteria 24140
415 Ga0495592_0090373 3300046454 Bacteria 2197
416 Ga0495592_0090393 3300046454 Bacteria 2197
417 Ga0495638_0000003 3300046460 Bacteria 888792
418 Ga0495638_0057097 3300046460 Unclassified 2422
419 Ga0495638_0188481 3300046460 Unclassified 1172
420 Ga0495651_0309763 3300046462 Bacteria 1056
421 Ga0495650_0007871 3300046471 Bacteria 6330
422 Ga0495580_0011883 3300046472 Bacteria 6713
423 Ga0495580_0035198 3300046472 Bacteria 3601
424 Ga0495639_0004602 3300046475 Bacteria 5918
425 Ga0495639_0027892 3300046475 Bacteria 2500
426 Ga0495662_0092595 3300046476 Unclassified 1474
427 Ga0495662_0118724 3300046476 Bacteria 1298
428 Ga0495594_0037284 3300046499 Bacteria 2652
429 Ga0495583_0054967 3300046506 Unclassified 1801
430 Ga0495606_0213470 3300046507 Bacteria 1091
431 Ga0495628_0018267 3300046516 Bacteria 5814
432 Ga0495630_0043941 3300046517 Bacteria 3339
433 Ga0495665_0023392 3300046531 Unclassified 3318
434 Ga0495640_0063064 3300046533 Bacteria 2512
435 Ga0495640_0083681 3300046533 Unclassified 2117
436 Ga0495586_0046787 3300046535 Unclassified 2333
437 Ga0495609_0048952 3300046538 Unclassified 1887
438 Ga0495621_0081033 3300046539 Bacteria 1210
439 Ga0495645_0023230 3300046543 Bacteria 4490
440 Ga0495645_0040280 3300046543 Bacteria 3409
441 Ga0495667_0092936 3300046559 Bacteria 1953
442 Ga0495656_0035475 3300046615 Bacteria 2049
443 Ga0495668_0000526 3300046616 Bacteria 47711
444 Ga0495634_0032823 3300046642 Bacteria 3568
445 Ga0495611_0240959 3300046648 Bacteria 839
446 Ga0495625_0061260 3300046660 Bacteria 2663
447 Ga0495635_0054562 3300046663 Bacteria 2753
448 Ga0495588_0199789 3300046674 Unclassified 1056
449 Ga0495623_0090135 3300046679 Bacteria 1883
450 Ga0495647_0040939 3300046681 Bacteria 1762
451 Ga0495658_0025524 3300046683 Bacteria 3158
452 Ga0495613_0046901 3300046689 Bacteria 3193
453 Ga0495649_0032766 3300046694 Bacteria 2861
454 Ga0495581_0000884 3300047315 Bacteria 16023
455 Ga0495604_0202754 3300047317 Unclassified 1375
456 Ga0495636_0002425 3300047318 Bacteria 7148
457 Ga0495674_0056639 3300047319 Unclassified 3432
458 Ga0495680_0089986 3300047322 Unclassified 2303
459 Ga0495683_0008096 3300047323 Bacteria 5642
460 Ga0495684_0049551 3300047471 Bacteria 3208
461 Ga0495684_0285805 3300047471 Unclassified 1188
462 Ga0495686_0012213 3300047472 Bacteria 6016
463 Ga0495686_0016151 3300047472 Bacteria 5072
464 Ga0495593_0045865 3300047673 Unclassified 2331
465 Ga0495602_0236243 3300048088 Unclassified 1370
466 Ga0496105_0102834 3300048908 Bacteria 2359
467 Ga0496106_0958788 3300048909 Bacteria 674
468 Ga0496107_0021378 3300048910 Unclassified 4573
469 Ga0496108_0000007 3300048911 Bacteria 351492
470 Ga0496108_0360945 3300048911 Unclassified 1268
471 Ga0496109_0002530 3300048912 Bacteria 15325
472 Ga0496114_0011119 3300048917 Bacteria 7185
473 Ga0496115_0291375 3300048918 Unclassified 1339
474 Ga0496126_0026690 3300048929 Bacteria 5531
475 Ga0501047_0020598 3300049581 Bacteria 6333
476 Ga0501047_0388716 3300049581 Bacteria 1229
477 Ga0501047_0424817 3300049581 Unclassified 1160
478 Ga0501048_0323869 3300049582 Bacteria 1098
479 Ga0501202_008218 3300049652 Bacteria 1899
480 Ga0501217_018075 3300049661 Bacteria 1633
481 Ga0501235_080771 3300049669 Unclassified 777
482 Ga0501236_000930 3300049670 Bacteria 3295
483 Ga0501242_000387 3300049674 Bacteria 3729
484 Ga0501257_000158 3300049686 Bacteria 13902
485 Ga0501257_000385 3300049686 Bacteria 8563
486 Ga0501225_0004322 3300049705 Unclassified 4246
487 Ga0501225_0010633 3300049705 Bacteria 2604
488 Ga0501080_0555774 3300049742 Bacteria 1022
489 Ga0501083_0098944 3300049744 Bacteria 1924
490 Ga0501264_000543 3300049761 Bacteria 5501
491 Ga0501264_005145 3300049761 Unclassified 1190
492 Ga0501044_0024091 3300049823 Bacteria 6466
493 nmdc:mga0k408_109114_c1 3300050493 Bacteria 1635
494 nmdc:mga0k408_4450_c1 3300050493 Bacteria 7436
495 nmdc:mga0k408_59567_c1 3300050493 Bacteria 2218
496 nmdc:mga05p37_10194_c2 3300050507 Bacteria 9428
497 nmdc:mga09592_187982_c1 3300050508 Unclassified 1788
498 nmdc:mga09592_4021_c1 3300050508 Bacteria 11865
499 nmdc:mga0qj67_94392_c1 3300050509 Bacteria 2406
500 nmdc:mga06r32_159410_c1 3300050510 Bacteria 2238
501 nmdc:mga06r32_170007_c1 3300050510 Unclassified 2163
502 nmdc:mga08y16_47211_c1 3300050511 Bacteria 4507
503 nmdc:mga0n895_870595_c1 3300050512 Unclassified 888
504 nmdc:mga0rr50_70638_c1 3300050513 Bacteria 2661
505 Ga0495601_0057365 3300053077 Unclassified 2467
506 Ga0495601_0141515 3300053077 Bacteria 1569
507 Ga0500635_0000267 3300053080 Bacteria 20576
508 Ga0495619_0001956 3300053085 Bacteria 13738
509 Ga0500578_0000091 3300053086 Bacteria 102427
510 Ga0500578_0021779 3300053086 Bacteria 4117
511 Ga0500578_0209412 3300053086 Bacteria 1190
512 Ga0500644_0035139 3300053088 Unclassified 1622
513 Ga0500581_215700 3300053089 Bacteria 838
514 Ga0500646_0028536 3300053090 Bacteria 1524
515 Ga0500646_0105765 3300053090 Bacteria 889
516 Ga0500583_0000011 3300053092 Bacteria 160380
517 Ga0500583_0000236 3300053092 Bacteria 19755
518 Ga0500555_016697 3300053103 Unclassified 2115
519 Ga0500556_0018576 3300053104 Bacteria 2197
