F463130
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 555 | 337 | 539 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300041505|Ga0451849_1366099|Ga0451849_1366099_534_1325 |
| Length | 263 |
| Sequence | LSKQCSGIIFKSLNDIAESGNTINKEDQQTVLINVIILDNHYMKIKAIITGASGMVGEGVLHECLLHPDVEEVLVIGRRTAGVIHPKLKEILHSDFFDLSAVKDQLKGYNACFFCLGVSSVGMNEKDYHHLTYDLTMHMATILADQDPDMTFCYVSGAGTDSSEHGKMMWARVKGQTENDLMRLPFKAAYMFRPGFMRPTKGLKNTLKGYKFIAWLYPVLRPMFPKFISTLQELGLAMINAAVKGYDKRVLEVKDIVKLAHTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 2 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 3 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 4 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 5 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 6 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 7 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 8 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 9 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 10 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 11 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 12 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 13 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 14 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 15 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 16 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 17 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 20 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 21 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 193 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 223 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 225 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 226 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 227 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 228 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 241 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 295 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 298 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 299 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 319 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 320 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 322 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 323 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 328 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 329 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 330 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 333 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 336 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 0 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.29 |
| Nodule | 0.18 |
| Rhizoplane | 1.62 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1016866 | 3300002705 | Bacteria | 1406 |
| 2 | JGI25406J46586_10013534 | 3300003203 | Bacteria | 3499 |
| 3 | rootH1_10007168 | 3300003316 | Bacteria | 12241 |
| 4 | rootH2_10010421 | 3300003320 | Bacteria | 28080 |
| 5 | rootH2_10094573 | 3300003320 | Unclassified | 1132 |
| 6 | rootL2_10035743 | 3300003322 | Bacteria | 3231 |
| 7 | rootL2_10061803 | 3300003322 | Bacteria | 7572 |
| 8 | rootL2_10195108 | 3300003322 | Unclassified | 3695 |
| 9 | rootL2_10206004 | 3300003322 | Bacteria | 4426 |
| 10 | rootH1_10312291 | 3300003323 | Bacteria | 1808 |
| 11 | Ga0055535_1000403 | 3300003761 | Bacteria | 40654 |
| 12 | Ga0055529_1000195 | 3300003763 | Bacteria | 82315 |
| 13 | Ga0055531_10000354 | 3300003794 | Bacteria | 44915 |
| 14 | Ga0065712_10013630 | 3300005290 | Bacteria | 1970 |
| 15 | Ga0065715_10089350 | 3300005293 | Bacteria | 10967 |
| 16 | Ga0070658_10063567 | 3300005327 | Bacteria | 3009 |
| 17 | Ga0070683_100083755 | 3300005329 | Bacteria | 2987 |
| 18 | Ga0070670_100009312 | 3300005331 | Bacteria | 8390 |
| 19 | Ga0070670_100377202 | 3300005331 | Bacteria | 1249 |
| 20 | Ga0068869_100026153 | 3300005334 | Unclassified | 4060 |
| 21 | Ga0068869_100252278 | 3300005334 | Bacteria | 1409 |
| 22 | Ga0070666_10026815 | 3300005335 | Unclassified | 3768 |
| 23 | Ga0068868_100034831 | 3300005338 | Unclassified | 3889 |
| 24 | Ga0068868_100120953 | 3300005338 | Bacteria | 2135 |
| 25 | Ga0068868_100419821 | 3300005338 | Bacteria | 1158 |
| 26 | Ga0070660_100082318 | 3300005339 | Bacteria | 2527 |
| 27 | Ga0070689_100000405 | 3300005340 | Bacteria | 25370 |
| 28 | Ga0070689_100475685 | 3300005340 | Bacteria | 1066 |
| 29 | Ga0070669_100066337 | 3300005353 | Bacteria | 2660 |
| 30 | Ga0070669_100670907 | 3300005353 | Bacteria | 873 |
| 31 | Ga0070675_100395322 | 3300005354 | Bacteria | 1232 |
| 32 | Ga0070675_100404420 | 3300005354 | Bacteria | 1218 |
| 33 | Ga0070675_100884961 | 3300005354 | Bacteria | 818 |
| 34 | Ga0070671_100014853 | 3300005355 | Bacteria | 6291 |
| 35 | Ga0070671_100127533 | 3300005355 | Bacteria | 2142 |
| 36 | Ga0070674_100000708 | 3300005356 | Bacteria | 16973 |
| 37 | Ga0070673_100003821 | 3300005364 | Bacteria | 9450 |
| 38 | Ga0070673_100030671 | 3300005364 | Bacteria | 4028 |
| 39 | Ga0070673_100114620 | 3300005364 | Bacteria | 2240 |
| 40 | Ga0070673_100579038 | 3300005364 | Bacteria | 1022 |
| 41 | Ga0070688_100000683 | 3300005365 | Bacteria | 16890 |
| 42 | Ga0070688_100087414 | 3300005365 | Bacteria | 2030 |
| 43 | Ga0070688_100134287 | 3300005365 | Bacteria | 1673 |
| 44 | Ga0070659_100247317 | 3300005366 | Bacteria | 1477 |
| 45 | Ga0070667_100007792 | 3300005367 | Bacteria | 8878 |
| 46 | Ga0070667_100025827 | 3300005367 | Bacteria | 4885 |
| 47 | Ga0070709_10003881 | 3300005434 | Bacteria | 8057 |
| 48 | Ga0070714_100000097 | 3300005435 | Bacteria | 74184 |
| 49 | Ga0070714_100774609 | 3300005435 | Bacteria | 928 |
| 50 | Ga0070713_100000967 | 3300005436 | Bacteria | 18403 |
| 51 | Ga0070710_10036855 | 3300005437 | Bacteria | 2676 |
| 52 | Ga0070710_10076912 | 3300005437 | Bacteria | 1938 |
| 53 | Ga0070711_100002923 | 3300005439 | Bacteria | 9845 |
| 54 | Ga0070678_100016413 | 3300005456 | Unclassified | 4738 |
| 55 | Ga0070662_100019588 | 3300005457 | Bacteria | 4595 |
| 56 | Ga0070685_10000781 | 3300005466 | Bacteria | 17262 |
| 57 | Ga0070698_100004733 | 3300005471 | Bacteria | 14948 |
| 58 | Ga0070698_100038618 | 3300005471 | Bacteria | 4918 |
| 59 | Ga0070698_100221929 | 3300005471 | Bacteria | 1823 |
| 60 | Ga0070698_100759031 | 3300005471 | Bacteria | 913 |
| 61 | Ga0070699_100564891 | 3300005518 | Bacteria | 1036 |
| 62 | Ga0070684_100664856 | 3300005535 | Bacteria | 970 |
| 63 | Ga0070684_100696572 | 3300005535 | Bacteria | 947 |
| 64 | Ga0068853_100000646 | 3300005539 | Bacteria | 23892 |
| 65 | Ga0068853_100273875 | 3300005539 | Bacteria | 1555 |
| 66 | Ga0070672_100335002 | 3300005543 | Bacteria | 1288 |
| 67 | Ga0070686_100029095 | 3300005544 | Bacteria | 3356 |
| 68 | Ga0070696_100586616 | 3300005546 | Bacteria | 897 |
| 69 | Ga0070693_100002460 | 3300005547 | Bacteria | 8532 |
| 70 | Ga0070665_100012399 | 3300005548 | Bacteria | 8591 |
| 71 | Ga0070664_100031918 | 3300005564 | Bacteria | 4405 |
| 72 | Ga0068857_100171981 | 3300005577 | Bacteria | 1969 |
| 73 | Ga0068854_100043287 | 3300005578 | Bacteria | 3191 |
| 74 | Ga0070702_100024663 | 3300005615 | Bacteria | 3211 |
| 75 | Ga0070702_100103989 | 3300005615 | Bacteria | 1747 |
| 76 | Ga0068852_100034295 | 3300005616 | Bacteria | 4221 |
| 77 | Ga0068852_100249772 | 3300005616 | Bacteria | 1699 |
| 78 | Ga0068852_100376449 | 3300005616 | Bacteria | 1392 |
| 79 | Ga0068859_100009913 | 3300005617 | Bacteria | 9622 |
| 80 | Ga0068859_100059804 | 3300005617 | Bacteria | 3839 |
| 81 | Ga0068859_100250225 | 3300005617 | Bacteria | 1863 |
| 82 | Ga0068859_100558125 | 3300005617 | Bacteria | 1239 |
| 83 | Ga0068864_100003963 | 3300005618 | Bacteria | 12193 |
| 84 | Ga0068864_101037666 | 3300005618 | Bacteria | 814 |
| 85 | Ga0068866_10003539 | 3300005718 | Bacteria | 6398 |
| 86 | Ga0068866_10431738 | 3300005718 | Bacteria | 857 |
| 87 | Ga0068861_100340420 | 3300005719 | Bacteria | 1312 |
| 88 | Ga0068851_10524769 | 3300005834 | Unclassified | 713 |
| 89 | Ga0068870_10119689 | 3300005840 | Unclassified | 1515 |
| 90 | Ga0068863_100006358 | 3300005841 | Bacteria | 11585 |
| 91 | Ga0068863_100009757 | 3300005841 | Bacteria | 9362 |
| 92 | Ga0068863_100022841 | 3300005841 | Bacteria | 5976 |
| 93 | Ga0068863_100772731 | 3300005841 | Bacteria | 957 |
| 94 | Ga0068858_100027089 | 3300005842 | Bacteria | 5324 |
| 95 | Ga0068858_100177274 | 3300005842 | Bacteria | 2011 |
| 96 | Ga0068860_100043274 | 3300005843 | Bacteria | 4297 |
| 97 | Ga0068860_100127227 | 3300005843 | Unclassified | 2442 |
| 98 | Ga0068860_100276783 | 3300005843 | Bacteria | 1639 |
| 99 | Ga0068860_100419440 | 3300005843 | Bacteria | 1326 |
| 100 | Ga0068860_101196616 | 3300005843 | Bacteria | 780 |
| 101 | Ga0081540_1016375 | 3300005983 | Unclassified | 4642 |
| 102 | Ga0081539_10001260 | 3300005985 | Bacteria | 44845 |
| 103 | Ga0081539_10023221 | 3300005985 | Bacteria | 4070 |
| 104 | Ga0070715_10012733 | 3300006163 | Unclassified | 3071 |
| 105 | Ga0070716_100013118 | 3300006173 | Bacteria | 4217 |
| 106 | Ga0070716_100155378 | 3300006173 | Bacteria | 1476 |
| 107 | Ga0070712_100004729 | 3300006175 | Bacteria | 8421 |
| 108 | Ga0075369_10113311 | 3300006186 | Bacteria | 1223 |
| 109 | Ga0075366_10085740 | 3300006195 | Bacteria | 1884 |
| 110 | Ga0097621_100021134 | 3300006237 | Bacteria | 5026 |
| 111 | Ga0097621_100149956 | 3300006237 | Unclassified | 1999 |
| 112 | Ga0068871_100020140 | 3300006358 | Bacteria | 5105 |
| 113 | Ga0068871_100086251 | 3300006358 | Unclassified | 2608 |
| 114 | Ga0068871_100190328 | 3300006358 | Unclassified | 1767 |