520 Ga0500591_073448 3300053115 Bacteria 1543
521 Ga0500618_000010 3300053125 Bacteria 203909
522 Ga0500642_0026381 3300053130 Unclassified 2371
523 Ga0500559_0008054 3300053136 Bacteria 4639
524 Ga0500564_124461 3300053138 Bacteria 1120
525 Ga0500577_0039752 3300053142 Bacteria 1707
526 Ga0500577_0041861 3300053142 Bacteria 1674
527 Ga0500588_0002329 3300053146 Bacteria 3838
528 Ga0500589_009872 3300053147 Bacteria 4054
529 Ga0500603_096533 3300053150 Bacteria 874
530 Ga0500616_0000007 3300053153 Bacteria 836875
531 Ga0500616_0004297 3300053153 Bacteria 10222
532 Ga0500622_0000844 3300053156 Bacteria 26216
533 Ga0500622_0001136 3300053156 Bacteria 22218
534 Ga0500622_0018143 3300053156 Unclassified 3742
535 Ga0500627_0040170 3300053158 Bacteria 2007
536 Ga0500630_088313 3300053159 Bacteria 1437
537 Ga0500611_000026 3300053727 Bacteria 96342
538 Ga0500609_025558 3300053731 Bacteria 809
539 Ga0501082_0124487 3300060353 Bacteria 2235

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0124487 Ga0501082_0124487_12_542 171
2 3300048909 Ga0496106_0958788 Ga0496106_0958788_65_652 195
3 3300053142 Ga0500577_0041861 Ga0500577_0041861_18_623 201
4 3300006186 Ga0075369_10113311 Ga0075369_101133112 203
5 3300006844 Ga0075428_100233698 Ga0075428_1002336983 205
6 3300006846 Ga0075430_100213910 Ga0075430_1002139102 205
7 3300005338 Ga0068868_100120953 Ga0068868_1001209533 207
8 3300005355 Ga0070671_100127533 Ga0070671_1001275333 207
9 3300005356 Ga0070674_100000708 Ga0070674_10000070819 207
10 3300005367 Ga0070667_100007792 Ga0070667_1000077922 207
11 3300005435 Ga0070714_100774609 Ga0070714_1007746091 207
12 3300005437 Ga0070710_10076912 Ga0070710_100769123 207
13 3300005456 Ga0070678_100016413 Ga0070678_1000164137 207
14 3300005457 Ga0070662_100019588 Ga0070662_1000195885 207
15 3300005547 Ga0070693_100002460 Ga0070693_1000024608 207
16 3300005578 Ga0068854_100043287 Ga0068854_1000432872 207
17 3300005615 Ga0070702_100103989 Ga0070702_1001039892 207
18 3300005616 Ga0068852_100249772 Ga0068852_1002497722 207
19 3300005718 Ga0068866_10003539 Ga0068866_100035399 207
20 3300005843 Ga0068860_100043274 Ga0068860_1000432747 207
21 3300005843 Ga0068860_101196616 Ga0068860_1011966162 207
22 3300006358 Ga0068871_100086251 Ga0068871_1000862513 207
23 3300006881 Ga0068865_100013441 Ga0068865_1000134413 207
24 3300025898 Ga0207692_10065866 Ga0207692_100658663 207
25 3300025899 Ga0207642_10003460 Ga0207642_100034608 207
26 3300025903 Ga0207680_10005875 Ga0207680_1000587511 207
27 3300025911 Ga0207654_10011755 Ga0207654_100117557 207
28 3300025924 Ga0207694_10070493 Ga0207694_100704933 207
29 3300025927 Ga0207687_10002556 Ga0207687_100025568 207
30 3300025931 Ga0207644_10157747 Ga0207644_101577473 207
31 3300025933 Ga0207706_10008355 Ga0207706_100083558 207
32 3300025934 Ga0207686_10001142 Ga0207686_1000114216 207
33 3300025935 Ga0207709_10133420 Ga0207709_101334202 207
34 3300025938 Ga0207704_10011323 Ga0207704_100113237 207
35 3300025981 Ga0207640_10020548 Ga0207640_100205483 207
36 3300025986 Ga0207658_10215972 Ga0207658_102159723 207
37 3300026041 Ga0207639_10012557 Ga0207639_100125575 207
38 3300026067 Ga0207678_10027859 Ga0207678_100278597 207
39 3300026089 Ga0207648_10046070 Ga0207648_100460702 207
40 3300026121 Ga0207683_10000671 Ga0207683_1000067132 207
41 3300031730 Ga0307516_10235549 Ga0307516_102355492 207
42 3300035170 Ga0373943_0318462 Ga0373943_0318462_18_641 207
43 3300005617 Ga0068859_100250225 Ga0068859_1002502252 208
44 3300006358 Ga0068871_100761050 Ga0068871_1007610502 208
45 3300006931 Ga0097620_100250223 Ga0097620_1002502232 208
46 3300025940 Ga0207691_10420193 Ga0207691_104201931 208
47 3300005329 Ga0070683_100083755 Ga0070683_1000837553 209
48 3300025944 Ga0207661_10076557 Ga0207661_100765573 209
49 3300033180 Ga0307510_10064887 Ga0307510_100648872 209
50 3300047323 Ga0495683_0008096 Ga0495683_0008096_579_1253 209
51 3300005354 Ga0070675_100884961 Ga0070675_1008849611 210
52 3300005535 Ga0070684_100664856 Ga0070684_1006648561 210
53 3300005985 Ga0081539_10023221 Ga0081539_100232214 210
54 3300009094 Ga0111539_10781835 Ga0111539_107818352 210
55 3300028794 Ga0307515_10000044 Ga0307515_10000044189 210
56 3300048911 Ga0496108_0000007 Ga0496108_0000007_253846_254490 210
57 3300031727 Ga0316576_10267488 Ga0316576_102674882 211
58 3300031728 Ga0316578_10155415 Ga0316578_101554152 211
59 3300036647 Ga0316582_0178355 Ga0316582_0178355_489_1163 211
60 3300009147 Ga0114129_10175389 Ga0114129_101753892 213
61 3300047472 Ga0495686_0012213 Ga0495686_0012213_4175_4855 213
62 3300053092 Ga0500583_0000236 Ga0500583_0000236_14112_14777 213
63 3300053147 Ga0500589_009872 Ga0500589_009872_766_1431 213
64 iso_pu_bacteria 2738541273 2738699058 213
65 iso_pu_bacteria 2738543014 2739254774 213
66 3300005471 Ga0070698_100759031 Ga0070698_1007590311 214
67 3300006844 Ga0075428_100375066 Ga0075428_1003750662 214
68 3300009545 Ga0105237_10689220 Ga0105237_106892201 214
69 3300026078 Ga0207702_10294169 Ga0207702_102941693 214
70 3300031731 Ga0307405_10805817 Ga0307405_108058171 214
71 3300031901 Ga0307406_10411655 Ga0307406_104116552 214