| 115 | Ga0068871_100474042 | 3300006358 | Bacteria | 1125 |
| 116 | Ga0068871_100761050 | 3300006358 | Bacteria | 891 |
| 117 | Ga0075428_100233698 | 3300006844 | Bacteria | 1984 |
| 118 | Ga0075428_100375066 | 3300006844 | Bacteria | 1525 |
| 119 | Ga0075428_100675792 | 3300006844 | Bacteria | 1100 |
| 120 | Ga0075430_100053072 | 3300006846 | Bacteria | 3414 |
| 121 | Ga0075430_100213910 | 3300006846 | Unclassified | 1599 |
| 122 | Ga0075431_100062466 | 3300006847 | Bacteria | 3843 |
| 123 | Ga0075434_101015993 | 3300006871 | Unclassified | 843 |
| 124 | Ga0075429_100004703 | 3300006880 | Bacteria | 11747 |
| 125 | Ga0075429_100159934 | 3300006880 | Unclassified | 1972 |
| 126 | Ga0068865_100013441 | 3300006881 | Bacteria | 5171 |
| 127 | Ga0068865_100285083 | 3300006881 | Bacteria | 1316 |
| 128 | Ga0068865_100298407 | 3300006881 | Bacteria | 1289 |
| 129 | Ga0097620_100009913 | 3300006931 | Bacteria | 9622 |
| 130 | Ga0097620_100059798 | 3300006931 | Bacteria | 3839 |
| 131 | Ga0097620_100250223 | 3300006931 | Bacteria | 1863 |
| 132 | Ga0097620_100558105 | 3300006931 | Bacteria | 1239 |
| 133 | Ga0075435_100109075 | 3300007076 | Bacteria | 2300 |
| 134 | Ga0099794_10061020 | 3300007265 | Bacteria | 1832 |
| 135 | Ga0099795_10003893 | 3300007788 | Bacteria | 3767 |
| 136 | Ga0099795_10178596 | 3300007788 | Bacteria | 885 |
| 137 | Ga0105240_10000086 | 3300009093 | Bacteria | 188623 |
| 138 | Ga0105240_10000105 | 3300009093 | Bacteria | 172035 |
| 139 | Ga0105240_10009554 | 3300009093 | Bacteria | 13730 |
| 140 | Ga0105240_10147283 | 3300009093 | Unclassified | 2808 |
| 141 | Ga0105240_10346613 | 3300009093 | Bacteria | 1686 |
| 142 | Ga0111539_10007729 | 3300009094 | Bacteria | 13732 |
| 143 | Ga0111539_10215628 | 3300009094 | Bacteria | 2236 |
| 144 | Ga0111539_10781835 | 3300009094 | Bacteria | 1111 |
| 145 | Ga0111539_10956453 | 3300009094 | Bacteria | 996 |
| 146 | Ga0105245_10044224 | 3300009098 | Bacteria | 3974 |
| 147 | Ga0105247_10001753 | 3300009101 | Bacteria | 15274 |
| 148 | Ga0114129_10050326 | 3300009147 | Bacteria | 5852 |
| 149 | Ga0114129_10175389 | 3300009147 | Bacteria | 2920 |
| 150 | Ga0114129_11645720 | 3300009147 | Unclassified | 785 |
| 151 | Ga0105243_10357890 | 3300009148 | Unclassified | 1342 |
| 152 | Ga0105241_10029415 | 3300009174 | Bacteria | 4099 |
| 153 | Ga0105242_10003372 | 3300009176 | Bacteria | 12431 |
| 154 | Ga0105242_10079663 | 3300009176 | Bacteria | 2736 |
| 155 | Ga0105242_10085986 | 3300009176 | Bacteria | 2638 |
| 156 | Ga0105242_10165742 | 3300009176 | Unclassified | 1938 |
| 157 | Ga0105242_10711151 | 3300009176 | Unclassified | 984 |
| 158 | Ga0105248_10176986 | 3300009177 | Bacteria | 2404 |
| 159 | Ga0105248_10185042 | 3300009177 | Bacteria | 2347 |
| 160 | Ga0105248_10468519 | 3300009177 | Bacteria | 1420 |
| 161 | Ga0105237_10018159 | 3300009545 | Bacteria | 7282 |
| 162 | Ga0105237_10042009 | 3300009545 | Bacteria | 4611 |
| 163 | Ga0105237_10393039 | 3300009545 | Bacteria | 1391 |
| 164 | Ga0105237_10450313 | 3300009545 | Bacteria | 1293 |
| 165 | Ga0105237_10689220 | 3300009545 | Bacteria | 1028 |
| 166 | Ga0105238_10052033 | 3300009551 | Bacteria | 4117 |
| 167 | Ga0105238_10053458 | 3300009551 | Bacteria | 4058 |
| 168 | Ga0105238_10161956 | 3300009551 | Bacteria | 2213 |
| 169 | Ga0105249_10025511 | 3300009553 | Bacteria | 5322 |
| 170 | Ga0105249_10093571 | 3300009553 | Unclassified | 2816 |
| 171 | Ga0105249_11374990 | 3300009553 | Bacteria | 778 |
| 172 | Ga0105239_10000313 | 3300010375 | Bacteria | 71404 |
| 173 | Ga0105239_10001195 | 3300010375 | Bacteria | 35500 |
| 174 | Ga0105239_10029591 | 3300010375 | Bacteria | 6022 |
| 175 | Ga0105239_10758576 | 3300010375 | Unclassified | 1111 |
| 176 | Ga0105246_10032100 | 3300011119 | Bacteria | 3480 |
| 177 | Ga0157373_10005182 | 3300013100 | Bacteria | 9795 |
| 178 | Ga0157370_10015764 | 3300013104 | Bacteria | 7670 |
| 179 | Ga0157370_10333403 | 3300013104 | Bacteria | 1398 |
| 180 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 181 | Ga0157374_10004115 | 3300013296 | Bacteria | 12209 |
| 182 | Ga0157374_10076001 | 3300013296 | Bacteria | 3175 |
| 183 | Ga0157374_10160388 | 3300013296 | Bacteria | 2190 |
| 184 | Ga0157374_10374559 | 3300013296 | Bacteria | 1417 |
| 185 | Ga0157374_10821754 | 3300013296 | Bacteria | 946 |
| 186 | Ga0157374_10825432 | 3300013296 | Unclassified | 943 |
| 187 | Ga0157378_10043739 | 3300013297 | Unclassified | 3976 |
| 188 | Ga0157378_10097786 | 3300013297 | Bacteria | 2676 |
| 189 | Ga0157378_10376281 | 3300013297 | Bacteria | 1394 |
| 190 | Ga0157378_11365322 | 3300013297 | Bacteria | 751 |
| 191 | Ga0163162_10000109 | 3300013306 | Bacteria | 74550 |
| 192 | Ga0163162_10009385 | 3300013306 | Bacteria | 9517 |
| 193 | Ga0163162_10123692 | 3300013306 | Unclassified | 2692 |
| 194 | Ga0163162_10123909 | 3300013306 | Bacteria | 2690 |
| 195 | Ga0163162_10143214 | 3300013306 | Bacteria | 2504 |
| 196 | Ga0163162_11619759 | 3300013306 | Unclassified | 739 |
| 197 | Ga0157372_10000617 | 3300013307 | Bacteria | 38817 |
| 198 | Ga0157372_11435024 | 3300013307 | Bacteria | 795 |
| 199 | Ga0157375_10110636 | 3300013308 | Bacteria | 2844 |
| 200 | Ga0157375_10189997 | 3300013308 | Bacteria | 2208 |
| 201 | Ga0157375_10253028 | 3300013308 | Unclassified | 1922 |
| 202 | Ga0163163_10014607 | 3300014325 | Bacteria | 7223 |
| 203 | Ga0157380_10100131 | 3300014326 | Bacteria | 2412 |
| 204 | Ga0157380_10212465 | 3300014326 | Bacteria | 1725 |
| 205 | Ga0157380_10223294 | 3300014326 | Bacteria | 1687 |
| 206 | Ga0157380_10451450 | 3300014326 | Bacteria | 1235 |
| 207 | Ga0157380_10589861 | 3300014326 | Bacteria | 1097 |
| 208 | Ga0157380_11242165 | 3300014326 | Bacteria | 790 |
| 209 | Ga0157377_10033329 | 3300014745 | Bacteria | 2811 |
| 210 | Ga0157379_10000468 | 3300014968 | Bacteria | 32782 |
| 211 | Ga0157376_10042301 | 3300014969 | Bacteria | 3735 |
| 212 | Ga0157376_10087384 | 3300014969 | Bacteria | 2690 |
| 213 | Ga0157376_10198456 | 3300014969 | Bacteria | 1844 |
| 214 | Ga0157376_10419978 | 3300014969 | Bacteria | 1298 |
| 215 | Ga0163161_10083506 | 3300017792 | Bacteria | 2354 |
| 216 | Ga0209672_102553 | 3300025228 | Bacteria | 4371 |
| 217 | Ga0209258_100291 | 3300025242 | Bacteria | 82373 |
| 218 | Ga0209759_1000522 | 3300025256 | Bacteria | 41349 |
| 219 | Ga0209759_1000641 | 3300025256 | Bacteria | 32625 |
| 220 | Ga0209233_1020811 | 3300025261 | Unclassified | 1712 |
| 221 | Ga0209455_1000208 | 3300025272 | Bacteria | 83420 |
| 222 | Ga0209676_1000425 | 3300025292 | Bacteria | 74151 |
| 223 | Ga0209050_1034118 | 3300025298 | Bacteria | 1530 |
| 224 | Ga0209257_1000008 | 3300025304 | Bacteria | 1294570 |
| 225 | Ga0207682_10285115 | 3300025893 | Bacteria | 773 |
| 226 | Ga0207692_10017644 | 3300025898 | Unclassified | 3187 |
| 227 | Ga0207692_10065866 | 3300025898 | Bacteria | 1892 |
| 228 | Ga0207642_10003460 | 3300025899 | Bacteria | 4985 |
| 229 | Ga0207642_10443876 | 3300025899 | Bacteria | 785 |
| 230 | Ga0207710_10050580 | 3300025900 | Bacteria | 1865 |
| 231 | Ga0207680_10005875 | 3300025903 | Bacteria | 5893 |
| 232 | Ga0207680_10048250 | 3300025903 | Bacteria | 2528 |
| 233 | Ga0207643_10237953 | 3300025908 | Bacteria | 1118 |
| 234 | Ga0207705_10045960 | 3300025909 | Bacteria | 3137 |
| 235 | Ga0207654_10011755 | 3300025911 | Unclassified | 4469 |
| 236 | Ga0207695_10000175 | 3300025913 | Bacteria | 188658 |
| 237 | Ga0207695_10000193 | 3300025913 | Bacteria | 172070 |
| 238 | Ga0207695_10021408 | 3300025913 | Bacteria | 7376 |
| 239 | Ga0207671_10007762 | 3300025914 | Bacteria | 9241 |
| 240 | Ga0207671_10285179 | 3300025914 | Bacteria | 1303 |
| 241 | Ga0207693_10000325 | 3300025915 | Bacteria | 44161 |
| 242 | Ga0207663_10053307 | 3300025916 | Bacteria | 2526 |
| 243 | Ga0207662_10052953 | 3300025918 | Bacteria | 2417 |
| 244 | Ga0207681_10025840 | 3300025923 | Bacteria | 3782 |
| 245 | Ga0207681_10088041 | 3300025923 | Unclassified | 2211 |
| 246 | Ga0207694_10061757 | 3300025924 | Bacteria | 2916 |
| 247 | Ga0207694_10070493 | 3300025924 | Bacteria | 2731 |
| 248 | Ga0207694_10267824 | 3300025924 | Bacteria | 1401 |
| 249 | Ga0207650_10038163 | 3300025925 | Bacteria | 3506 |
| 250 | Ga0207650_10058175 | 3300025925 | Bacteria | 2877 |
| 251 | Ga0207650_10451561 | 3300025925 | Bacteria | 1070 |
| 252 | Ga0207687_10002556 | 3300025927 | Bacteria | 12360 |
| 253 | Ga0207687_10065545 | 3300025927 | Bacteria | 2579 |
| 254 | Ga0207700_10003146 | 3300025928 | Bacteria | 9525 |
| 255 | Ga0207664_10000078 | 3300025929 | Bacteria | 97308 |
| 256 | Ga0207644_10032020 | 3300025931 | Bacteria | 3666 |
| 257 | Ga0207644_10157747 | 3300025931 | Unclassified | 1761 |
| 258 | Ga0207706_10008355 | 3300025933 | Bacteria | 9550 |
| 259 | Ga0207686_10001142 | 3300025934 | Bacteria | 15331 |
| 260 | Ga0207686_10002988 | 3300025934 | Bacteria | 9116 |
| 261 | Ga0207686_10121214 | 3300025934 | Bacteria | 1780 |
| 262 | Ga0207709_10133420 | 3300025935 | Bacteria | 1696 |
| 263 | Ga0207670_10024025 | 3300025936 | Unclassified | 3804 |
| 264 | Ga0207670_10236185 | 3300025936 | Bacteria | 1406 |
| 265 | Ga0207704_10011323 | 3300025938 | Unclassified | 4386 |
| 266 | Ga0207704_10233293 | 3300025938 | Unclassified | 1370 |
| 267 | Ga0207704_10357423 | 3300025938 | Bacteria | 1139 |
| 268 | Ga0207691_10011173 | 3300025940 | Bacteria | 8618 |
| 269 | Ga0207691_10420193 | 3300025940 | Bacteria | 1139 |
| 270 | Ga0207711_10000206 | 3300025941 | Bacteria | 62928 |
| 271 | Ga0207689_10581395 | 3300025942 | Bacteria | 942 |
| 272 | Ga0207661_10076557 | 3300025944 | Bacteria | 2748 |
| 273 | Ga0207667_10048420 | 3300025949 | Bacteria | 4495 |