72 3300032002 Ga0307416_100368847 Ga0307416_1003688472 214
73 3300041512 Ga0451853_0693207 Ga0451853_0693207_693_1358 214
74 3300046460 Ga0495638_0057097 Ga0495638_0057097_1361_2020 214
75 3300050493 nmdc:mga0k408_4450_c1 nmdc:mga0k408_4450_c1_1290_1955 214
76 iso_pu_bacteria 2739367866 2740032774 214
77 iso_pu_bacteria 2980182181 2980188492 214
78 3300003316 rootH1_10007168 rootH1_100071684 215
79 3300003322 rootL2_10035743 rootL2_100357432 215
80 3300046516 Ga0495628_0018267 Ga0495628_0018267_3609_4301 215
81 iso_pu_bacteria 2896109856 2896112302 215
82 3300006880 Ga0075429_100159934 Ga0075429_1001599342 216
83 3300026142 Ga0207698_10586629 Ga0207698_105866292 216
84 3300028556 Ga0265337_1047038 Ga0265337_10470382 216
85 3300028573 Ga0265334_10011973 Ga0265334_100119734 216
86 3300028800 Ga0265338_10057130 Ga0265338_100571303 216
87 3300036712 Ga0316584_0094211 Ga0316584_0094211_760_1425 216
88 3300050508 nmdc:mga09592_187982_c1 nmdc:mga09592_187982_c1_513_1166 216
89 3300050510 nmdc:mga06r32_170007_c1 nmdc:mga06r32_170007_c1_861_1514 216
90 iso_pu_bacteria 2738541278 2738724859 216
91 iso_pu_bacteria 2911138879 2911141327 216
92 iso_pu_bacteria 2932794094 2932796174 216
93 3300005290 Ga0065712_10013630 Ga0065712_100136303 217
94 3300005338 Ga0068868_100419821 Ga0068868_1004198212 217
95 3300005353 Ga0070669_100066337 Ga0070669_1000663372 217
96 3300005354 Ga0070675_100395322 Ga0070675_1003953222 217
97 3300005354 Ga0070675_100404420 Ga0070675_1004044201 217
98 3300005364 Ga0070673_100030671 Ga0070673_1000306715 217
99 3300005365 Ga0070688_100087414 Ga0070688_1000874142 217
100 3300005471 Ga0070698_100004733 Ga0070698_1000047336 217
101 3300005518 Ga0070699_100564891 Ga0070699_1005648912 217
102 3300005543 Ga0070672_100335002 Ga0070672_1003350022 217
103 3300005577 Ga0068857_100171981 Ga0068857_1001719812 217
104 3300005617 Ga0068859_100059804 Ga0068859_1000598045 217
105 3300005719 Ga0068861_100340420 Ga0068861_1003404202 217
106 3300005842 Ga0068858_100177274 Ga0068858_1001772741 217
107 3300005843 Ga0068860_100276783 Ga0068860_1002767833 217
108 3300006173 Ga0070716_100155378 Ga0070716_1001553782 217
109 3300006844 Ga0075428_100675792 Ga0075428_1006757921 217
110 3300006846 Ga0075430_100053072 Ga0075430_1000530722 217
111 3300006847 Ga0075431_100062466 Ga0075431_1000624662 217
112 3300006880 Ga0075429_100004703 Ga0075429_10000470310 217
113 3300006931 Ga0097620_100059798 Ga0097620_1000597985 217
114 3300009177 Ga0105248_10468519 Ga0105248_104685191 217
115 3300013308 Ga0157375_10110636 Ga0157375_101106362 217
116 3300014326 Ga0157380_10223294 Ga0157380_102232942 217
117 3300014745 Ga0157377_10033329 Ga0157377_100333292 217
118 3300014969 Ga0157376_10198456 Ga0157376_101984561 217
119 3300017792 Ga0163161_10083506 Ga0163161_100835063 217
120 3300025918 Ga0207662_10052953 Ga0207662_100529532 217
121 3300025923 Ga0207681_10025840 Ga0207681_100258404 217
122 3300025925 Ga0207650_10451561 Ga0207650_104515611 217
123 3300025940 Ga0207691_10011173 Ga0207691_100111732 217
124 3300025960 Ga0207651_10085620 Ga0207651_100856204 217
125 3300025986 Ga0207658_10346847 Ga0207658_103468471 217
126 3300026035 Ga0207703_10355711 Ga0207703_103557112 217
127 3300026075 Ga0207708_10466111 Ga0207708_104661111 217
128 3300026095 Ga0207676_10080013 Ga0207676_100800132 217
129 3300026118 Ga0207675_100310286 Ga0207675_1003102861 217
130 3300026121 Ga0207683_10092375 Ga0207683_100923752 217
131 3300032126 Ga0307415_100343776 Ga0307415_1003437762 217
132 3300044673 Ga0453683_0073693 Ga0453683_0073693_37_762 217
133 3300044712 Ga0453684_0063998 Ga0453684_0063998_1450_2118 217
134 3300046476 Ga0495662_0118724 Ga0495662_0118724_549_1205 217
135 3300050508 nmdc:mga09592_4021_c1 nmdc:mga09592_4021_c1_377_1042 217
136 3300050509 nmdc:mga0qj67_94392_c1 nmdc:mga0qj67_94392_c1_784_1449 217
137 3300050510 nmdc:mga06r32_159410_c1 nmdc:mga06r32_159410_c1_1501_2166 217
138 iso_pu_bacteria 2896085136 2896087977 217
139 3300005841 Ga0068863_100772731 Ga0068863_1007727312 218
140 3300006195 Ga0075366_10085740 Ga0075366_100857403 218
141 3300025298 Ga0209050_1034118 Ga0209050_10341182 218
142 3300028794 Ga0307515_10000251 Ga0307515_1000025160 218
143 3300028794 Ga0307515_10000724 Ga0307515_1000072440 218
144 3300028794 Ga0307515_10118212 Ga0307515_101182122 218
145 3300031251 Ga0265327_10000743 Ga0265327_1000074321 218
146 3300031456 Ga0307513_10014229 Ga0307513_100142294 218
147 3300031456 Ga0307513_10040771 Ga0307513_100407714 218
148 3300031456 Ga0307513_10098540 Ga0307513_100985402 218
149 3300032004 Ga0307414_10082631 Ga0307414_100826312 218
150 3300035695 Ga0373927_0137867 Ga0373927_0137867_438_1109 218
151 3300044712 Ga0453684_0011388 Ga0453684_0011388_6916_7575 218
152 3300046460 Ga0495638_0000003 Ga0495638_0000003_506591_507256 218
153 3300046615 Ga0495656_0035475 Ga0495656_0035475_1185_1841 218
154 3300047318 Ga0495636_0002425 Ga0495636_0002425_4795_5451 218
155 3300049742 Ga0501080_0555774 Ga0501080_0555774_202_873 218
156 3300050493 nmdc:mga0k408_109114_c1 nmdc:mga0k408_109114_c1_885_1559 218
157 3300053077 Ga0495601_0057365 Ga0495601_0057365_979_1638 218