| 274 | Ga0207667_10180715 | 3300025949 | Unclassified | 2167 |
| 275 | Ga0207651_10003757 | 3300025960 | Bacteria | 7512 |
| 276 | Ga0207651_10006731 | 3300025960 | Bacteria | 6053 |
| 277 | Ga0207651_10085620 | 3300025960 | Bacteria | 2287 |
| 278 | Ga0207712_10023889 | 3300025961 | Bacteria | 4041 |
| 279 | Ga0207712_10060602 | 3300025961 | Bacteria | 2683 |
| 280 | Ga0207640_10020548 | 3300025981 | Unclassified | 3922 |
| 281 | Ga0207658_10027193 | 3300025986 | Bacteria | 4017 |
| 282 | Ga0207658_10215972 | 3300025986 | Bacteria | 1610 |
| 283 | Ga0207658_10346847 | 3300025986 | Bacteria | 1292 |
| 284 | Ga0207677_10003774 | 3300026023 | Bacteria | 8044 |
| 285 | Ga0207703_10023517 | 3300026035 | Bacteria | 4841 |
| 286 | Ga0207703_10355711 | 3300026035 | Bacteria | 1349 |
| 287 | Ga0207639_10012557 | 3300026041 | Bacteria | 5902 |
| 288 | Ga0207678_10027859 | 3300026067 | Bacteria | 4933 |
| 289 | Ga0207708_10466111 | 3300026075 | Bacteria | 1054 |
| 290 | Ga0207702_10015550 | 3300026078 | Bacteria | 6298 |
| 291 | Ga0207702_10075404 | 3300026078 | Unclassified | 2914 |
| 292 | Ga0207702_10294169 | 3300026078 | Bacteria | 1539 |
| 293 | Ga0207641_10000371 | 3300026088 | Bacteria | 53368 |
| 294 | Ga0207641_10041694 | 3300026088 | Bacteria | 3847 |
| 295 | Ga0207641_10051358 | 3300026088 | Unclassified | 3491 |
| 296 | Ga0207648_10046070 | 3300026089 | Unclassified | 3824 |
| 297 | Ga0207648_10205080 | 3300026089 | Bacteria | 1749 |
| 298 | Ga0207676_10006383 | 3300026095 | Bacteria | 8329 |
| 299 | Ga0207676_10080013 | 3300026095 | Bacteria | 2652 |
| 300 | Ga0207674_10099645 | 3300026116 | Bacteria | 2888 |
| 301 | Ga0207674_10368114 | 3300026116 | Bacteria | 1389 |
| 302 | Ga0207674_10739851 | 3300026116 | Unclassified | 949 |
| 303 | Ga0207675_100308155 | 3300026118 | Bacteria | 1543 |
| 304 | Ga0207675_100310286 | 3300026118 | Bacteria | 1538 |
| 305 | Ga0207683_10000671 | 3300026121 | Bacteria | 31464 |
| 306 | Ga0207683_10092375 | 3300026121 | Bacteria | 2697 |
| 307 | Ga0207698_10189854 | 3300026142 | Bacteria | 1829 |
| 308 | Ga0207698_10421763 | 3300026142 | Bacteria | 1280 |
| 309 | Ga0207698_10586629 | 3300026142 | Bacteria | 1097 |
| 310 | Ga0268266_10000088 | 3300028379 | Bacteria | 199029 |
| 311 | Ga0268266_10039461 | 3300028379 | Unclassified | 4022 |
| 312 | Ga0268265_10098247 | 3300028380 | Bacteria | 2358 |
| 313 | Ga0268264_10406590 | 3300028381 | Bacteria | 1309 |
| 314 | Ga0265337_1035008 | 3300028556 | Bacteria | 1473 |
| 315 | Ga0265337_1047038 | 3300028556 | Bacteria | 1224 |
| 316 | Ga0265334_10011973 | 3300028573 | Bacteria | 3644 |
| 317 | Ga0265334_10106084 | 3300028573 | Bacteria | 1013 |
| 318 | Ga0265336_10000003 | 3300028666 | Bacteria | 423158 |
| 319 | Ga0265336_10032732 | 3300028666 | Bacteria | 1612 |
| 320 | Ga0307515_10000044 | 3300028794 | Bacteria | 303041 |
| 321 | Ga0307515_10000251 | 3300028794 | Bacteria | 132970 |
| 322 | Ga0307515_10000724 | 3300028794 | Bacteria | 75975 |
| 323 | Ga0307515_10118212 | 3300028794 | Bacteria | 3027 |
| 324 | Ga0265338_10003080 | 3300028800 | Bacteria | 23928 |
| 325 | Ga0265338_10057130 | 3300028800 | Bacteria | 3454 |
| 326 | Ga0265338_10180041 | 3300028800 | Bacteria | 1612 |
| 327 | Ga0265338_10378283 | 3300028800 | Bacteria | 1013 |
| 328 | Ga0265324_10001536 | 3300029957 | Bacteria | 12971 |
| 329 | Ga0265331_10115906 | 3300031250 | Bacteria | 1227 |
| 330 | Ga0265327_10000743 | 3300031251 | Bacteria | 50644 |
| 331 | Ga0265316_10000246 | 3300031344 | Bacteria | 62474 |
| 332 | Ga0265316_10005277 | 3300031344 | Bacteria | 12607 |
| 333 | Ga0265316_10183976 | 3300031344 | Bacteria | 1555 |
| 334 | Ga0307513_10014229 | 3300031456 | Bacteria | 9728 |
| 335 | Ga0307513_10040771 | 3300031456 | Bacteria | 5131 |
| 336 | Ga0307513_10098540 | 3300031456 | Bacteria | 2954 |
| 337 | Ga0307509_10224400 | 3300031507 | Bacteria | 1688 |
| 338 | Ga0307408_100001708 | 3300031548 | Bacteria | 16126 |
| 339 | Ga0307408_100884888 | 3300031548 | Bacteria | 816 |
| 340 | Ga0265342_10124039 | 3300031712 | Bacteria | 1452 |
| 341 | Ga0316576_10267488 | 3300031727 | Bacteria | 1282 |
| 342 | Ga0316578_10155415 | 3300031728 | Unclassified | 1379 |
| 343 | Ga0307516_10235549 | 3300031730 | Bacteria | 1532 |
| 344 | Ga0307405_10805817 | 3300031731 | Bacteria | 787 |
| 345 | Ga0307406_10411655 | 3300031901 | Bacteria | 1075 |
| 346 | Ga0307416_100368847 | 3300032002 | Bacteria | 1461 |
| 347 | Ga0307414_10082631 | 3300032004 | Bacteria | 2356 |
| 348 | Ga0307415_100343776 | 3300032126 | Bacteria | 1253 |
| 349 | Ga0316583_10025580 | 3300032133 | Bacteria | 2108 |
| 350 | Ga0316583_10079002 | 3300032133 | Bacteria | 1150 |
| 351 | Ga0307510_10064887 | 3300033180 | Bacteria | 3704 |
| 352 | Ga0373926_0038629 | 3300035083 | Unclassified | 1701 |
| 353 | Ga0373934_0007255 | 3300035086 | Bacteria | 4110 |
| 354 | Ga0373923_0001540 | 3300035111 | Bacteria | 6667 |
| 355 | Ga0373945_0051252 | 3300035116 | Bacteria | 1518 |
| 356 | Ga0373945_0055299 | 3300035116 | Unclassified | 1469 |
| 357 | Ga0373954_0001962 | 3300035118 | Bacteria | 8532 |
| 358 | Ga0373957_0014603 | 3300035120 | Unclassified | 2688 |
| 359 | Ga0373943_0011742 | 3300035170 | Unclassified | 3943 |
| 360 | Ga0373943_0022831 | 3300035170 | Bacteria | 2904 |
| 361 | Ga0373943_0318462 | 3300035170 | Bacteria | 886 |
| 362 | Ga0373955_0039012 | 3300035172 | Bacteria | 2532 |
| 363 | Ga0316574_0102859 | 3300035398 | Unclassified | 1829 |
| 364 | Ga0373924_0006655 | 3300035410 | Bacteria | 4146 |
| 365 | Ga0373931_0139433 | 3300035691 | Unclassified | 1403 |
| 366 | Ga0373935_0019528 | 3300035692 | Bacteria | 4133 |
| 367 | Ga0373935_0045754 | 3300035692 | Bacteria | 2762 |
| 368 | Ga0373927_0032592 | 3300035695 | Bacteria | 3394 |
| 369 | Ga0373927_0132854 | 3300035695 | Unclassified | 1626 |
| 370 | Ga0373927_0137867 | 3300035695 | Bacteria | 1595 |
| 371 | Ga0373927_0428472 | 3300035695 | Bacteria | 873 |
| 372 | Ga0373933_0040262 | 3300035724 | Unclassified | 2752 |
| 373 | Ga0373937_0007866 | 3300036401 | Bacteria | 9241 |
| 374 | Ga0373937_0031181 | 3300036401 | Bacteria | 4828 |
| 375 | Ga0316582_0178355 | 3300036647 | Bacteria | 1445 |
| 376 | Ga0316584_0094211 | 3300036712 | Bacteria | 2242 |
| 377 | Ga0373925_0114800 | 3300037068 | Unclassified | 2084 |
| 378 | Ga0395900_0046658 | 3300037418 | Bacteria | 4462 |
| 379 | Ga0395898_0440741 | 3300037466 | Bacteria | 1241 |
| 380 | Ga0439439_0001900 | 3300041406 | Bacteria | 4315 |
| 381 | Ga0451787_341172 | 3300041441 | Bacteria | 820 |
| 382 | Ga0451839_0695238 | 3300041496 | Bacteria | 1118 |
| 383 | Ga0451849_1366099 | 3300041505 | Bacteria | 1560 |
| 384 | Ga0451843_1210020 | 3300041509 | Bacteria | 941 |
| 385 | Ga0451853_0693207 | 3300041512 | Unclassified | 1425 |
| 386 | Ga0451853_2023802 | 3300041512 | Bacteria | 906 |
| 387 | Ga0439457_001015 | 3300042014 | Bacteria | 8459 |
| 388 | Ga0451577_0016862 | 3300042876 | Bacteria | 6756 |
| 389 | Ga0451577_0292794 | 3300042876 | Unclassified | 1475 |
| 390 | Ga0451577_0599973 | 3300042876 | Bacteria | 999 |
| 391 | Ga0466969_0000371 | 3300044656 | Bacteria | 24624 |
| 392 | Ga0466972_0000075 | 3300044658 | Bacteria | 94290 |
| 393 | Ga0466972_0012429 | 3300044658 | Bacteria | 4279 |
| 394 | Ga0453683_0000162 | 3300044673 | Bacteria | 97997 |
| 395 | Ga0453683_0020950 | 3300044673 | Bacteria | 4175 |
| 396 | Ga0453683_0073693 | 3300044673 | Bacteria | 2137 |
| 397 | Ga0466966_0000131 | 3300044684 | Bacteria | 48304 |
| 398 | Ga0466966_0174210 | 3300044684 | Bacteria | 1307 |
| 399 | Ga0466961_0060382 | 3300044693 | Bacteria | 2411 |
| 400 | Ga0466964_0133460 | 3300044706 | Bacteria | 1133 |
| 401 | Ga0453684_0000604 | 3300044712 | Bacteria | 132335 |
| 402 | Ga0453684_0004825 | 3300044712 | Bacteria | 27702 |
| 403 | Ga0453684_0011388 | 3300044712 | Bacteria | 14935 |
| 404 | Ga0453684_0063998 | 3300044712 | Bacteria | 4700 |
| 405 | Ga0466971_0010042 | 3300044719 | Bacteria | 4136 |
| 406 | Ga0466970_0008141 | 3300044765 | Bacteria | 5264 |
| 407 | Ga0466970_0033032 | 3300044765 | Unclassified | 2735 |
| 408 | Ga0466970_0103862 | 3300044765 | Bacteria | 1549 |
| 409 | Ga0466957_0008518 | 3300044842 | Bacteria | 5836 |
| 410 | Ga0466959_0000003 | 3300045049 | Bacteria | 285164 |
| 411 | Ga0466959_0052730 | 3300045049 | Unclassified | 2978 |
| 412 | Ga0451576_0000299 | 3300045051 | Bacteria | 120013 |
| 413 | Ga0451576_0000913 | 3300045051 | Bacteria | 55976 |
| 414 | Ga0451576_0002946 | 3300045051 | Bacteria | 24140 |
| 415 | Ga0495592_0090373 | 3300046454 | Bacteria | 2197 |
| 416 | Ga0495592_0090393 | 3300046454 | Bacteria | 2197 |
| 417 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 418 | Ga0495638_0057097 | 3300046460 | Unclassified | 2422 |
| 419 | Ga0495638_0188481 | 3300046460 | Unclassified | 1172 |
| 420 | Ga0495651_0309763 | 3300046462 | Bacteria | 1056 |
| 421 | Ga0495650_0007871 | 3300046471 | Bacteria | 6330 |
| 422 | Ga0495580_0011883 | 3300046472 | Bacteria | 6713 |
| 423 | Ga0495580_0035198 | 3300046472 | Bacteria | 3601 |
| 424 | Ga0495639_0004602 | 3300046475 | Bacteria | 5918 |
| 425 | Ga0495639_0027892 | 3300046475 | Bacteria | 2500 |
| 426 | Ga0495662_0092595 | 3300046476 | Unclassified | 1474 |
| 427 | Ga0495662_0118724 | 3300046476 | Bacteria | 1298 |
| 428 | Ga0495594_0037284 | 3300046499 | Bacteria | 2652 |
| 429 | Ga0495583_0054967 | 3300046506 | Unclassified | 1801 |
| 430 | Ga0495606_0213470 | 3300046507 | Bacteria | 1091 |
| 431 | Ga0495628_0018267 | 3300046516 | Bacteria | 5814 |
| 432 | Ga0495630_0043941 | 3300046517 | Bacteria | 3339 |