158 3300053146 Ga0500588_0002329 Ga0500588_0002329_1142_1801 218
159 3300053153 Ga0500616_0000007 Ga0500616_0000007_284864_285529 218
160 iso_pu_bacteria 2818991444 2819587859 218
161 iso_pu_bacteria 2977232053 2977234338 218
162 3300003203 JGI25406J46586_10013534 JGI25406J46586_100135345 219
163 3300003320 rootH2_10010421 rootH2_1001042129 219
164 3300003323 rootH1_10312291 rootH1_103122912 219
165 3300005331 Ga0070670_100009312 Ga0070670_10000931215 219
166 3300005331 Ga0070670_100377202 Ga0070670_1003772021 219
167 3300005334 Ga0068869_100026153 Ga0068869_1000261537 219
168 3300005335 Ga0070666_10026815 Ga0070666_100268153 219
169 3300005338 Ga0068868_100034831 Ga0068868_1000348314 219
170 3300005340 Ga0070689_100000405 Ga0070689_10000040534 219
171 3300005353 Ga0070669_100670907 Ga0070669_1006709072 219
172 3300005355 Ga0070671_100014853 Ga0070671_1000148537 219
173 3300005364 Ga0070673_100003821 Ga0070673_10000382114 219
174 3300005365 Ga0070688_100000683 Ga0070688_10000068321 219
175 3300005365 Ga0070688_100134287 Ga0070688_1001342872 219
176 3300005367 Ga0070667_100025827 Ga0070667_1000258273 219
177 3300005434 Ga0070709_10003881 Ga0070709_100038814 219
178 3300005436 Ga0070713_100000967 Ga0070713_10000096726 219
179 3300005437 Ga0070710_10036855 Ga0070710_100368553 219
180 3300005439 Ga0070711_100002923 Ga0070711_10000292316 219
181 3300005466 Ga0070685_10000781 Ga0070685_100007817 219
182 3300005539 Ga0068853_100000646 Ga0068853_10000064610 219
183 3300005544 Ga0070686_100029095 Ga0070686_1000290953 219
184 3300005548 Ga0070665_100012399 Ga0070665_1000123991 219
185 3300005564 Ga0070664_100031918 Ga0070664_1000319183 219
186 3300005615 Ga0070702_100024663 Ga0070702_1000246637 219
187 3300005616 Ga0068852_100034295 Ga0068852_1000342958 219
188 3300005617 Ga0068859_100009913 Ga0068859_10000991315 219
189 3300005618 Ga0068864_100003963 Ga0068864_10000396322 219
190 3300005618 Ga0068864_101037666 Ga0068864_1010376661 219
191 3300005834 Ga0068851_10524769 Ga0068851_105247691 219
192 3300005840 Ga0068870_10119689 Ga0068870_101196892 219
193 3300005841 Ga0068863_100006358 Ga0068863_1000063583 219
194 3300005842 Ga0068858_100027089 Ga0068858_1000270897 219
195 3300005843 Ga0068860_100127227 Ga0068860_1001272274 219
196 3300005983 Ga0081540_1016375 Ga0081540_10163754 219
197 3300005985 Ga0081539_10001260 Ga0081539_1000126013 219
198 3300006163 Ga0070715_10012733 Ga0070715_100127334 219
199 3300006173 Ga0070716_100013118 Ga0070716_1000131181 219
200 3300006175 Ga0070712_100004729 Ga0070712_1000047297 219
201 3300006237 Ga0097621_100149956 Ga0097621_1001499563 219
202 3300006358 Ga0068871_100190328 Ga0068871_1001903282 219
203 3300006871 Ga0075434_101015993 Ga0075434_1010159932 219
204 3300006931 Ga0097620_100009913 Ga0097620_10000991315 219
205 3300007076 Ga0075435_100109075 Ga0075435_1001090753 219
206 3300007265 Ga0099794_10061020 Ga0099794_100610201 219
207 3300007788 Ga0099795_10003893 Ga0099795_100038933 219
208 3300007788 Ga0099795_10178596 Ga0099795_101785961 219
209 3300009093 Ga0105240_10000086 Ga0105240_10000086108 219
210 3300009093 Ga0105240_10000105 Ga0105240_10000105110 219
211 3300009093 Ga0105240_10147283 Ga0105240_101472833 219
212 3300009093 Ga0105240_10346613 Ga0105240_103466132 219
213 3300009098 Ga0105245_10044224 Ga0105245_100442243 219
214 3300009101 Ga0105247_10001753 Ga0105247_1000175315 219
215 3300009147 Ga0114129_11645720 Ga0114129_116457201 219
216 3300009148 Ga0105243_10357890 Ga0105243_103578902 219
217 3300009174 Ga0105241_10029415 Ga0105241_100294153 219
218 3300009176 Ga0105242_10085986 Ga0105242_100859863 219
219 3300009176 Ga0105242_10165742 Ga0105242_101657424 219
220 3300009177 Ga0105248_10176986 Ga0105248_101769862 219
221 3300009177 Ga0105248_10185042 Ga0105248_101850423 219
222 3300009545 Ga0105237_10018159 Ga0105237_100181594 219
223 3300009545 Ga0105237_10393039 Ga0105237_103930392 219
224 3300009551 Ga0105238_10052033 Ga0105238_100520332 219
225 3300009551 Ga0105238_10053458 Ga0105238_100534583 219
226 3300009551 Ga0105238_10161956 Ga0105238_101619564 219
227 3300009553 Ga0105249_10093571 Ga0105249_100935712 219
228 3300010375 Ga0105239_10000313 Ga0105239_1000031359 219
229 3300010375 Ga0105239_10001195 Ga0105239_1000119524 219
230 3300010375 Ga0105239_10758576 Ga0105239_107585762 219
231 3300011119 Ga0105246_10032100 Ga0105246_100321002 219
232 3300013100 Ga0157373_10005182 Ga0157373_100051823 219
233 3300013104 Ga0157370_10333403 Ga0157370_103334031 219
234 3300013296 Ga0157374_10000002 Ga0157374_10000002573 219
235 3300013296 Ga0157374_10004115 Ga0157374_1000411521 219
236 3300013296 Ga0157374_10076001 Ga0157374_100760012 219
237 3300013296 Ga0157374_10374559 Ga0157374_103745592 219
238 3300013296 Ga0157374_10825432 Ga0157374_108254321 219
239 3300013297 Ga0157378_10043739 Ga0157378_100437393 219
240 3300013297 Ga0157378_10097786 Ga0157378_100977863 219
241 3300013297 Ga0157378_11365322 Ga0157378_113653221 219
242 3300013306 Ga0163162_10000109 Ga0163162_1000010954 219
243 3300013306 Ga0163162_10123692 Ga0163162_101236924 219
244 3300013306 Ga0163162_10123909 Ga0163162_101239094 219
245 3300013307 Ga0157372_10000617 Ga0157372_100006176 219
246 3300013308 Ga0157375_10189997 Ga0157375_101899973 219
247 3300013308 Ga0157375_10253028 Ga0157375_102530283 219
248 3300014325 Ga0163163_10014607 Ga0163163_1001460712 219
249 3300014968 Ga0157379_10000468 Ga0157379_1000046822 219
250 3300014969 Ga0157376_10087384 Ga0157376_100873844 219
251 3300014969 Ga0157376_10419978 Ga0157376_104199782 219
252 3300025261 Ga0209233_1020811 Ga0209233_10208112 219
253 3300025898 Ga0207692_10017644 Ga0207692_100176444 219
254 3300025900 Ga0207710_10050580 Ga0207710_100505803 219
255 3300025903 Ga0207680_10048250 Ga0207680_100482503 219
256 3300025913 Ga0207695_10000175 Ga0207695_1000017536 219
257 3300025913 Ga0207695_10000193 Ga0207695_1000019328 219
258 3300025913 Ga0207695_10021408 Ga0207695_100214084 219
259 3300025914 Ga0207671_10007762 Ga0207671_100077623 219
260 3300025915 Ga0207693_10000325 Ga0207693_1000032519 219
261 3300025916 Ga0207663_10053307 Ga0207663_100533074 219
262 3300025923 Ga0207681_10088041 Ga0207681_100880412 219
263 3300025924 Ga0207694_10061757 Ga0207694_100617573 219
264 3300025924 Ga0207694_10267824 Ga0207694_102678243 219
265 3300025925 Ga0207650_10038163 Ga0207650_100381637 219
266 3300025925 Ga0207650_10058175 Ga0207650_100581755 219
267 3300025927 Ga0207687_10065545 Ga0207687_100655453 219
268 3300025928 Ga0207700_10003146 Ga0207700_100031463 219
269 3300025931 Ga0207644_10032020 Ga0207644_100320206 219
270 3300025936 Ga0207670_10024025 Ga0207670_100240254 219
271 3300025936 Ga0207670_10236185 Ga0207670_102361852 219
272 3300025938 Ga0207704_10233293 Ga0207704_102332932 219
273 3300025941 Ga0207711_10000206 Ga0207711_1000020672 219
274 3300025960 Ga0207651_10003757 Ga0207651_100037576 219
275 3300025961 Ga0207712_10060602 Ga0207712_100606021 219
276 3300025986 Ga0207658_10027193 Ga0207658_100271936 219
277 3300026023 Ga0207677_10003774 Ga0207677_1000377411 219
278 3300026035 Ga0207703_10023517 Ga0207703_100235177 219
279 3300026078 Ga0207702_10075404 Ga0207702_100754043 219
280 3300026088 Ga0207641_10051358 Ga0207641_100513584 219
281 3300026095 Ga0207676_10006383 Ga0207676_100063837 219
282 3300026116 Ga0207674_10368114 Ga0207674_103681142 219
283 3300026116 Ga0207674_10739851 Ga0207674_107398512 219
284 3300026142 Ga0207698_10189854 Ga0207698_101898543 219
285 3300028379 Ga0268266_10039461 Ga0268266_100394613 219
286 3300028556 Ga0265337_1035008 Ga0265337_10350082 219
287 3300031250 Ga0265331_10115906 Ga0265331_101159062 219
288 3300031507 Ga0307509_10224400 Ga0307509_102244002 219
289 3300032133 Ga0316583_10025580 Ga0316583_100255802 219
290 3300032133 Ga0316583_10079002 Ga0316583_100790022 219
291 3300035083 Ga0373926_0038629 Ga0373926_0038629_564_1232 219
292 3300035086 Ga0373934_0007255 Ga0373934_0007255_3093_3761 219
293 3300035111 Ga0373923_0001540 Ga0373923_0001540_1111_1779 219
294 3300035116 Ga0373945_0051252 Ga0373945_0051252_96_764 219
295 3300035116 Ga0373945_0055299 Ga0373945_0055299_386_1054 219
296 3300035118 Ga0373954_0001962 Ga0373954_0001962_5272_5940 219
297 3300035120 Ga0373957_0014603 Ga0373957_0014603_459_1127 219
298 3300035170 Ga0373943_0011742 Ga0373943_0011742_558_1226 219
299 3300035170 Ga0373943_0022831 Ga0373943_0022831_702_1370 219
300 3300035172 Ga0373955_0039012 Ga0373955_0039012_1183_1851 219
301 3300035398 Ga0316574_0102859 Ga0316574_0102859_941_1603 219
302 3300035410 Ga0373924_0006655 Ga0373924_0006655_1135_1803 219
303 3300035691 Ga0373931_0139433 Ga0373931_0139433_17_685 219
304 3300035692 Ga0373935_0019528 Ga0373935_0019528_667_1335 219
305 3300035692 Ga0373935_0045754 Ga0373935_0045754_1958_2626 219
306 3300035695 Ga0373927_0132854 Ga0373927_0132854_498_1166 219
307 3300035695 Ga0373927_0428472 Ga0373927_0428472_127_795 219
308 3300035724 Ga0373933_0040262 Ga0373933_0040262_1211_1879 219
309 3300036401 Ga0373937_0007866 Ga0373937_0007866_4432_5100 219
310 3300036401 Ga0373937_0031181 Ga0373937_0031181_910_1578 219
311 3300037068 Ga0373925_0114800 Ga0373925_0114800_373_1041 219
312 3300037418 Ga0395900_0046658 Ga0395900_0046658_3171_3845 219
313 3300037466 Ga0395898_0440741 Ga0395898_0440741_400_1074 219
314 3300041512 Ga0451853_2023802 Ga0451853_2023802_180_839 219
315 3300042876 Ga0451577_0016862 Ga0451577_0016862_1102_1764 219
316 3300042876 Ga0451577_0599973 Ga0451577_0599973_66_728 219
317 3300044673 Ga0453683_0000162 Ga0453683_0000162_67930_68592 219
318 3300044673 Ga0453683_0020950 Ga0453683_0020950_138_800 219
319 3300044684 Ga0466966_0174210 Ga0466966_0174210_42_701 219
320 3300044706 Ga0466964_0133460 Ga0466964_0133460_417_1076 219
321 3300044712 Ga0453684_0000604 Ga0453684_0000604_35104_35766 219
322 3300044719 Ga0466971_0010042 Ga0466971_0010042_1806_2465 219
323 3300044765 Ga0466970_0033032 Ga0466970_0033032_1552_2211 219
324 3300044765 Ga0466970_0103862 Ga0466970_0103862_850_1509 219
325 3300045051 Ga0451576_0000299 Ga0451576_0000299_20782_21444 219
326 3300045051 Ga0451576_0000913 Ga0451576_0000913_36331_36993 219
327 3300046454 Ga0495592_0090373 Ga0495592_0090373_632_1294 219
328 3300046454 Ga0495592_0090393 Ga0495592_0090393_123_791 219