| 433 | Ga0495665_0023392 | 3300046531 | Unclassified | 3318 |
| 434 | Ga0495640_0063064 | 3300046533 | Bacteria | 2512 |
| 435 | Ga0495640_0083681 | 3300046533 | Unclassified | 2117 |
| 436 | Ga0495586_0046787 | 3300046535 | Unclassified | 2333 |
| 437 | Ga0495609_0048952 | 3300046538 | Unclassified | 1887 |
| 438 | Ga0495621_0081033 | 3300046539 | Bacteria | 1210 |
| 439 | Ga0495645_0023230 | 3300046543 | Bacteria | 4490 |
| 440 | Ga0495645_0040280 | 3300046543 | Bacteria | 3409 |
| 441 | Ga0495667_0092936 | 3300046559 | Bacteria | 1953 |
| 442 | Ga0495656_0035475 | 3300046615 | Bacteria | 2049 |
| 443 | Ga0495668_0000526 | 3300046616 | Bacteria | 47711 |
| 444 | Ga0495634_0032823 | 3300046642 | Bacteria | 3568 |
| 445 | Ga0495611_0240959 | 3300046648 | Bacteria | 839 |
| 446 | Ga0495625_0061260 | 3300046660 | Bacteria | 2663 |
| 447 | Ga0495635_0054562 | 3300046663 | Bacteria | 2753 |
| 448 | Ga0495588_0199789 | 3300046674 | Unclassified | 1056 |
| 449 | Ga0495623_0090135 | 3300046679 | Bacteria | 1883 |
| 450 | Ga0495647_0040939 | 3300046681 | Bacteria | 1762 |
| 451 | Ga0495658_0025524 | 3300046683 | Bacteria | 3158 |
| 452 | Ga0495613_0046901 | 3300046689 | Bacteria | 3193 |
| 453 | Ga0495649_0032766 | 3300046694 | Bacteria | 2861 |
| 454 | Ga0495581_0000884 | 3300047315 | Bacteria | 16023 |
| 455 | Ga0495604_0202754 | 3300047317 | Unclassified | 1375 |
| 456 | Ga0495636_0002425 | 3300047318 | Bacteria | 7148 |
| 457 | Ga0495674_0056639 | 3300047319 | Unclassified | 3432 |
| 458 | Ga0495680_0089986 | 3300047322 | Unclassified | 2303 |
| 459 | Ga0495683_0008096 | 3300047323 | Bacteria | 5642 |
| 460 | Ga0495684_0049551 | 3300047471 | Bacteria | 3208 |
| 461 | Ga0495684_0285805 | 3300047471 | Unclassified | 1188 |
| 462 | Ga0495686_0012213 | 3300047472 | Bacteria | 6016 |
| 463 | Ga0495686_0016151 | 3300047472 | Bacteria | 5072 |
| 464 | Ga0495593_0045865 | 3300047673 | Unclassified | 2331 |
| 465 | Ga0495602_0236243 | 3300048088 | Unclassified | 1370 |
| 466 | Ga0496105_0102834 | 3300048908 | Bacteria | 2359 |
| 467 | Ga0496106_0958788 | 3300048909 | Bacteria | 674 |
| 468 | Ga0496107_0021378 | 3300048910 | Unclassified | 4573 |
| 469 | Ga0496108_0000007 | 3300048911 | Bacteria | 351492 |
| 470 | Ga0496108_0360945 | 3300048911 | Unclassified | 1268 |
| 471 | Ga0496109_0002530 | 3300048912 | Bacteria | 15325 |
| 472 | Ga0496114_0011119 | 3300048917 | Bacteria | 7185 |
| 473 | Ga0496115_0291375 | 3300048918 | Unclassified | 1339 |
| 474 | Ga0496126_0026690 | 3300048929 | Bacteria | 5531 |
| 475 | Ga0501047_0020598 | 3300049581 | Bacteria | 6333 |
| 476 | Ga0501047_0388716 | 3300049581 | Bacteria | 1229 |
| 477 | Ga0501047_0424817 | 3300049581 | Unclassified | 1160 |
| 478 | Ga0501048_0323869 | 3300049582 | Bacteria | 1098 |
| 479 | Ga0501202_008218 | 3300049652 | Bacteria | 1899 |
| 480 | Ga0501217_018075 | 3300049661 | Bacteria | 1633 |
| 481 | Ga0501235_080771 | 3300049669 | Unclassified | 777 |
| 482 | Ga0501236_000930 | 3300049670 | Bacteria | 3295 |
| 483 | Ga0501242_000387 | 3300049674 | Bacteria | 3729 |
| 484 | Ga0501257_000158 | 3300049686 | Bacteria | 13902 |
| 485 | Ga0501257_000385 | 3300049686 | Bacteria | 8563 |
| 486 | Ga0501225_0004322 | 3300049705 | Unclassified | 4246 |
| 487 | Ga0501225_0010633 | 3300049705 | Bacteria | 2604 |
| 488 | Ga0501080_0555774 | 3300049742 | Bacteria | 1022 |
| 489 | Ga0501083_0098944 | 3300049744 | Bacteria | 1924 |
| 490 | Ga0501264_000543 | 3300049761 | Bacteria | 5501 |
| 491 | Ga0501264_005145 | 3300049761 | Unclassified | 1190 |
| 492 | Ga0501044_0024091 | 3300049823 | Bacteria | 6466 |
| 493 | nmdc:mga0k408_109114_c1 | 3300050493 | Bacteria | 1635 |
| 494 | nmdc:mga0k408_4450_c1 | 3300050493 | Bacteria | 7436 |
| 495 | nmdc:mga0k408_59567_c1 | 3300050493 | Bacteria | 2218 |
| 496 | nmdc:mga05p37_10194_c2 | 3300050507 | Bacteria | 9428 |
| 497 | nmdc:mga09592_187982_c1 | 3300050508 | Unclassified | 1788 |
| 498 | nmdc:mga09592_4021_c1 | 3300050508 | Bacteria | 11865 |
| 499 | nmdc:mga0qj67_94392_c1 | 3300050509 | Bacteria | 2406 |
| 500 | nmdc:mga06r32_159410_c1 | 3300050510 | Bacteria | 2238 |
| 501 | nmdc:mga06r32_170007_c1 | 3300050510 | Unclassified | 2163 |
| 502 | nmdc:mga08y16_47211_c1 | 3300050511 | Bacteria | 4507 |
| 503 | nmdc:mga0n895_870595_c1 | 3300050512 | Unclassified | 888 |
| 504 | nmdc:mga0rr50_70638_c1 | 3300050513 | Bacteria | 2661 |
| 505 | Ga0495601_0057365 | 3300053077 | Unclassified | 2467 |
| 506 | Ga0495601_0141515 | 3300053077 | Bacteria | 1569 |
| 507 | Ga0500635_0000267 | 3300053080 | Bacteria | 20576 |
| 508 | Ga0495619_0001956 | 3300053085 | Bacteria | 13738 |
| 509 | Ga0500578_0000091 | 3300053086 | Bacteria | 102427 |
| 510 | Ga0500578_0021779 | 3300053086 | Bacteria | 4117 |
| 511 | Ga0500578_0209412 | 3300053086 | Bacteria | 1190 |
| 512 | Ga0500644_0035139 | 3300053088 | Unclassified | 1622 |
| 513 | Ga0500581_215700 | 3300053089 | Bacteria | 838 |
| 514 | Ga0500646_0028536 | 3300053090 | Bacteria | 1524 |
| 515 | Ga0500646_0105765 | 3300053090 | Bacteria | 889 |
| 516 | Ga0500583_0000011 | 3300053092 | Bacteria | 160380 |
| 517 | Ga0500583_0000236 | 3300053092 | Bacteria | 19755 |
| 518 | Ga0500555_016697 | 3300053103 | Unclassified | 2115 |
| 519 | Ga0500556_0018576 | 3300053104 | Bacteria | 2197 |
| 520 | Ga0500591_073448 | 3300053115 | Bacteria | 1543 |
| 521 | Ga0500618_000010 | 3300053125 | Bacteria | 203909 |
| 522 | Ga0500642_0026381 | 3300053130 | Unclassified | 2371 |
| 523 | Ga0500559_0008054 | 3300053136 | Bacteria | 4639 |
| 524 | Ga0500564_124461 | 3300053138 | Bacteria | 1120 |
| 525 | Ga0500577_0039752 | 3300053142 | Bacteria | 1707 |
| 526 | Ga0500577_0041861 | 3300053142 | Bacteria | 1674 |
| 527 | Ga0500588_0002329 | 3300053146 | Bacteria | 3838 |
| 528 | Ga0500589_009872 | 3300053147 | Bacteria | 4054 |
| 529 | Ga0500603_096533 | 3300053150 | Bacteria | 874 |
| 530 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 531 | Ga0500616_0004297 | 3300053153 | Bacteria | 10222 |
| 532 | Ga0500622_0000844 | 3300053156 | Bacteria | 26216 |
| 533 | Ga0500622_0001136 | 3300053156 | Bacteria | 22218 |
| 534 | Ga0500622_0018143 | 3300053156 | Unclassified | 3742 |
| 535 | Ga0500627_0040170 | 3300053158 | Bacteria | 2007 |
| 536 | Ga0500630_088313 | 3300053159 | Bacteria | 1437 |
| 537 | Ga0500611_000026 | 3300053727 | Bacteria | 96342 |
| 538 | Ga0500609_025558 | 3300053731 | Bacteria | 809 |
| 539 | Ga0501082_0124487 | 3300060353 | Bacteria | 2235 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300060353 | Ga0501082_0124487 | Ga0501082_0124487_12_542 | 171 |
| 2 | 3300048909 | Ga0496106_0958788 | Ga0496106_0958788_65_652 | 195 |
| 3 | 3300053142 | Ga0500577_0041861 | Ga0500577_0041861_18_623 | 201 |
| 4 | 3300006186 | Ga0075369_10113311 | Ga0075369_101133112 | 203 |
| 5 | 3300006844 | Ga0075428_100233698 | Ga0075428_1002336983 | 205 |
| 6 | 3300006846 | Ga0075430_100213910 | Ga0075430_1002139102 | 205 |
| 7 | 3300005338 | Ga0068868_100120953 | Ga0068868_1001209533 | 207 |
| 8 | 3300005355 | Ga0070671_100127533 | Ga0070671_1001275333 | 207 |
| 9 | 3300005356 | Ga0070674_100000708 | Ga0070674_10000070819 | 207 |
| 10 | 3300005367 | Ga0070667_100007792 | Ga0070667_1000077922 | 207 |
| 11 | 3300005435 | Ga0070714_100774609 | Ga0070714_1007746091 | 207 |
| 12 | 3300005437 | Ga0070710_10076912 | Ga0070710_100769123 | 207 |
| 13 | 3300005456 | Ga0070678_100016413 | Ga0070678_1000164137 | 207 |
| 14 | 3300005457 | Ga0070662_100019588 | Ga0070662_1000195885 | 207 |
| 15 | 3300005547 | Ga0070693_100002460 | Ga0070693_1000024608 | 207 |
| 16 | 3300005578 | Ga0068854_100043287 | Ga0068854_1000432872 | 207 |
| 17 | 3300005615 | Ga0070702_100103989 | Ga0070702_1001039892 | 207 |
| 18 | 3300005616 | Ga0068852_100249772 | Ga0068852_1002497722 | 207 |
| 19 | 3300005718 | Ga0068866_10003539 | Ga0068866_100035399 | 207 |
| 20 | 3300005843 | Ga0068860_100043274 | Ga0068860_1000432747 | 207 |
| 21 | 3300005843 | Ga0068860_101196616 | Ga0068860_1011966162 | 207 |
| 22 | 3300006358 | Ga0068871_100086251 | Ga0068871_1000862513 | 207 |
| 23 | 3300006881 | Ga0068865_100013441 | Ga0068865_1000134413 | 207 |
| 24 | 3300025898 | Ga0207692_10065866 | Ga0207692_100658663 | 207 |
| 25 | 3300025899 | Ga0207642_10003460 | Ga0207642_100034608 | 207 |
| 26 | 3300025903 | Ga0207680_10005875 | Ga0207680_1000587511 | 207 |
| 27 | 3300025911 | Ga0207654_10011755 | Ga0207654_100117557 | 207 |
| 28 | 3300025924 | Ga0207694_10070493 | Ga0207694_100704933 | 207 |
| 29 | 3300025927 | Ga0207687_10002556 | Ga0207687_100025568 | 207 |
| 30 | 3300025931 | Ga0207644_10157747 | Ga0207644_101577473 | 207 |
| 31 | 3300025933 | Ga0207706_10008355 | Ga0207706_100083558 | 207 |
| 32 | 3300025934 | Ga0207686_10001142 | Ga0207686_1000114216 | 207 |
| 33 | 3300025935 | Ga0207709_10133420 | Ga0207709_101334202 | 207 |
| 34 | 3300025938 | Ga0207704_10011323 | Ga0207704_100113237 | 207 |
| 35 | 3300025981 | Ga0207640_10020548 | Ga0207640_100205483 | 207 |
| 36 | 3300025986 | Ga0207658_10215972 | Ga0207658_102159723 | 207 |
| 37 | 3300026041 | Ga0207639_10012557 | Ga0207639_100125575 | 207 |
| 38 | 3300026067 | Ga0207678_10027859 | Ga0207678_100278597 | 207 |
| 39 | 3300026089 | Ga0207648_10046070 | Ga0207648_100460702 | 207 |
| 40 | 3300026121 | Ga0207683_10000671 | Ga0207683_1000067132 | 207 |
| 41 | 3300031730 | Ga0307516_10235549 | Ga0307516_102355492 | 207 |
| 42 | 3300035170 | Ga0373943_0318462 | Ga0373943_0318462_18_641 | 207 |
| 43 | 3300005617 | Ga0068859_100250225 | Ga0068859_1002502252 | 208 |
| 44 | 3300006358 | Ga0068871_100761050 | Ga0068871_1007610502 | 208 |
| 45 | 3300006931 | Ga0097620_100250223 | Ga0097620_1002502232 | 208 |