329 3300046460 Ga0495638_0188481 Ga0495638_0188481_15_674 219
330 3300046472 Ga0495580_0011883 Ga0495580_0011883_4226_4894 219
331 3300046472 Ga0495580_0035198 Ga0495580_0035198_2211_2879 219
332 3300046475 Ga0495639_0027892 Ga0495639_0027892_915_1583 219
333 3300046476 Ga0495662_0092595 Ga0495662_0092595_791_1459 219
334 3300046499 Ga0495594_0037284 Ga0495594_0037284_1000_1668 219
335 3300046506 Ga0495583_0054967 Ga0495583_0054967_368_1117 219
336 3300046507 Ga0495606_0213470 Ga0495606_0213470_389_1048 219
337 3300046517 Ga0495630_0043941 Ga0495630_0043941_519_1187 219
338 3300046531 Ga0495665_0023392 Ga0495665_0023392_152_820 219
339 3300046533 Ga0495640_0063064 Ga0495640_0063064_1597_2265 219
340 3300046533 Ga0495640_0083681 Ga0495640_0083681_834_1502 219
341 3300046535 Ga0495586_0046787 Ga0495586_0046787_1557_2225 219
342 3300046538 Ga0495609_0048952 Ga0495609_0048952_19_687 219
343 3300046543 Ga0495645_0023230 Ga0495645_0023230_3299_3967 219
344 3300046543 Ga0495645_0040280 Ga0495645_0040280_274_942 219
345 3300046559 Ga0495667_0092936 Ga0495667_0092936_102_770 219
346 3300046616 Ga0495668_0000526 Ga0495668_0000526_20252_20911 219
347 3300046642 Ga0495634_0032823 Ga0495634_0032823_2698_3360 219
348 3300046663 Ga0495635_0054562 Ga0495635_0054562_721_1389 219
349 3300046674 Ga0495588_0199789 Ga0495588_0199789_258_926 219
350 3300046679 Ga0495623_0090135 Ga0495623_0090135_572_1240 219
351 3300046681 Ga0495647_0040939 Ga0495647_0040939_177_845 219
352 3300046683 Ga0495658_0025524 Ga0495658_0025524_1239_1907 219
353 3300046689 Ga0495613_0046901 Ga0495613_0046901_1507_2175 219
354 3300046694 Ga0495649_0032766 Ga0495649_0032766_1135_1794 219
355 3300047315 Ga0495581_0000884 Ga0495581_0000884_365_1033 219
356 3300047317 Ga0495604_0202754 Ga0495604_0202754_521_1189 219
357 3300047319 Ga0495674_0056639 Ga0495674_0056639_618_1286 219
358 3300047322 Ga0495680_0089986 Ga0495680_0089986_1072_1740 219
359 3300047471 Ga0495684_0049551 Ga0495684_0049551_1266_1934 219
360 3300047471 Ga0495684_0285805 Ga0495684_0285805_473_1141 219
361 3300047673 Ga0495593_0045865 Ga0495593_0045865_105_773 219
362 3300048088 Ga0495602_0236243 Ga0495602_0236243_247_915 219
363 3300048908 Ga0496105_0102834 Ga0496105_0102834_718_1386 219
364 3300048910 Ga0496107_0021378 Ga0496107_0021378_2108_2776 219
365 3300048911 Ga0496108_0360945 Ga0496108_0360945_256_924 219
366 3300048912 Ga0496109_0002530 Ga0496109_0002530_9676_10344 219
367 3300048917 Ga0496114_0011119 Ga0496114_0011119_2346_3014 219
368 3300048918 Ga0496115_0291375 Ga0496115_0291375_108_767 219
369 3300049581 Ga0501047_0424817 Ga0501047_0424817_389_1051 219
370 3300049744 Ga0501083_0098944 Ga0501083_0098944_1023_1682 219
371 3300050512 nmdc:mga0n895_870595_c1 nmdc:mga0n895_870595_c1_116_784 219
372 3300050513 nmdc:mga0rr50_70638_c1 nmdc:mga0rr50_70638_c1_660_1328 219
373 3300053077 Ga0495601_0141515 Ga0495601_0141515_826_1494 219
374 3300053085 Ga0495619_0001956 Ga0495619_0001956_10548_11216 219
375 3300053086 Ga0500578_0209412 Ga0500578_0209412_129_788 219
376 3300053090 Ga0500646_0028536 Ga0500646_0028536_624_1283 219
377 3300053104 Ga0500556_0018576 Ga0500556_0018576_50_709 219
378 3300053125 Ga0500618_000010 Ga0500618_000010_11211_11870 219
379 3300053130 Ga0500642_0026381 Ga0500642_0026381_1653_2312 219
380 3300053142 Ga0500577_0039752 Ga0500577_0039752_207_866 219
381 3300053158 Ga0500627_0040170 Ga0500627_0040170_1047_1706 219
382 3300053727 Ga0500611_000026 Ga0500611_000026_85788_86453 219
383 3300053731 Ga0500609_025558 Ga0500609_025558_95_754 219
384 iso_pu_bacteria 2576861424 2578338325 219
385 iso_pu_bacteria 2928078545 2928082429 219
386 iso_pu_bacteria 2971511577 2971515955 219
387 iso_pu_bacteria 2980176882 2980177832 219
388 3300005334 Ga0068869_100252278 Ga0068869_1002522781 220
389 3300005340 Ga0070689_100475685 Ga0070689_1004756851 220
390 3300005471 Ga0070698_100038618 Ga0070698_1000386184 220
391 3300005471 Ga0070698_100221929 Ga0070698_1002219292 220
392 3300005535 Ga0070684_100696572 Ga0070684_1006965722 220
393 3300005539 Ga0068853_100273875 Ga0068853_1002738752 220
394 3300005546 Ga0070696_100586616 Ga0070696_1005866161 220
395 3300005617 Ga0068859_100558125 Ga0068859_1005581252 220
396 3300005718 Ga0068866_10431738 Ga0068866_104317381 220
397 3300005841 Ga0068863_100009757 Ga0068863_1000097578 220
398 3300005841 Ga0068863_100022841 Ga0068863_1000228415 220
399 3300005843 Ga0068860_100419440 Ga0068860_1004194402 220
400 3300006237 Ga0097621_100021134 Ga0097621_1000211342 220
401 3300006358 Ga0068871_100020140 Ga0068871_1000201404 220
402 3300006358 Ga0068871_100474042 Ga0068871_1004740421 220
403 3300006881 Ga0068865_100285083 Ga0068865_1002850832 220
404 3300006881 Ga0068865_100298407 Ga0068865_1002984072 220
405 3300006931 Ga0097620_100558105 Ga0097620_1005581052 220
406 3300009094 Ga0111539_10215628 Ga0111539_102156282 220
407 3300009094 Ga0111539_10956453 Ga0111539_109564532 220
408 3300009147 Ga0114129_10050326 Ga0114129_100503264 220
409 3300009176 Ga0105242_10003372 Ga0105242_100033726 220
410 3300009176 Ga0105242_10079663 Ga0105242_100796632 220
411 3300009176 Ga0105242_10711151 Ga0105242_107111511 220
412 3300009545 Ga0105237_10042009 Ga0105237_100420092 220
413 3300009553 Ga0105249_10025511 Ga0105249_100255113 220
414 3300009553 Ga0105249_11374990 Ga0105249_113749901 220
415 3300013296 Ga0157374_10160388 Ga0157374_101603882 220
416 3300013296 Ga0157374_10821754 Ga0157374_108217541 220
417 3300013297 Ga0157378_10376281 Ga0157378_103762812 220
418 3300013306 Ga0163162_10143214 Ga0163162_101432142 220
419 3300013306 Ga0163162_11619759 Ga0163162_116197591 220
420 3300014326 Ga0157380_10451450 Ga0157380_104514502 220
421 3300014326 Ga0157380_10589861 Ga0157380_105898611 220
422 3300014969 Ga0157376_10042301 Ga0157376_100423017 220
423 3300025893 Ga0207682_10285115 Ga0207682_102851151 220
424 3300025899 Ga0207642_10443876 Ga0207642_104438761 220
425 3300025908 Ga0207643_10237953 Ga0207643_102379531 220
426 3300025914 Ga0207671_10285179 Ga0207671_102851792 220
427 3300025934 Ga0207686_10002988 Ga0207686_100029883 220
428 3300025934 Ga0207686_10121214 Ga0207686_101212142 220
429 3300025938 Ga0207704_10357423 Ga0207704_103574232 220
430 3300025942 Ga0207689_10581395 Ga0207689_105813951 220
431 3300025949 Ga0207667_10180715 Ga0207667_101807153 220
432 3300025961 Ga0207712_10023889 Ga0207712_100238895 220
433 3300026078 Ga0207702_10015550 Ga0207702_100155504 220
434 3300026088 Ga0207641_10000371 Ga0207641_1000037145 220
435 3300026088 Ga0207641_10041694 Ga0207641_100416945 220
436 3300026089 Ga0207648_10205080 Ga0207648_102050802 220
437 3300026116 Ga0207674_10099645 Ga0207674_100996451 220
438 3300026118 Ga0207675_100308155 Ga0207675_1003081552 220
439 3300028380 Ga0268265_10098247 Ga0268265_100982472 220
440 3300028381 Ga0268264_10406590 Ga0268264_104065902 220
441 3300028573 Ga0265334_10106084 Ga0265334_101060841 220
442 3300028666 Ga0265336_10032732 Ga0265336_100327322 220
443 3300028800 Ga0265338_10003080 Ga0265338_1000308016 220
444 3300028800 Ga0265338_10180041 Ga0265338_101800413 220
445 3300028800 Ga0265338_10378283 Ga0265338_103782832 220
446 3300031344 Ga0265316_10005277 Ga0265316_100052773 220
447 3300035695 Ga0373927_0032592 Ga0373927_0032592_508_1173 220
448 3300041406 Ga0439439_0001900 Ga0439439_0001900_2993_3658 220
449 3300041441 Ga0451787_341172 Ga0451787_341172_26_688 220
450 3300041496 Ga0451839_0695238 Ga0451839_0695238_156_821 220
451 3300041505 Ga0451849_1366099 Ga0451849_1366099_534_1325 220
452 3300041509 Ga0451843_1210020 Ga0451843_1210020_138_803 220
453 3300042014 Ga0439457_001015 Ga0439457_001015_3292_3957 220
454 3300044658 Ga0466972_0000075 Ga0466972_0000075_53270_53935 220
455 3300044658 Ga0466972_0012429 Ga0466972_0012429_1475_2140 220
456 3300044842 Ga0466957_0008518 Ga0466957_0008518_1232_1897 220
457 3300046539 Ga0495621_0081033 Ga0495621_0081033_80_745 220
458 3300046660 Ga0495625_0061260 Ga0495625_0061260_44_715 220
459 3300049581 Ga0501047_0020598 Ga0501047_0020598_4029_4694 220
460 3300049581 Ga0501047_0388716 Ga0501047_0388716_537_1202 220
461 3300049582 Ga0501048_0323869 Ga0501048_0323869_68_733 220
462 3300049661 Ga0501217_018075 Ga0501217_018075_870_1544 220
463 3300049669 Ga0501235_080771 Ga0501235_080771_82_747 220
464 3300049705 Ga0501225_0010633 Ga0501225_0010633_349_1014 220
465 3300049823 Ga0501044_0024091 Ga0501044_0024091_5330_5995 220
466 3300050493 nmdc:mga0k408_59567_c1 nmdc:mga0k408_59567_c1_1090_1755 220
467 3300050507 nmdc:mga05p37_10194_c2 nmdc:mga05p37_10194_c2_546_1211 220
468 3300053086 Ga0500578_0000091 Ga0500578_0000091_80463_81128 220
469 3300053086 Ga0500578_0021779 Ga0500578_0021779_956_1621 220
470 3300053088 Ga0500644_0035139 Ga0500644_0035139_671_1336 220
471 3300053089 Ga0500581_215700 Ga0500581_215700_63_728 220
472 3300053092 Ga0500583_0000011 Ga0500583_0000011_100734_101399 220
473 3300053103 Ga0500555_016697 Ga0500555_016697_821_1486 220
474 3300053115 Ga0500591_073448 Ga0500591_073448_54_716 220
475 3300053150 Ga0500603_096533 Ga0500603_096533_23_688 220
476 3300053153 Ga0500616_0004297 Ga0500616_0004297_9083_9787 220
477 3300053156 Ga0500622_0000844 Ga0500622_0000844_13527_14192 220
478 3300053156 Ga0500622_0001136 Ga0500622_0001136_71_742 220
479 3300053159 Ga0500630_088313 Ga0500630_088313_142_804 220
480 3300003320 rootH2_10094573 rootH2_100945731 221
481 3300003322 rootL2_10061803 rootL2_100618035 221
482 3300003322 rootL2_10195108 rootL2_101951083 221
483 3300010375 Ga0105239_10029591 Ga0105239_100295914 221
484 3300028666 Ga0265336_10000003 Ga0265336_10000003293 221
485 3300029957 Ga0265324_10001536 Ga0265324_100015365 221
486 3300031344 Ga0265316_10000246 Ga0265316_1000024636 221
487 3300031548 Ga0307408_100884888 Ga0307408_1008848881 221
488 3300044656 Ga0466969_0000371 Ga0466969_0000371_5042_5710 221
489 3300044684 Ga0466966_0000131 Ga0466966_0000131_26632_27300 221
490 3300044693 Ga0466961_0060382 Ga0466961_0060382_126_794 221
491 3300045049 Ga0466959_0000003 Ga0466959_0000003_42069_42737 221
492 3300049652 Ga0501202_008218 Ga0501202_008218_856_1533 221
493 3300049670 Ga0501236_000930 Ga0501236_000930_2497_3174 221
494 3300049674 Ga0501242_000387 Ga0501242_000387_2370_3044 221