| 46 | 3300025940 | Ga0207691_10420193 | Ga0207691_104201931 | 208 |
| 47 | 3300005329 | Ga0070683_100083755 | Ga0070683_1000837553 | 209 |
| 48 | 3300025944 | Ga0207661_10076557 | Ga0207661_100765573 | 209 |
| 49 | 3300033180 | Ga0307510_10064887 | Ga0307510_100648872 | 209 |
| 50 | 3300047323 | Ga0495683_0008096 | Ga0495683_0008096_579_1253 | 209 |
| 51 | 3300005354 | Ga0070675_100884961 | Ga0070675_1008849611 | 210 |
| 52 | 3300005535 | Ga0070684_100664856 | Ga0070684_1006648561 | 210 |
| 53 | 3300005985 | Ga0081539_10023221 | Ga0081539_100232214 | 210 |
| 54 | 3300009094 | Ga0111539_10781835 | Ga0111539_107818352 | 210 |
| 55 | 3300028794 | Ga0307515_10000044 | Ga0307515_10000044189 | 210 |
| 56 | 3300048911 | Ga0496108_0000007 | Ga0496108_0000007_253846_254490 | 210 |
| 57 | 3300031727 | Ga0316576_10267488 | Ga0316576_102674882 | 211 |
| 58 | 3300031728 | Ga0316578_10155415 | Ga0316578_101554152 | 211 |
| 59 | 3300036647 | Ga0316582_0178355 | Ga0316582_0178355_489_1163 | 211 |
| 60 | 3300009147 | Ga0114129_10175389 | Ga0114129_101753892 | 213 |
| 61 | 3300047472 | Ga0495686_0012213 | Ga0495686_0012213_4175_4855 | 213 |
| 62 | 3300053092 | Ga0500583_0000236 | Ga0500583_0000236_14112_14777 | 213 |
| 63 | 3300053147 | Ga0500589_009872 | Ga0500589_009872_766_1431 | 213 |
| 64 | iso_pu_bacteria | 2738541273 | 2738699058 | 213 |
| 65 | iso_pu_bacteria | 2738543014 | 2739254774 | 213 |
| 66 | 3300005471 | Ga0070698_100759031 | Ga0070698_1007590311 | 214 |
| 67 | 3300006844 | Ga0075428_100375066 | Ga0075428_1003750662 | 214 |
| 68 | 3300009545 | Ga0105237_10689220 | Ga0105237_106892201 | 214 |
| 69 | 3300026078 | Ga0207702_10294169 | Ga0207702_102941693 | 214 |
| 70 | 3300031731 | Ga0307405_10805817 | Ga0307405_108058171 | 214 |
| 71 | 3300031901 | Ga0307406_10411655 | Ga0307406_104116552 | 214 |
| 72 | 3300032002 | Ga0307416_100368847 | Ga0307416_1003688472 | 214 |
| 73 | 3300041512 | Ga0451853_0693207 | Ga0451853_0693207_693_1358 | 214 |
| 74 | 3300046460 | Ga0495638_0057097 | Ga0495638_0057097_1361_2020 | 214 |
| 75 | 3300050493 | nmdc:mga0k408_4450_c1 | nmdc:mga0k408_4450_c1_1290_1955 | 214 |
| 76 | iso_pu_bacteria | 2739367866 | 2740032774 | 214 |
| 77 | iso_pu_bacteria | 2980182181 | 2980188492 | 214 |
| 78 | 3300003316 | rootH1_10007168 | rootH1_100071684 | 215 |
| 79 | 3300003322 | rootL2_10035743 | rootL2_100357432 | 215 |
| 80 | 3300046516 | Ga0495628_0018267 | Ga0495628_0018267_3609_4301 | 215 |
| 81 | iso_pu_bacteria | 2896109856 | 2896112302 | 215 |
| 82 | 3300006880 | Ga0075429_100159934 | Ga0075429_1001599342 | 216 |
| 83 | 3300026142 | Ga0207698_10586629 | Ga0207698_105866292 | 216 |
| 84 | 3300028556 | Ga0265337_1047038 | Ga0265337_10470382 | 216 |
| 85 | 3300028573 | Ga0265334_10011973 | Ga0265334_100119734 | 216 |
| 86 | 3300028800 | Ga0265338_10057130 | Ga0265338_100571303 | 216 |
| 87 | 3300036712 | Ga0316584_0094211 | Ga0316584_0094211_760_1425 | 216 |
| 88 | 3300050508 | nmdc:mga09592_187982_c1 | nmdc:mga09592_187982_c1_513_1166 | 216 |
| 89 | 3300050510 | nmdc:mga06r32_170007_c1 | nmdc:mga06r32_170007_c1_861_1514 | 216 |
| 90 | iso_pu_bacteria | 2738541278 | 2738724859 | 216 |
| 91 | iso_pu_bacteria | 2911138879 | 2911141327 | 216 |
| 92 | iso_pu_bacteria | 2932794094 | 2932796174 | 216 |
| 93 | 3300005290 | Ga0065712_10013630 | Ga0065712_100136303 | 217 |
| 94 | 3300005338 | Ga0068868_100419821 | Ga0068868_1004198212 | 217 |
| 95 | 3300005353 | Ga0070669_100066337 | Ga0070669_1000663372 | 217 |
| 96 | 3300005354 | Ga0070675_100395322 | Ga0070675_1003953222 | 217 |
| 97 | 3300005354 | Ga0070675_100404420 | Ga0070675_1004044201 | 217 |
| 98 | 3300005364 | Ga0070673_100030671 | Ga0070673_1000306715 | 217 |
| 99 | 3300005365 | Ga0070688_100087414 | Ga0070688_1000874142 | 217 |
| 100 | 3300005471 | Ga0070698_100004733 | Ga0070698_1000047336 | 217 |
| 101 | 3300005518 | Ga0070699_100564891 | Ga0070699_1005648912 | 217 |
| 102 | 3300005543 | Ga0070672_100335002 | Ga0070672_1003350022 | 217 |
| 103 | 3300005577 | Ga0068857_100171981 | Ga0068857_1001719812 | 217 |
| 104 | 3300005617 | Ga0068859_100059804 | Ga0068859_1000598045 | 217 |
| 105 | 3300005719 | Ga0068861_100340420 | Ga0068861_1003404202 | 217 |
| 106 | 3300005842 | Ga0068858_100177274 | Ga0068858_1001772741 | 217 |
| 107 | 3300005843 | Ga0068860_100276783 | Ga0068860_1002767833 | 217 |
| 108 | 3300006173 | Ga0070716_100155378 | Ga0070716_1001553782 | 217 |
| 109 | 3300006844 | Ga0075428_100675792 | Ga0075428_1006757921 | 217 |
| 110 | 3300006846 | Ga0075430_100053072 | Ga0075430_1000530722 | 217 |
| 111 | 3300006847 | Ga0075431_100062466 | Ga0075431_1000624662 | 217 |
| 112 | 3300006880 | Ga0075429_100004703 | Ga0075429_10000470310 | 217 |
| 113 | 3300006931 | Ga0097620_100059798 | Ga0097620_1000597985 | 217 |
| 114 | 3300009177 | Ga0105248_10468519 | Ga0105248_104685191 | 217 |
| 115 | 3300013308 | Ga0157375_10110636 | Ga0157375_101106362 | 217 |
| 116 | 3300014326 | Ga0157380_10223294 | Ga0157380_102232942 | 217 |
| 117 | 3300014745 | Ga0157377_10033329 | Ga0157377_100333292 | 217 |
| 118 | 3300014969 | Ga0157376_10198456 | Ga0157376_101984561 | 217 |
| 119 | 3300017792 | Ga0163161_10083506 | Ga0163161_100835063 | 217 |
| 120 | 3300025918 | Ga0207662_10052953 | Ga0207662_100529532 | 217 |
| 121 | 3300025923 | Ga0207681_10025840 | Ga0207681_100258404 | 217 |
| 122 | 3300025925 | Ga0207650_10451561 | Ga0207650_104515611 | 217 |
| 123 | 3300025940 | Ga0207691_10011173 | Ga0207691_100111732 | 217 |
| 124 | 3300025960 | Ga0207651_10085620 | Ga0207651_100856204 | 217 |
| 125 | 3300025986 | Ga0207658_10346847 | Ga0207658_103468471 | 217 |
| 126 | 3300026035 | Ga0207703_10355711 | Ga0207703_103557112 | 217 |
| 127 | 3300026075 | Ga0207708_10466111 | Ga0207708_104661111 | 217 |
| 128 | 3300026095 | Ga0207676_10080013 | Ga0207676_100800132 | 217 |
| 129 | 3300026118 | Ga0207675_100310286 | Ga0207675_1003102861 | 217 |
| 130 | 3300026121 | Ga0207683_10092375 | Ga0207683_100923752 | 217 |
| 131 | 3300032126 | Ga0307415_100343776 | Ga0307415_1003437762 | 217 |
| 132 | 3300044673 | Ga0453683_0073693 | Ga0453683_0073693_37_762 | 217 |
| 133 | 3300044712 | Ga0453684_0063998 | Ga0453684_0063998_1450_2118 | 217 |
| 134 | 3300046476 | Ga0495662_0118724 | Ga0495662_0118724_549_1205 | 217 |
| 135 | 3300050508 | nmdc:mga09592_4021_c1 | nmdc:mga09592_4021_c1_377_1042 | 217 |
| 136 | 3300050509 | nmdc:mga0qj67_94392_c1 | nmdc:mga0qj67_94392_c1_784_1449 | 217 |
| 137 | 3300050510 | nmdc:mga06r32_159410_c1 | nmdc:mga06r32_159410_c1_1501_2166 | 217 |
| 138 | iso_pu_bacteria | 2896085136 | 2896087977 | 217 |
| 139 | 3300005841 | Ga0068863_100772731 | Ga0068863_1007727312 | 218 |
| 140 | 3300006195 | Ga0075366_10085740 | Ga0075366_100857403 | 218 |
| 141 | 3300025298 | Ga0209050_1034118 | Ga0209050_10341182 | 218 |
| 142 | 3300028794 | Ga0307515_10000251 | Ga0307515_1000025160 | 218 |
| 143 | 3300028794 | Ga0307515_10000724 | Ga0307515_1000072440 | 218 |
| 144 | 3300028794 | Ga0307515_10118212 | Ga0307515_101182122 | 218 |
| 145 | 3300031251 | Ga0265327_10000743 | Ga0265327_1000074321 | 218 |
| 146 | 3300031456 | Ga0307513_10014229 | Ga0307513_100142294 | 218 |
| 147 | 3300031456 | Ga0307513_10040771 | Ga0307513_100407714 | 218 |
| 148 | 3300031456 | Ga0307513_10098540 | Ga0307513_100985402 | 218 |
| 149 | 3300032004 | Ga0307414_10082631 | Ga0307414_100826312 | 218 |
| 150 | 3300035695 | Ga0373927_0137867 | Ga0373927_0137867_438_1109 | 218 |
| 151 | 3300044712 | Ga0453684_0011388 | Ga0453684_0011388_6916_7575 | 218 |
| 152 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_506591_507256 | 218 |
| 153 | 3300046615 | Ga0495656_0035475 | Ga0495656_0035475_1185_1841 | 218 |
| 154 | 3300047318 | Ga0495636_0002425 | Ga0495636_0002425_4795_5451 | 218 |
| 155 | 3300049742 | Ga0501080_0555774 | Ga0501080_0555774_202_873 | 218 |
| 156 | 3300050493 | nmdc:mga0k408_109114_c1 | nmdc:mga0k408_109114_c1_885_1559 | 218 |
| 157 | 3300053077 | Ga0495601_0057365 | Ga0495601_0057365_979_1638 | 218 |
| 158 | 3300053146 | Ga0500588_0002329 | Ga0500588_0002329_1142_1801 | 218 |
| 159 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_284864_285529 | 218 |
| 160 | iso_pu_bacteria | 2818991444 | 2819587859 | 218 |
| 161 | iso_pu_bacteria | 2977232053 | 2977234338 | 218 |
| 162 | 3300003203 | JGI25406J46586_10013534 | JGI25406J46586_100135345 | 219 |
| 163 | 3300003320 | rootH2_10010421 | rootH2_1001042129 | 219 |
| 164 | 3300003323 | rootH1_10312291 | rootH1_103122912 | 219 |
| 165 | 3300005331 | Ga0070670_100009312 | Ga0070670_10000931215 | 219 |
| 166 | 3300005331 | Ga0070670_100377202 | Ga0070670_1003772021 | 219 |
| 167 | 3300005334 | Ga0068869_100026153 | Ga0068869_1000261537 | 219 |
| 168 | 3300005335 | Ga0070666_10026815 | Ga0070666_100268153 | 219 |
| 169 | 3300005338 | Ga0068868_100034831 | Ga0068868_1000348314 | 219 |
| 170 | 3300005340 | Ga0070689_100000405 | Ga0070689_10000040534 | 219 |
| 171 | 3300005353 | Ga0070669_100670907 | Ga0070669_1006709072 | 219 |
| 172 | 3300005355 | Ga0070671_100014853 | Ga0070671_1000148537 | 219 |
| 173 | 3300005364 | Ga0070673_100003821 | Ga0070673_10000382114 | 219 |
| 174 | 3300005365 | Ga0070688_100000683 | Ga0070688_10000068321 | 219 |
| 175 | 3300005365 | Ga0070688_100134287 | Ga0070688_1001342872 | 219 |
| 176 | 3300005367 | Ga0070667_100025827 | Ga0070667_1000258273 | 219 |
| 177 | 3300005434 | Ga0070709_10003881 | Ga0070709_100038814 | 219 |
| 178 | 3300005436 | Ga0070713_100000967 | Ga0070713_10000096726 | 219 |
| 179 | 3300005437 | Ga0070710_10036855 | Ga0070710_100368553 | 219 |
| 180 | 3300005439 | Ga0070711_100002923 | Ga0070711_10000292316 | 219 |
| 181 | 3300005466 | Ga0070685_10000781 | Ga0070685_100007817 | 219 |
| 182 | 3300005539 | Ga0068853_100000646 | Ga0068853_10000064610 | 219 |
| 183 | 3300005544 | Ga0070686_100029095 | Ga0070686_1000290953 | 219 |
| 184 | 3300005548 | Ga0070665_100012399 | Ga0070665_1000123991 | 219 |
| 185 | 3300005564 | Ga0070664_100031918 | Ga0070664_1000319183 | 219 |
| 186 | 3300005615 | Ga0070702_100024663 | Ga0070702_1000246637 | 219 |
| 187 | 3300005616 | Ga0068852_100034295 | Ga0068852_1000342958 | 219 |
| 188 | 3300005617 | Ga0068859_100009913 | Ga0068859_10000991315 | 219 |
| 189 | 3300005618 | Ga0068864_100003963 | Ga0068864_10000396322 | 219 |
| 190 | 3300005618 | Ga0068864_101037666 | Ga0068864_1010376661 | 219 |
| 191 | 3300005834 | Ga0068851_10524769 | Ga0068851_105247691 | 219 |
| 192 | 3300005840 | Ga0068870_10119689 | Ga0068870_101196892 | 219 |
| 193 | 3300005841 | Ga0068863_100006358 | Ga0068863_1000063583 | 219 |
| 194 | 3300005842 | Ga0068858_100027089 | Ga0068858_1000270897 | 219 |
| 195 | 3300005843 | Ga0068860_100127227 | Ga0068860_1001272274 | 219 |
| 196 | 3300005983 | Ga0081540_1016375 | Ga0081540_10163754 | 219 |
| 197 | 3300005985 | Ga0081539_10001260 | Ga0081539_1000126013 | 219 |
| 198 | 3300006163 | Ga0070715_10012733 | Ga0070715_100127334 | 219 |
| 199 | 3300006173 | Ga0070716_100013118 | Ga0070716_1000131181 | 219 |
| 200 | 3300006175 | Ga0070712_100004729 | Ga0070712_1000047297 | 219 |
| 201 | 3300006237 | Ga0097621_100149956 | Ga0097621_1001499563 | 219 |
| 202 | 3300006358 | Ga0068871_100190328 | Ga0068871_1001903282 | 219 |
| 203 | 3300006871 | Ga0075434_101015993 | Ga0075434_1010159932 | 219 |
| 204 | 3300006931 | Ga0097620_100009913 | Ga0097620_10000991315 | 219 |
| 205 | 3300007076 | Ga0075435_100109075 | Ga0075435_1001090753 | 219 |
| 206 | 3300007265 | Ga0099794_10061020 | Ga0099794_100610201 | 219 |
| 207 | 3300007788 | Ga0099795_10003893 | Ga0099795_100038933 | 219 |
| 208 | 3300007788 | Ga0099795_10178596 | Ga0099795_101785961 | 219 |
| 209 | 3300009093 | Ga0105240_10000086 | Ga0105240_10000086108 | 219 |
| 210 | 3300009093 | Ga0105240_10000105 | Ga0105240_10000105110 | 219 |
| 211 | 3300009093 | Ga0105240_10147283 | Ga0105240_101472833 | 219 |
| 212 | 3300009093 | Ga0105240_10346613 | Ga0105240_103466132 | 219 |
| 213 | 3300009098 | Ga0105245_10044224 | Ga0105245_100442243 | 219 |
| 214 | 3300009101 | Ga0105247_10001753 | Ga0105247_1000175315 | 219 |
| 215 | 3300009147 | Ga0114129_11645720 | Ga0114129_116457201 | 219 |
| 216 | 3300009148 | Ga0105243_10357890 | Ga0105243_103578902 | 219 |
| 217 | 3300009174 | Ga0105241_10029415 | Ga0105241_100294153 | 219 |
| 218 | 3300009176 | Ga0105242_10085986 | Ga0105242_100859863 | 219 |
| 219 | 3300009176 | Ga0105242_10165742 | Ga0105242_101657424 | 219 |
| 220 | 3300009177 | Ga0105248_10176986 | Ga0105248_101769862 | 219 |
| 221 | 3300009177 | Ga0105248_10185042 | Ga0105248_101850423 | 219 |
| 222 | 3300009545 | Ga0105237_10018159 | Ga0105237_100181594 | 219 |
| 223 | 3300009545 | Ga0105237_10393039 | Ga0105237_103930392 | 219 |
| 224 | 3300009551 | Ga0105238_10052033 | Ga0105238_100520332 | 219 |
| 225 | 3300009551 | Ga0105238_10053458 | Ga0105238_100534583 | 219 |
| 226 | 3300009551 | Ga0105238_10161956 | Ga0105238_101619564 | 219 |
| 227 | 3300009553 | Ga0105249_10093571 | Ga0105249_100935712 | 219 |
| 228 | 3300010375 | Ga0105239_10000313 | Ga0105239_1000031359 | 219 |
| 229 | 3300010375 | Ga0105239_10001195 | Ga0105239_1000119524 | 219 |
| 230 | 3300010375 | Ga0105239_10758576 | Ga0105239_107585762 | 219 |
| 231 | 3300011119 | Ga0105246_10032100 | Ga0105246_100321002 | 219 |
| 232 | 3300013100 | Ga0157373_10005182 | Ga0157373_100051823 | 219 |
| 233 | 3300013104 | Ga0157370_10333403 | Ga0157370_103334031 | 219 |
| 234 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002573 | 219 |
| 235 | 3300013296 | Ga0157374_10004115 | Ga0157374_1000411521 | 219 |
| 236 | 3300013296 | Ga0157374_10076001 | Ga0157374_100760012 | 219 |
| 237 | 3300013296 | Ga0157374_10374559 | Ga0157374_103745592 | 219 |
| 238 | 3300013296 | Ga0157374_10825432 | Ga0157374_108254321 | 219 |
| 239 | 3300013297 | Ga0157378_10043739 | Ga0157378_100437393 | 219 |
| 240 | 3300013297 | Ga0157378_10097786 | Ga0157378_100977863 | 219 |
| 241 | 3300013297 | Ga0157378_11365322 | Ga0157378_113653221 | 219 |
| 242 | 3300013306 | Ga0163162_10000109 | Ga0163162_1000010954 | 219 |
| 243 | 3300013306 | Ga0163162_10123692 | Ga0163162_101236924 | 219 |
| 244 | 3300013306 | Ga0163162_10123909 | Ga0163162_101239094 | 219 |
| 245 | 3300013307 | Ga0157372_10000617 | Ga0157372_100006176 | 219 |
| 246 | 3300013308 | Ga0157375_10189997 | Ga0157375_101899973 | 219 |
| 247 | 3300013308 | Ga0157375_10253028 | Ga0157375_102530283 | 219 |
| 248 | 3300014325 | Ga0163163_10014607 | Ga0163163_1001460712 | 219 |
| 249 | 3300014968 | Ga0157379_10000468 | Ga0157379_1000046822 | 219 |
| 250 | 3300014969 | Ga0157376_10087384 | Ga0157376_100873844 | 219 |
| 251 | 3300014969 | Ga0157376_10419978 | Ga0157376_104199782 | 219 |
| 252 | 3300025261 | Ga0209233_1020811 | Ga0209233_10208112 | 219 |
| 253 | 3300025898 | Ga0207692_10017644 | Ga0207692_100176444 | 219 |
| 254 | 3300025900 | Ga0207710_10050580 | Ga0207710_100505803 | 219 |
| 255 | 3300025903 | Ga0207680_10048250 | Ga0207680_100482503 | 219 |
| 256 | 3300025913 | Ga0207695_10000175 | Ga0207695_1000017536 | 219 |
| 257 | 3300025913 | Ga0207695_10000193 | Ga0207695_1000019328 | 219 |
| 258 | 3300025913 | Ga0207695_10021408 | Ga0207695_100214084 | 219 |
| 259 | 3300025914 | Ga0207671_10007762 | Ga0207671_100077623 | 219 |
| 260 | 3300025915 | Ga0207693_10000325 | Ga0207693_1000032519 | 219 |
| 261 | 3300025916 | Ga0207663_10053307 | Ga0207663_100533074 | 219 |
| 262 | 3300025923 | Ga0207681_10088041 | Ga0207681_100880412 | 219 |
| 263 | 3300025924 | Ga0207694_10061757 | Ga0207694_100617573 | 219 |
| 264 | 3300025924 | Ga0207694_10267824 | Ga0207694_102678243 | 219 |
| 265 | 3300025925 | Ga0207650_10038163 | Ga0207650_100381637 | 219 |
| 266 | 3300025925 | Ga0207650_10058175 | Ga0207650_100581755 | 219 |
| 267 | 3300025927 | Ga0207687_10065545 | Ga0207687_100655453 | 219 |
| 268 | 3300025928 | Ga0207700_10003146 | Ga0207700_100031463 | 219 |
| 269 | 3300025931 | Ga0207644_10032020 | Ga0207644_100320206 | 219 |
| 270 | 3300025936 | Ga0207670_10024025 | Ga0207670_100240254 | 219 |
| 271 | 3300025936 | Ga0207670_10236185 | Ga0207670_102361852 | 219 |
| 272 | 3300025938 | Ga0207704_10233293 | Ga0207704_102332932 | 219 |
| 273 | 3300025941 | Ga0207711_10000206 | Ga0207711_1000020672 | 219 |
| 274 | 3300025960 | Ga0207651_10003757 | Ga0207651_100037576 | 219 |
| 275 | 3300025961 | Ga0207712_10060602 | Ga0207712_100606021 | 219 |
| 276 | 3300025986 | Ga0207658_10027193 | Ga0207658_100271936 | 219 |
| 277 | 3300026023 | Ga0207677_10003774 | Ga0207677_1000377411 | 219 |
| 278 | 3300026035 | Ga0207703_10023517 | Ga0207703_100235177 | 219 |
| 279 | 3300026078 | Ga0207702_10075404 | Ga0207702_100754043 | 219 |
| 280 | 3300026088 | Ga0207641_10051358 | Ga0207641_100513584 | 219 |
| 281 | 3300026095 | Ga0207676_10006383 | Ga0207676_100063837 | 219 |
| 282 | 3300026116 | Ga0207674_10368114 | Ga0207674_103681142 | 219 |
| 283 | 3300026116 | Ga0207674_10739851 | Ga0207674_107398512 | 219 |
| 284 | 3300026142 | Ga0207698_10189854 | Ga0207698_101898543 | 219 |
| 285 | 3300028379 | Ga0268266_10039461 | Ga0268266_100394613 | 219 |
| 286 | 3300028556 | Ga0265337_1035008 | Ga0265337_10350082 | 219 |
| 287 | 3300031250 | Ga0265331_10115906 | Ga0265331_101159062 | 219 |
| 288 | 3300031507 | Ga0307509_10224400 | Ga0307509_102244002 | 219 |
| 289 | 3300032133 | Ga0316583_10025580 | Ga0316583_100255802 | 219 |
| 290 | 3300032133 | Ga0316583_10079002 | Ga0316583_100790022 | 219 |
| 291 | 3300035083 | Ga0373926_0038629 | Ga0373926_0038629_564_1232 | 219 |
| 292 | 3300035086 | Ga0373934_0007255 | Ga0373934_0007255_3093_3761 | 219 |
| 293 | 3300035111 | Ga0373923_0001540 | Ga0373923_0001540_1111_1779 | 219 |
| 294 | 3300035116 | Ga0373945_0051252 | Ga0373945_0051252_96_764 | 219 |
| 295 | 3300035116 | Ga0373945_0055299 | Ga0373945_0055299_386_1054 | 219 |
| 296 | 3300035118 | Ga0373954_0001962 | Ga0373954_0001962_5272_5940 | 219 |
| 297 | 3300035120 | Ga0373957_0014603 | Ga0373957_0014603_459_1127 | 219 |
| 298 | 3300035170 | Ga0373943_0011742 | Ga0373943_0011742_558_1226 | 219 |
| 299 | 3300035170 | Ga0373943_0022831 | Ga0373943_0022831_702_1370 | 219 |
| 300 | 3300035172 | Ga0373955_0039012 | Ga0373955_0039012_1183_1851 | 219 |
| 301 | 3300035398 | Ga0316574_0102859 | Ga0316574_0102859_941_1603 | 219 |
| 302 | 3300035410 | Ga0373924_0006655 | Ga0373924_0006655_1135_1803 | 219 |
| 303 | 3300035691 | Ga0373931_0139433 | Ga0373931_0139433_17_685 | 219 |
| 304 | 3300035692 | Ga0373935_0019528 | Ga0373935_0019528_667_1335 | 219 |
| 305 | 3300035692 | Ga0373935_0045754 | Ga0373935_0045754_1958_2626 | 219 |
| 306 | 3300035695 | Ga0373927_0132854 | Ga0373927_0132854_498_1166 | 219 |
| 307 | 3300035695 | Ga0373927_0428472 | Ga0373927_0428472_127_795 | 219 |
| 308 | 3300035724 | Ga0373933_0040262 | Ga0373933_0040262_1211_1879 | 219 |
| 309 | 3300036401 | Ga0373937_0007866 | Ga0373937_0007866_4432_5100 | 219 |
| 310 | 3300036401 | Ga0373937_0031181 | Ga0373937_0031181_910_1578 | 219 |
| 311 | 3300037068 | Ga0373925_0114800 | Ga0373925_0114800_373_1041 | 219 |
| 312 | 3300037418 | Ga0395900_0046658 | Ga0395900_0046658_3171_3845 | 219 |
| 313 | 3300037466 | Ga0395898_0440741 | Ga0395898_0440741_400_1074 | 219 |
| 314 | 3300041512 | Ga0451853_2023802 | Ga0451853_2023802_180_839 | 219 |
| 315 | 3300042876 | Ga0451577_0016862 | Ga0451577_0016862_1102_1764 | 219 |