495 3300049686 Ga0501257_000158 Ga0501257_000158_4278_4952 221
496 3300049686 Ga0501257_000385 Ga0501257_000385_5040_5717 221
497 3300049705 Ga0501225_0004322 Ga0501225_0004322_2631_3305 221
498 3300049761 Ga0501264_000543 Ga0501264_000543_1708_2385 221
499 3300049761 Ga0501264_005145 Ga0501264_005145_469_1143 221
500 3300053136 Ga0500559_0008054 Ga0500559_0008054_2634_3299 221
501 3300053138 Ga0500564_124461 Ga0500564_124461_108_773 221
502 3300002705 JGI25156J39149_1016866 JGI25156J39149_10168662 222
503 3300003322 rootL2_10206004 rootL2_102060041 222
504 3300003761 Ga0055535_1000403 Ga0055535_100040332 222
505 3300003763 Ga0055529_1000195 Ga0055529_100019532 222
506 3300003794 Ga0055531_10000354 Ga0055531_100003544 222
507 3300005293 Ga0065715_10089350 Ga0065715_100893501 222
508 3300005327 Ga0070658_10063567 Ga0070658_100635673 222
509 3300005339 Ga0070660_100082318 Ga0070660_1000823182 222
510 3300005364 Ga0070673_100114620 Ga0070673_1001146201 222
511 3300005364 Ga0070673_100579038 Ga0070673_1005790382 222
512 3300005366 Ga0070659_100247317 Ga0070659_1002473171 222
513 3300005435 Ga0070714_100000097 Ga0070714_10000009764 222
514 3300005616 Ga0068852_100376449 Ga0068852_1003764492 222
515 3300009093 Ga0105240_10009554 Ga0105240_100095545 222
516 3300009094 Ga0111539_10007729 Ga0111539_1000772913 222
517 3300009545 Ga0105237_10450313 Ga0105237_104503131 222
518 3300013104 Ga0157370_10015764 Ga0157370_100157645 222
519 3300013306 Ga0163162_10009385 Ga0163162_100093853 222
520 3300013307 Ga0157372_11435024 Ga0157372_114350241 222
521 3300014326 Ga0157380_10100131 Ga0157380_101001312 222
522 3300014326 Ga0157380_10212465 Ga0157380_102124651 222
523 3300014326 Ga0157380_11242165 Ga0157380_112421651 222
524 3300025228 Ga0209672_102553 Ga0209672_1025532 222
525 3300025242 Ga0209258_100291 Ga0209258_10029134 222
526 3300025256 Ga0209759_1000522 Ga0209759_100052222 222
527 3300025256 Ga0209759_1000641 Ga0209759_100064110 222
528 3300025272 Ga0209455_1000208 Ga0209455_100020840 222
529 3300025292 Ga0209676_1000425 Ga0209676_100042568 222
530 3300025304 Ga0209257_1000008 Ga0209257_1000008980 222
531 3300025909 Ga0207705_10045960 Ga0207705_100459602 222
532 3300025929 Ga0207664_10000078 Ga0207664_100000789 222
533 3300025949 Ga0207667_10048420 Ga0207667_100484203 222
534 3300025960 Ga0207651_10006731 Ga0207651_100067315 222
535 3300026142 Ga0207698_10421763 Ga0207698_104217632 222
536 3300028379 Ga0268266_10000088 Ga0268266_10000088108 222
537 3300031344 Ga0265316_10183976 Ga0265316_101839762 222
538 3300031548 Ga0307408_100001708 Ga0307408_1000017084 222
539 3300031712 Ga0265342_10124039 Ga0265342_101240392 222
540 3300042876 Ga0451577_0292794 Ga0451577_0292794_556_1302 222
541 3300044712 Ga0453684_0004825 Ga0453684_0004825_654_1400 222
542 3300044765 Ga0466970_0008141 Ga0466970_0008141_4524_5222 222
543 3300045049 Ga0466959_0052730 Ga0466959_0052730_1449_2132 222
544 3300045051 Ga0451576_0002946 Ga0451576_0002946_22763_23509 222
545 3300046462 Ga0495651_0309763 Ga0495651_0309763_254_922 222
546 3300046471 Ga0495650_0007871 Ga0495650_0007871_3701_4369 222
547 3300046475 Ga0495639_0004602 Ga0495639_0004602_719_1387 222
548 3300046648 Ga0495611_0240959 Ga0495611_0240959_72_752 222
549 3300047472 Ga0495686_0016151 Ga0495686_0016151_2754_3422 222
550 3300048929 Ga0496126_0026690 Ga0496126_0026690_205_924 222
551 3300050511 nmdc:mga08y16_47211_c1 nmdc:mga08y16_47211_c1_593_1285 222
552 3300053080 Ga0500635_0000267 Ga0500635_0000267_187_858 222
553 3300053090 Ga0500646_0105765 Ga0500646_0105765_97_777 222
554 3300053156 Ga0500622_0018143 Ga0500622_0018143_641_1321 222
555 iso_pu_bacteria 2884791551 2884793298 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

47

171

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fmu-assembly1.cif.gz_A crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution 0.852 2 217
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.8014 3 156
4ivm-assembly1.cif.gz_B structure of human protoporphyrinogen ix oxidase(r59g) 0.7917 3 34
4ivo-assembly1.cif.gz_B structure of human protoporphyrinogen ix oxidase(r59q) 0.7895 3 34
5f5l-assembly1.cif.gz_A the structure of monooxygenase ksta11 in the biosynthetic pathway of kosinostatin 0.7857 1 154
ID Description Score Start End Superfamily
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 2 218 3.40.50.720
af_Q54WF5_27_272_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 2 218 3.40.50.720
2fmuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.852 2 217 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8332 3 219 3.40.50.720
af_Q5AP65_1_228_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8125 3 219 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A833AP09-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9873 2 75
AF-A0A7Y2MTA3-F1-model_v4 Epimerase 0.9847 3 106
AF-A0A519GZU2-F1-model_v4 Epimerase 0.983 3 110
AF-A0A519MFY1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9829 1 112
AF-A0A519SIT4-F1-model_v4 Epimerase 0.9827 1 221

Feature Viewer

pLDDT pTM Quality
93.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map