| 316 | 3300042876 | Ga0451577_0599973 | Ga0451577_0599973_66_728 | 219 |
| 317 | 3300044673 | Ga0453683_0000162 | Ga0453683_0000162_67930_68592 | 219 |
| 318 | 3300044673 | Ga0453683_0020950 | Ga0453683_0020950_138_800 | 219 |
| 319 | 3300044684 | Ga0466966_0174210 | Ga0466966_0174210_42_701 | 219 |
| 320 | 3300044706 | Ga0466964_0133460 | Ga0466964_0133460_417_1076 | 219 |
| 321 | 3300044712 | Ga0453684_0000604 | Ga0453684_0000604_35104_35766 | 219 |
| 322 | 3300044719 | Ga0466971_0010042 | Ga0466971_0010042_1806_2465 | 219 |
| 323 | 3300044765 | Ga0466970_0033032 | Ga0466970_0033032_1552_2211 | 219 |
| 324 | 3300044765 | Ga0466970_0103862 | Ga0466970_0103862_850_1509 | 219 |
| 325 | 3300045051 | Ga0451576_0000299 | Ga0451576_0000299_20782_21444 | 219 |
| 326 | 3300045051 | Ga0451576_0000913 | Ga0451576_0000913_36331_36993 | 219 |
| 327 | 3300046454 | Ga0495592_0090373 | Ga0495592_0090373_632_1294 | 219 |
| 328 | 3300046454 | Ga0495592_0090393 | Ga0495592_0090393_123_791 | 219 |
| 329 | 3300046460 | Ga0495638_0188481 | Ga0495638_0188481_15_674 | 219 |
| 330 | 3300046472 | Ga0495580_0011883 | Ga0495580_0011883_4226_4894 | 219 |
| 331 | 3300046472 | Ga0495580_0035198 | Ga0495580_0035198_2211_2879 | 219 |
| 332 | 3300046475 | Ga0495639_0027892 | Ga0495639_0027892_915_1583 | 219 |
| 333 | 3300046476 | Ga0495662_0092595 | Ga0495662_0092595_791_1459 | 219 |
| 334 | 3300046499 | Ga0495594_0037284 | Ga0495594_0037284_1000_1668 | 219 |
| 335 | 3300046506 | Ga0495583_0054967 | Ga0495583_0054967_368_1117 | 219 |
| 336 | 3300046507 | Ga0495606_0213470 | Ga0495606_0213470_389_1048 | 219 |
| 337 | 3300046517 | Ga0495630_0043941 | Ga0495630_0043941_519_1187 | 219 |
| 338 | 3300046531 | Ga0495665_0023392 | Ga0495665_0023392_152_820 | 219 |
| 339 | 3300046533 | Ga0495640_0063064 | Ga0495640_0063064_1597_2265 | 219 |
| 340 | 3300046533 | Ga0495640_0083681 | Ga0495640_0083681_834_1502 | 219 |
| 341 | 3300046535 | Ga0495586_0046787 | Ga0495586_0046787_1557_2225 | 219 |
| 342 | 3300046538 | Ga0495609_0048952 | Ga0495609_0048952_19_687 | 219 |
| 343 | 3300046543 | Ga0495645_0023230 | Ga0495645_0023230_3299_3967 | 219 |
| 344 | 3300046543 | Ga0495645_0040280 | Ga0495645_0040280_274_942 | 219 |
| 345 | 3300046559 | Ga0495667_0092936 | Ga0495667_0092936_102_770 | 219 |
| 346 | 3300046616 | Ga0495668_0000526 | Ga0495668_0000526_20252_20911 | 219 |
| 347 | 3300046642 | Ga0495634_0032823 | Ga0495634_0032823_2698_3360 | 219 |
| 348 | 3300046663 | Ga0495635_0054562 | Ga0495635_0054562_721_1389 | 219 |
| 349 | 3300046674 | Ga0495588_0199789 | Ga0495588_0199789_258_926 | 219 |
| 350 | 3300046679 | Ga0495623_0090135 | Ga0495623_0090135_572_1240 | 219 |
| 351 | 3300046681 | Ga0495647_0040939 | Ga0495647_0040939_177_845 | 219 |
| 352 | 3300046683 | Ga0495658_0025524 | Ga0495658_0025524_1239_1907 | 219 |
| 353 | 3300046689 | Ga0495613_0046901 | Ga0495613_0046901_1507_2175 | 219 |
| 354 | 3300046694 | Ga0495649_0032766 | Ga0495649_0032766_1135_1794 | 219 |
| 355 | 3300047315 | Ga0495581_0000884 | Ga0495581_0000884_365_1033 | 219 |
| 356 | 3300047317 | Ga0495604_0202754 | Ga0495604_0202754_521_1189 | 219 |
| 357 | 3300047319 | Ga0495674_0056639 | Ga0495674_0056639_618_1286 | 219 |
| 358 | 3300047322 | Ga0495680_0089986 | Ga0495680_0089986_1072_1740 | 219 |
| 359 | 3300047471 | Ga0495684_0049551 | Ga0495684_0049551_1266_1934 | 219 |
| 360 | 3300047471 | Ga0495684_0285805 | Ga0495684_0285805_473_1141 | 219 |
| 361 | 3300047673 | Ga0495593_0045865 | Ga0495593_0045865_105_773 | 219 |
| 362 | 3300048088 | Ga0495602_0236243 | Ga0495602_0236243_247_915 | 219 |
| 363 | 3300048908 | Ga0496105_0102834 | Ga0496105_0102834_718_1386 | 219 |
| 364 | 3300048910 | Ga0496107_0021378 | Ga0496107_0021378_2108_2776 | 219 |
| 365 | 3300048911 | Ga0496108_0360945 | Ga0496108_0360945_256_924 | 219 |
| 366 | 3300048912 | Ga0496109_0002530 | Ga0496109_0002530_9676_10344 | 219 |
| 367 | 3300048917 | Ga0496114_0011119 | Ga0496114_0011119_2346_3014 | 219 |
| 368 | 3300048918 | Ga0496115_0291375 | Ga0496115_0291375_108_767 | 219 |
| 369 | 3300049581 | Ga0501047_0424817 | Ga0501047_0424817_389_1051 | 219 |
| 370 | 3300049744 | Ga0501083_0098944 | Ga0501083_0098944_1023_1682 | 219 |
| 371 | 3300050512 | nmdc:mga0n895_870595_c1 | nmdc:mga0n895_870595_c1_116_784 | 219 |
| 372 | 3300050513 | nmdc:mga0rr50_70638_c1 | nmdc:mga0rr50_70638_c1_660_1328 | 219 |
| 373 | 3300053077 | Ga0495601_0141515 | Ga0495601_0141515_826_1494 | 219 |
| 374 | 3300053085 | Ga0495619_0001956 | Ga0495619_0001956_10548_11216 | 219 |
| 375 | 3300053086 | Ga0500578_0209412 | Ga0500578_0209412_129_788 | 219 |
| 376 | 3300053090 | Ga0500646_0028536 | Ga0500646_0028536_624_1283 | 219 |
| 377 | 3300053104 | Ga0500556_0018576 | Ga0500556_0018576_50_709 | 219 |
| 378 | 3300053125 | Ga0500618_000010 | Ga0500618_000010_11211_11870 | 219 |
| 379 | 3300053130 | Ga0500642_0026381 | Ga0500642_0026381_1653_2312 | 219 |
| 380 | 3300053142 | Ga0500577_0039752 | Ga0500577_0039752_207_866 | 219 |
| 381 | 3300053158 | Ga0500627_0040170 | Ga0500627_0040170_1047_1706 | 219 |
| 382 | 3300053727 | Ga0500611_000026 | Ga0500611_000026_85788_86453 | 219 |
| 383 | 3300053731 | Ga0500609_025558 | Ga0500609_025558_95_754 | 219 |
| 384 | iso_pu_bacteria | 2576861424 | 2578338325 | 219 |
| 385 | iso_pu_bacteria | 2928078545 | 2928082429 | 219 |
| 386 | iso_pu_bacteria | 2971511577 | 2971515955 | 219 |
| 387 | iso_pu_bacteria | 2980176882 | 2980177832 | 219 |
| 388 | 3300005334 | Ga0068869_100252278 | Ga0068869_1002522781 | 220 |
| 389 | 3300005340 | Ga0070689_100475685 | Ga0070689_1004756851 | 220 |
| 390 | 3300005471 | Ga0070698_100038618 | Ga0070698_1000386184 | 220 |
| 391 | 3300005471 | Ga0070698_100221929 | Ga0070698_1002219292 | 220 |
| 392 | 3300005535 | Ga0070684_100696572 | Ga0070684_1006965722 | 220 |
| 393 | 3300005539 | Ga0068853_100273875 | Ga0068853_1002738752 | 220 |
| 394 | 3300005546 | Ga0070696_100586616 | Ga0070696_1005866161 | 220 |
| 395 | 3300005617 | Ga0068859_100558125 | Ga0068859_1005581252 | 220 |
| 396 | 3300005718 | Ga0068866_10431738 | Ga0068866_104317381 | 220 |
| 397 | 3300005841 | Ga0068863_100009757 | Ga0068863_1000097578 | 220 |
| 398 | 3300005841 | Ga0068863_100022841 | Ga0068863_1000228415 | 220 |
| 399 | 3300005843 | Ga0068860_100419440 | Ga0068860_1004194402 | 220 |
| 400 | 3300006237 | Ga0097621_100021134 | Ga0097621_1000211342 | 220 |
| 401 | 3300006358 | Ga0068871_100020140 | Ga0068871_1000201404 | 220 |
| 402 | 3300006358 | Ga0068871_100474042 | Ga0068871_1004740421 | 220 |
| 403 | 3300006881 | Ga0068865_100285083 | Ga0068865_1002850832 | 220 |
| 404 | 3300006881 | Ga0068865_100298407 | Ga0068865_1002984072 | 220 |
| 405 | 3300006931 | Ga0097620_100558105 | Ga0097620_1005581052 | 220 |
| 406 | 3300009094 | Ga0111539_10215628 | Ga0111539_102156282 | 220 |
| 407 | 3300009094 | Ga0111539_10956453 | Ga0111539_109564532 | 220 |
| 408 | 3300009147 | Ga0114129_10050326 | Ga0114129_100503264 | 220 |
| 409 | 3300009176 | Ga0105242_10003372 | Ga0105242_100033726 | 220 |
| 410 | 3300009176 | Ga0105242_10079663 | Ga0105242_100796632 | 220 |
| 411 | 3300009176 | Ga0105242_10711151 | Ga0105242_107111511 | 220 |
| 412 | 3300009545 | Ga0105237_10042009 | Ga0105237_100420092 | 220 |
| 413 | 3300009553 | Ga0105249_10025511 | Ga0105249_100255113 | 220 |
| 414 | 3300009553 | Ga0105249_11374990 | Ga0105249_113749901 | 220 |
| 415 | 3300013296 | Ga0157374_10160388 | Ga0157374_101603882 | 220 |
| 416 | 3300013296 | Ga0157374_10821754 | Ga0157374_108217541 | 220 |
| 417 | 3300013297 | Ga0157378_10376281 | Ga0157378_103762812 | 220 |
| 418 | 3300013306 | Ga0163162_10143214 | Ga0163162_101432142 | 220 |
| 419 | 3300013306 | Ga0163162_11619759 | Ga0163162_116197591 | 220 |
| 420 | 3300014326 | Ga0157380_10451450 | Ga0157380_104514502 | 220 |
| 421 | 3300014326 | Ga0157380_10589861 | Ga0157380_105898611 | 220 |
| 422 | 3300014969 | Ga0157376_10042301 | Ga0157376_100423017 | 220 |
| 423 | 3300025893 | Ga0207682_10285115 | Ga0207682_102851151 | 220 |
| 424 | 3300025899 | Ga0207642_10443876 | Ga0207642_104438761 | 220 |
| 425 | 3300025908 | Ga0207643_10237953 | Ga0207643_102379531 | 220 |
| 426 | 3300025914 | Ga0207671_10285179 | Ga0207671_102851792 | 220 |
| 427 | 3300025934 | Ga0207686_10002988 | Ga0207686_100029883 | 220 |
| 428 | 3300025934 | Ga0207686_10121214 | Ga0207686_101212142 | 220 |
| 429 | 3300025938 | Ga0207704_10357423 | Ga0207704_103574232 | 220 |
| 430 | 3300025942 | Ga0207689_10581395 | Ga0207689_105813951 | 220 |
| 431 | 3300025949 | Ga0207667_10180715 | Ga0207667_101807153 | 220 |
| 432 | 3300025961 | Ga0207712_10023889 | Ga0207712_100238895 | 220 |
| 433 | 3300026078 | Ga0207702_10015550 | Ga0207702_100155504 | 220 |
| 434 | 3300026088 | Ga0207641_10000371 | Ga0207641_1000037145 | 220 |
| 435 | 3300026088 | Ga0207641_10041694 | Ga0207641_100416945 | 220 |
| 436 | 3300026089 | Ga0207648_10205080 | Ga0207648_102050802 | 220 |
| 437 | 3300026116 | Ga0207674_10099645 | Ga0207674_100996451 | 220 |
| 438 | 3300026118 | Ga0207675_100308155 | Ga0207675_1003081552 | 220 |
| 439 | 3300028380 | Ga0268265_10098247 | Ga0268265_100982472 | 220 |
| 440 | 3300028381 | Ga0268264_10406590 | Ga0268264_104065902 | 220 |
| 441 | 3300028573 | Ga0265334_10106084 | Ga0265334_101060841 | 220 |
| 442 | 3300028666 | Ga0265336_10032732 | Ga0265336_100327322 | 220 |
| 443 | 3300028800 | Ga0265338_10003080 | Ga0265338_1000308016 | 220 |
| 444 | 3300028800 | Ga0265338_10180041 | Ga0265338_101800413 | 220 |
| 445 | 3300028800 | Ga0265338_10378283 | Ga0265338_103782832 | 220 |
| 446 | 3300031344 | Ga0265316_10005277 | Ga0265316_100052773 | 220 |
| 447 | 3300035695 | Ga0373927_0032592 | Ga0373927_0032592_508_1173 | 220 |
| 448 | 3300041406 | Ga0439439_0001900 | Ga0439439_0001900_2993_3658 | 220 |
| 449 | 3300041441 | Ga0451787_341172 | Ga0451787_341172_26_688 | 220 |
| 450 | 3300041496 | Ga0451839_0695238 | Ga0451839_0695238_156_821 | 220 |
| 451 | 3300041505 | Ga0451849_1366099 | Ga0451849_1366099_534_1325 | 220 |
| 452 | 3300041509 | Ga0451843_1210020 | Ga0451843_1210020_138_803 | 220 |
| 453 | 3300042014 | Ga0439457_001015 | Ga0439457_001015_3292_3957 | 220 |
| 454 | 3300044658 | Ga0466972_0000075 | Ga0466972_0000075_53270_53935 | 220 |
| 455 | 3300044658 | Ga0466972_0012429 | Ga0466972_0012429_1475_2140 | 220 |
| 456 | 3300044842 | Ga0466957_0008518 | Ga0466957_0008518_1232_1897 | 220 |
| 457 | 3300046539 | Ga0495621_0081033 | Ga0495621_0081033_80_745 | 220 |
| 458 | 3300046660 | Ga0495625_0061260 | Ga0495625_0061260_44_715 | 220 |
| 459 | 3300049581 | Ga0501047_0020598 | Ga0501047_0020598_4029_4694 | 220 |
| 460 | 3300049581 | Ga0501047_0388716 | Ga0501047_0388716_537_1202 | 220 |
| 461 | 3300049582 | Ga0501048_0323869 | Ga0501048_0323869_68_733 | 220 |
| 462 | 3300049661 | Ga0501217_018075 | Ga0501217_018075_870_1544 | 220 |
| 463 | 3300049669 | Ga0501235_080771 | Ga0501235_080771_82_747 | 220 |
| 464 | 3300049705 | Ga0501225_0010633 | Ga0501225_0010633_349_1014 | 220 |
| 465 | 3300049823 | Ga0501044_0024091 | Ga0501044_0024091_5330_5995 | 220 |
| 466 | 3300050493 | nmdc:mga0k408_59567_c1 | nmdc:mga0k408_59567_c1_1090_1755 | 220 |
| 467 | 3300050507 | nmdc:mga05p37_10194_c2 | nmdc:mga05p37_10194_c2_546_1211 | 220 |
| 468 | 3300053086 | Ga0500578_0000091 | Ga0500578_0000091_80463_81128 | 220 |
| 469 | 3300053086 | Ga0500578_0021779 | Ga0500578_0021779_956_1621 | 220 |
| 470 | 3300053088 | Ga0500644_0035139 | Ga0500644_0035139_671_1336 | 220 |
| 471 | 3300053089 | Ga0500581_215700 | Ga0500581_215700_63_728 | 220 |
| 472 | 3300053092 | Ga0500583_0000011 | Ga0500583_0000011_100734_101399 | 220 |
| 473 | 3300053103 | Ga0500555_016697 | Ga0500555_016697_821_1486 | 220 |
| 474 | 3300053115 | Ga0500591_073448 | Ga0500591_073448_54_716 | 220 |
| 475 | 3300053150 | Ga0500603_096533 | Ga0500603_096533_23_688 | 220 |
| 476 | 3300053153 | Ga0500616_0004297 | Ga0500616_0004297_9083_9787 | 220 |
| 477 | 3300053156 | Ga0500622_0000844 | Ga0500622_0000844_13527_14192 | 220 |
| 478 | 3300053156 | Ga0500622_0001136 | Ga0500622_0001136_71_742 | 220 |
| 479 | 3300053159 | Ga0500630_088313 | Ga0500630_088313_142_804 | 220 |
| 480 | 3300003320 | rootH2_10094573 | rootH2_100945731 | 221 |
| 481 | 3300003322 | rootL2_10061803 | rootL2_100618035 | 221 |
| 482 | 3300003322 | rootL2_10195108 | rootL2_101951083 | 221 |
| 483 | 3300010375 | Ga0105239_10029591 | Ga0105239_100295914 | 221 |
| 484 | 3300028666 | Ga0265336_10000003 | Ga0265336_10000003293 | 221 |
| 485 | 3300029957 | Ga0265324_10001536 | Ga0265324_100015365 | 221 |
| 486 | 3300031344 | Ga0265316_10000246 | Ga0265316_1000024636 | 221 |
| 487 | 3300031548 | Ga0307408_100884888 | Ga0307408_1008848881 | 221 |
| 488 | 3300044656 | Ga0466969_0000371 | Ga0466969_0000371_5042_5710 | 221 |
| 489 | 3300044684 | Ga0466966_0000131 | Ga0466966_0000131_26632_27300 | 221 |
| 490 | 3300044693 | Ga0466961_0060382 | Ga0466961_0060382_126_794 | 221 |
| 491 | 3300045049 | Ga0466959_0000003 | Ga0466959_0000003_42069_42737 | 221 |
| 492 | 3300049652 | Ga0501202_008218 | Ga0501202_008218_856_1533 | 221 |
| 493 | 3300049670 | Ga0501236_000930 | Ga0501236_000930_2497_3174 | 221 |
| 494 | 3300049674 | Ga0501242_000387 | Ga0501242_000387_2370_3044 | 221 |
| 495 | 3300049686 | Ga0501257_000158 | Ga0501257_000158_4278_4952 | 221 |
| 496 | 3300049686 | Ga0501257_000385 | Ga0501257_000385_5040_5717 | 221 |
| 497 | 3300049705 | Ga0501225_0004322 | Ga0501225_0004322_2631_3305 | 221 |
| 498 | 3300049761 | Ga0501264_000543 | Ga0501264_000543_1708_2385 | 221 |
| 499 | 3300049761 | Ga0501264_005145 | Ga0501264_005145_469_1143 | 221 |
| 500 | 3300053136 | Ga0500559_0008054 | Ga0500559_0008054_2634_3299 | 221 |
| 501 | 3300053138 | Ga0500564_124461 | Ga0500564_124461_108_773 | 221 |
| 502 | 3300002705 | JGI25156J39149_1016866 | JGI25156J39149_10168662 | 222 |
| 503 | 3300003322 | rootL2_10206004 | rootL2_102060041 | 222 |
| 504 | 3300003761 | Ga0055535_1000403 | Ga0055535_100040332 | 222 |
| 505 | 3300003763 | Ga0055529_1000195 | Ga0055529_100019532 | 222 |
| 506 | 3300003794 | Ga0055531_10000354 | Ga0055531_100003544 | 222 |
| 507 | 3300005293 | Ga0065715_10089350 | Ga0065715_100893501 | 222 |
| 508 | 3300005327 | Ga0070658_10063567 | Ga0070658_100635673 | 222 |
| 509 | 3300005339 | Ga0070660_100082318 | Ga0070660_1000823182 | 222 |
| 510 | 3300005364 | Ga0070673_100114620 | Ga0070673_1001146201 | 222 |
| 511 | 3300005364 | Ga0070673_100579038 | Ga0070673_1005790382 | 222 |
| 512 | 3300005366 | Ga0070659_100247317 | Ga0070659_1002473171 | 222 |
| 513 | 3300005435 | Ga0070714_100000097 | Ga0070714_10000009764 | 222 |
| 514 | 3300005616 | Ga0068852_100376449 | Ga0068852_1003764492 | 222 |
| 515 | 3300009093 | Ga0105240_10009554 | Ga0105240_100095545 | 222 |
| 516 | 3300009094 | Ga0111539_10007729 | Ga0111539_1000772913 | 222 |
| 517 | 3300009545 | Ga0105237_10450313 | Ga0105237_104503131 | 222 |
| 518 | 3300013104 | Ga0157370_10015764 | Ga0157370_100157645 | 222 |
| 519 | 3300013306 | Ga0163162_10009385 | Ga0163162_100093853 | 222 |
| 520 | 3300013307 | Ga0157372_11435024 | Ga0157372_114350241 | 222 |
| 521 | 3300014326 | Ga0157380_10100131 | Ga0157380_101001312 | 222 |
| 522 | 3300014326 | Ga0157380_10212465 | Ga0157380_102124651 | 222 |
| 523 | 3300014326 | Ga0157380_11242165 | Ga0157380_112421651 | 222 |
| 524 | 3300025228 | Ga0209672_102553 | Ga0209672_1025532 | 222 |
| 525 | 3300025242 | Ga0209258_100291 | Ga0209258_10029134 | 222 |
| 526 | 3300025256 | Ga0209759_1000522 | Ga0209759_100052222 | 222 |
| 527 | 3300025256 | Ga0209759_1000641 | Ga0209759_100064110 | 222 |
| 528 | 3300025272 | Ga0209455_1000208 | Ga0209455_100020840 | 222 |
| 529 | 3300025292 | Ga0209676_1000425 | Ga0209676_100042568 | 222 |
| 530 | 3300025304 | Ga0209257_1000008 | Ga0209257_1000008980 | 222 |
| 531 | 3300025909 | Ga0207705_10045960 | Ga0207705_100459602 | 222 |
| 532 | 3300025929 | Ga0207664_10000078 | Ga0207664_100000789 | 222 |
| 533 | 3300025949 | Ga0207667_10048420 | Ga0207667_100484203 | 222 |
| 534 | 3300025960 | Ga0207651_10006731 | Ga0207651_100067315 | 222 |
| 535 | 3300026142 | Ga0207698_10421763 | Ga0207698_104217632 | 222 |
| 536 | 3300028379 | Ga0268266_10000088 | Ga0268266_10000088108 | 222 |
| 537 | 3300031344 | Ga0265316_10183976 | Ga0265316_101839762 | 222 |
| 538 | 3300031548 | Ga0307408_100001708 | Ga0307408_1000017084 | 222 |
| 539 | 3300031712 | Ga0265342_10124039 | Ga0265342_101240392 | 222 |
| 540 | 3300042876 | Ga0451577_0292794 | Ga0451577_0292794_556_1302 | 222 |
| 541 | 3300044712 | Ga0453684_0004825 | Ga0453684_0004825_654_1400 | 222 |
| 542 | 3300044765 | Ga0466970_0008141 | Ga0466970_0008141_4524_5222 | 222 |
| 543 | 3300045049 | Ga0466959_0052730 | Ga0466959_0052730_1449_2132 | 222 |
| 544 | 3300045051 | Ga0451576_0002946 | Ga0451576_0002946_22763_23509 | 222 |
| 545 | 3300046462 | Ga0495651_0309763 | Ga0495651_0309763_254_922 | 222 |
| 546 | 3300046471 | Ga0495650_0007871 | Ga0495650_0007871_3701_4369 | 222 |
| 547 | 3300046475 | Ga0495639_0004602 | Ga0495639_0004602_719_1387 | 222 |
| 548 | 3300046648 | Ga0495611_0240959 | Ga0495611_0240959_72_752 | 222 |
| 549 | 3300047472 | Ga0495686_0016151 | Ga0495686_0016151_2754_3422 | 222 |
| 550 | 3300048929 | Ga0496126_0026690 | Ga0496126_0026690_205_924 | 222 |
| 551 | 3300050511 | nmdc:mga08y16_47211_c1 | nmdc:mga08y16_47211_c1_593_1285 | 222 |
| 552 | 3300053080 | Ga0500635_0000267 | Ga0500635_0000267_187_858 | 222 |
| 553 | 3300053090 | Ga0500646_0105765 | Ga0500646_0105765_97_777 | 222 |
| 554 | 3300053156 | Ga0500622_0018143 | Ga0500622_0018143_641_1321 | 222 |
| 555 | iso_pu_bacteria | 2884791551 | 2884793298 | 222 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fmu-assembly1.cif.gz_A | crystal structure of a tat-interacting protein homologue (htatip2, aw111545, cc3, tip30) from mus musculus at 2.30 a resolution | 0.852 | 2 | 217 |
| 6rfq-assembly1.cif.gz_E | cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 | 0.8014 | 3 | 156 |
| 4ivm-assembly1.cif.gz_B | structure of human protoporphyrinogen ix oxidase(r59g) | 0.7917 | 3 | 34 |
| 4ivo-assembly1.cif.gz_B | structure of human protoporphyrinogen ix oxidase(r59q) | 0.7895 | 3 | 34 |
| 5f5l-assembly1.cif.gz_A | the structure of monooxygenase ksta11 in the biosynthetic pathway of kosinostatin | 0.7857 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54WF5_27_272_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9556 | 2 | 218 | 3.40.50.720 |
| af_Q54WF5_27_272_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9306 | 2 | 218 | 3.40.50.720 |
| 2fmuA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.852 | 2 | 217 | 3.40.50.720 |
| af_Q5AP65_1_228_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8332 | 3 | 219 | 3.40.50.720 |
| af_Q5AP65_1_228_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8125 | 3 | 219 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833AP09-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9873 | 2 | 75 |
|
| AF-A0A7Y2MTA3-F1-model_v4 | Epimerase | 0.9847 | 3 | 106 |
|
| AF-A0A519GZU2-F1-model_v4 | Epimerase | 0.983 | 3 | 110 |
|
| AF-A0A519MFY1-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9829 | 1 | 112 |
|
| AF-A0A519SIT4-F1-model_v4 | Epimerase | 0.9827 | 1 | 221 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar