F462958
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 554 | 202 | 554 | 345 |
Family's Representative Sequence
| Representative Sequence | 3300005444|Ga0070694_100044173|Ga0070694_1000441733 |
| Length | 371 |
| Sequence | MASRARGRSSSTPSADTVSSIDRVRVAVAGASGYMGAELLRLLLVHPRVTLTGVTSERLAGEPLARVYPHLRGLTDLAFHDLDPAWLAEAADVVFLALPHMESQRAVPVLRAAGRKVIDLSADYRLHDAEDYVTWYKAPHIDPAGLAEAVYGLPELHRKAIAGASLVASPGCYPVGAILATAPLVKNGLARLDGIVVDGKSGVTGAGAQGRKVDPMYLYTEANENVQAYGLASHRHTAEMDQELSGLAGSPVRVSFTPHLVPLNRGLFTTASVPLATALTTADALRVYREFYAGETFVRVCGEGERPATRQVVGSNYCDVAVAVDARTNRAVCVSAIDNLGKGGSANGVQCLNILFGWHERTGLDAAPVYP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 141 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 142 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 144 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 146 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 155 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 156 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 157 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 158 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 167 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 169 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.72 |
| Rhizosphere | 99.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10169639 | 3300005295 | Bacteria | 1490 |
| 2 | Ga0070676_10001256 | 3300005328 | Bacteria | 12775 |
| 3 | Ga0070670_100016104 | 3300005331 | Bacteria | 6416 |
| 4 | Ga0068869_100004836 | 3300005334 | Bacteria | 8411 |
| 5 | Ga0068869_100247280 | 3300005334 | Bacteria | 1423 |
| 6 | Ga0070680_100000237 | 3300005336 | Bacteria | 36358 |
| 7 | Ga0070680_100016280 | 3300005336 | Bacteria | 5851 |
| 8 | Ga0070682_100002243 | 3300005337 | Bacteria | 10710 |
| 9 | Ga0068868_100237605 | 3300005338 | Bacteria | 1530 |
| 10 | Ga0070660_100001295 | 3300005339 | Bacteria | 17035 |
| 11 | Ga0070689_100217327 | 3300005340 | Bacteria | 1567 |
| 12 | Ga0070691_10009215 | 3300005341 | Bacteria | 4512 |
| 13 | Ga0070691_10052172 | 3300005341 | Bacteria | 1955 |
| 14 | Ga0070687_100048480 | 3300005343 | Bacteria | 2184 |
| 15 | Ga0070661_100002504 | 3300005344 | Bacteria | 12587 |
| 16 | Ga0070692_10001216 | 3300005345 | Bacteria | 9152 |
| 17 | Ga0070692_10012115 | 3300005345 | Bacteria | 3980 |
| 18 | Ga0070669_100005442 | 3300005353 | Bacteria | 9187 |
| 19 | Ga0070675_100472395 | 3300005354 | Bacteria | 1127 |
| 20 | Ga0070673_100043524 | 3300005364 | Bacteria | 3470 |
| 21 | Ga0070659_100010671 | 3300005366 | Bacteria | 6766 |
| 22 | Ga0070667_100102329 | 3300005367 | Bacteria | 2475 |
| 23 | Ga0070703_10069842 | 3300005406 | Bacteria | 1171 |
| 24 | Ga0070701_10002715 | 3300005438 | Bacteria | 6862 |
| 25 | Ga0070711_100030553 | 3300005439 | Bacteria | 3568 |
| 26 | Ga0070705_100001950 | 3300005440 | Bacteria | 10571 |
| 27 | Ga0070705_100001967 | 3300005440 | Bacteria | 10505 |
| 28 | Ga0070705_100028220 | 3300005440 | Bacteria | 3072 |
| 29 | Ga0070705_100037908 | 3300005440 | Bacteria | 2722 |
| 30 | Ga0070705_100077619 | 3300005440 | Bacteria | 2029 |
| 31 | Ga0070705_100122671 | 3300005440 | Bacteria | 1680 |
| 32 | Ga0070705_100150915 | 3300005440 | Bacteria | 1541 |
| 33 | Ga0070700_100047226 | 3300005441 | Bacteria | 2664 |
| 34 | Ga0070694_100000561 | 3300005444 | Bacteria | 20531 |
| 35 | Ga0070694_100020678 | 3300005444 | Bacteria | 4197 |
| 36 | Ga0070694_100044173 | 3300005444 | Bacteria | 2982 |
| 37 | Ga0070694_100070657 | 3300005444 | Bacteria | 2404 |
| 38 | Ga0070694_100075068 | 3300005444 | Bacteria | 2338 |
| 39 | Ga0070708_100001394 | 3300005445 | Bacteria | 18464 |
| 40 | Ga0070708_100011486 | 3300005445 | Bacteria | 7208 |
| 41 | Ga0070708_100012472 | 3300005445 | Bacteria | 6937 |
| 42 | Ga0070708_100023401 | 3300005445 | Bacteria | 5254 |
| 43 | Ga0070708_100029999 | 3300005445 | Bacteria | 4696 |
| 44 | Ga0070708_100046534 | 3300005445 | Bacteria | 3828 |
| 45 | Ga0070708_100072136 | 3300005445 | Bacteria | 3111 |
| 46 | Ga0070708_100173295 | 3300005445 | Bacteria | 2015 |
| 47 | Ga0070708_100346657 | 3300005445 | Bacteria | 1399 |
| 48 | Ga0070663_100002646 | 3300005455 | Bacteria | 10136 |
| 49 | Ga0070662_100073826 | 3300005457 | Bacteria | 2521 |
| 50 | Ga0070681_10028922 | 3300005458 | Bacteria | 5568 |
| 51 | Ga0068867_100046086 | 3300005459 | Bacteria | 3201 |
| 52 | Ga0070706_100002325 | 3300005467 | Bacteria | 19192 |
| 53 | Ga0070706_100003002 | 3300005467 | Bacteria | 16718 |
| 54 | Ga0070706_100004678 | 3300005467 | Bacteria | 13124 |
| 55 | Ga0070706_100017418 | 3300005467 | Bacteria | 6630 |
| 56 | Ga0070706_100092604 | 3300005467 | Bacteria | 2804 |
| 57 | Ga0070706_100175774 | 3300005467 | Bacteria | 1999 |
| 58 | Ga0070706_100221875 | 3300005467 | Bacteria | 1764 |
| 59 | Ga0070707_100002799 | 3300005468 | Bacteria | 16605 |
| 60 | Ga0070707_100005924 | 3300005468 | Bacteria | 11408 |
| 61 | Ga0070707_100011047 | 3300005468 | Bacteria | 8410 |
| 62 | Ga0070707_100038604 | 3300005468 | Bacteria | 4562 |
| 63 | Ga0070707_100048281 | 3300005468 | Bacteria | 4078 |
| 64 | Ga0070707_100248560 | 3300005468 | Bacteria | 1731 |
| 65 | Ga0070707_100361273 | 3300005468 | Bacteria | 1410 |
| 66 | Ga0070707_100454104 | 3300005468 | Bacteria | 1242 |
| 67 | Ga0070707_100524504 | 3300005468 | Bacteria | 1146 |
| 68 | Ga0070698_100000342 | 3300005471 | Bacteria | 48006 |
| 69 | Ga0070698_100049745 | 3300005471 | Bacteria | 4277 |
| 70 | Ga0070698_100200317 | 3300005471 | Bacteria | 1932 |
| 71 | Ga0070698_100285225 | 3300005471 | Bacteria | 1582 |
| 72 | Ga0070698_100368822 | 3300005471 | Bacteria | 1368 |
| 73 | Ga0070699_100000272 | 3300005518 | Bacteria | 49692 |
| 74 | Ga0070699_100008828 | 3300005518 | Bacteria | 8726 |
| 75 | Ga0070699_100018888 | 3300005518 | Bacteria | 5926 |
| 76 | Ga0070699_100086327 | 3300005518 | Bacteria | 2738 |
| 77 | Ga0070699_100096716 | 3300005518 | Bacteria | 2586 |
| 78 | Ga0070699_100120926 | 3300005518 | Bacteria | 2303 |
| 79 | Ga0070699_100298250 | 3300005518 | Bacteria | 1446 |
| 80 | Ga0070699_100379287 | 3300005518 | Bacteria | 1276 |
| 81 | Ga0070679_100148206 | 3300005530 | Bacteria | 2324 |
| 82 | Ga0070684_100081758 | 3300005535 | Bacteria | 2859 |
| 83 | Ga0070697_100002227 | 3300005536 | Bacteria | 14874 |
| 84 | Ga0070697_100005800 | 3300005536 | Bacteria | 9524 |
| 85 | Ga0070697_100011418 | 3300005536 | Bacteria | 6942 |
| 86 | Ga0070697_100050831 | 3300005536 | Bacteria | 3366 |
| 87 | Ga0070697_100102508 | 3300005536 | Unclassified | 2378 |
| 88 | Ga0070697_100287942 | 3300005536 | Bacteria | 1410 |
| 89 | Ga0068853_100002255 | 3300005539 | Bacteria | 14412 |
| 90 | Ga0070672_100019799 | 3300005543 | Bacteria | 4894 |
| 91 | Ga0070695_100000858 | 3300005545 | Bacteria | 16376 |
| 92 | Ga0070695_100003122 | 3300005545 | Bacteria | 9648 |
| 93 | Ga0070695_100003453 | 3300005545 | Bacteria | 9232 |
| 94 | Ga0070695_100005022 | 3300005545 | Bacteria | 7794 |
| 95 | Ga0070695_100146215 | 3300005545 | Bacteria | 1645 |
| 96 | Ga0070696_100004579 | 3300005546 | Bacteria | 9229 |
| 97 | Ga0070696_100012332 | 3300005546 | Bacteria | 5733 |
| 98 | Ga0070696_100044766 | 3300005546 | Bacteria | 3065 |
| 99 | Ga0070696_100052290 | 3300005546 | Bacteria | 2842 |
| 100 | Ga0070696_100131121 | 3300005546 | Bacteria | 1824 |
| 101 | Ga0070693_100002327 | 3300005547 | Bacteria | 8723 |
| 102 | Ga0070704_100016469 | 3300005549 | Bacteria | 4672 |
| 103 | Ga0070704_100033795 | 3300005549 | Bacteria | 3461 |
| 104 | Ga0070704_100098120 | 3300005549 | Bacteria | 2200 |
| 105 | Ga0070704_100219637 | 3300005549 | Bacteria | 1544 |
| 106 | Ga0070704_100369903 | 3300005549 | Bacteria | 1215 |
| 107 | Ga0068855_100004031 | 3300005563 | Bacteria | 17929 |
| 108 | Ga0070664_100031121 | 3300005564 | Bacteria | 4455 |
| 109 | Ga0068854_100064425 | 3300005578 | Bacteria | 2662 |
| 110 | Ga0068856_100008990 | 3300005614 | Bacteria | 9719 |
| 111 | Ga0068859_100008722 | 3300005617 | Bacteria | 10243 |
| 112 | Ga0068859_100079983 | 3300005617 | Bacteria | 3309 |
| 113 | Ga0068859_100158282 | 3300005617 | Bacteria | 2343 |
| 114 | Ga0068864_100010577 | 3300005618 | Bacteria | 7629 |
| 115 | Ga0068864_100106221 | 3300005618 | Bacteria | 2496 |
| 116 | Ga0068870_10001889 | 3300005840 | Bacteria | 8634 |
| 117 | Ga0068863_100018304 | 3300005841 | Bacteria | 6707 |
| 118 | Ga0068863_100158713 | 3300005841 | Bacteria | 2166 |
| 119 | Ga0068858_100500783 | 3300005842 | Bacteria | 1173 |
| 120 | Ga0068860_100004791 | 3300005843 | Bacteria | 13784 |
| 121 | Ga0068860_100013341 | 3300005843 | Bacteria | 8056 |
| 122 | Ga0068860_100144223 | 3300005843 | Bacteria | 2290 |
| 123 | Ga0068862_100000665 | 3300005844 | Bacteria | 35287 |
| 124 | Ga0068862_100026458 | 3300005844 | Bacteria | 4876 |
| 125 | Ga0068862_100030919 | 3300005844 | Bacteria | 4514 |
| 126 | Ga0081455_10000114 | 3300005937 | Bacteria | 91800 |
| 127 | Ga0081538_10108942 | 3300005981 | Bacteria | 1366 |
| 128 | Ga0081540_1019651 | 3300005983 | Bacteria | 4095 |
| 129 | Ga0081539_10000002 | 3300005985 | Bacteria | 601032 |
| 130 | Ga0070716_100033743 | 3300006173 | Bacteria | 2801 |
| 131 | Ga0070712_100007586 | 3300006175 | Bacteria | 6780 |
| 132 | Ga0075428_100000032 | 3300006844 | Bacteria | 118320 |
| 133 | Ga0075428_100000552 | 3300006844 | Bacteria | 38291 |
| 134 | Ga0075428_100007113 | 3300006844 | Bacteria | 12391 |
| 135 | Ga0075428_100012194 | 3300006844 | Bacteria | 9558 |
| 136 | Ga0075428_100112625 | 3300006844 | Bacteria | 2964 |
| 137 | Ga0075428_100175275 | 3300006844 | Bacteria | 2323 |
| 138 | Ga0075428_100306921 | 3300006844 | Bacteria | 1706 |
| 139 | Ga0075430_100000002 | 3300006846 | Bacteria | 150510 |
| 140 | Ga0075430_100002131 | 3300006846 | Bacteria | 16375 |
| 141 | Ga0075430_100003919 | 3300006846 | Bacteria | 12550 |
| 142 | Ga0075430_100004920 | 3300006846 | Bacteria | 11237 |
| 143 | Ga0075430_100007458 | 3300006846 | Bacteria | 9233 |
| 144 | Ga0075430_100054130 | 3300006846 | Bacteria | 3377 |
| 145 | Ga0075430_100121292 | 3300006846 | Bacteria | 2180 |
| 146 | Ga0075431_100000049 | 3300006847 | Bacteria | 63960 |
| 147 | Ga0075431_100000290 | 3300006847 | Bacteria | 39379 |
| 148 | Ga0075431_100000537 | 3300006847 | Bacteria | 31847 |
| 149 | Ga0075431_100002652 | 3300006847 | Bacteria | 17317 |
| 150 | Ga0075431_100003776 | 3300006847 | Bacteria | 14726 |
| 151 | Ga0075431_100012068 | 3300006847 | Bacteria | 8718 |
| 152 | Ga0075431_100016065 | 3300006847 | Bacteria | 7596 |
| 153 | Ga0075431_100058633 | 3300006847 | Bacteria | 3973 |
| 154 | Ga0075431_100163617 | 3300006847 | Bacteria | 2287 |
| 155 | Ga0075431_100275248 | 3300006847 | Bacteria | 1705 |
| 156 | Ga0075433_10000136 | 3300006852 | Bacteria | 38412 |
| 157 | Ga0075433_10000288 | 3300006852 | Bacteria | 30114 |
| 158 | Ga0075433_10010662 | 3300006852 | Bacteria | 7389 |
| 159 | Ga0075433_10021537 | 3300006852 | Bacteria | 5406 |
| 160 | Ga0075433_10087391 | 3300006852 | Bacteria | 2753 |
| 161 | Ga0075433_10096599 | 3300006852 | Bacteria | 2615 |
| 162 | Ga0075433_10100997 | 3300006852 | Bacteria | 2554 |
| 163 | Ga0075433_10170973 | 3300006852 | Bacteria | 1934 |
| 164 | Ga0075434_100000093 | 3300006871 | Bacteria | 49393 |
| 165 | Ga0075434_100005272 | 3300006871 | Bacteria | 11755 |
| 166 | Ga0075434_100025078 | 3300006871 | Bacteria | 5833 |
| 167 | Ga0075434_100034285 | 3300006871 | Bacteria | 5012 |
| 168 | Ga0075434_100049912 | 3300006871 | Bacteria | 4156 |
| 169 | Ga0075434_100126370 | 3300006871 | Bacteria | 2574 |
| 170 | Ga0075434_100158056 | 3300006871 | Bacteria | 2286 |
| 171 | Ga0075434_100394134 | 3300006871 | Bacteria | 1405 |
| 172 | Ga0075429_100000032 | 3300006880 | Bacteria | 64062 |
| 173 | Ga0075429_100001393 | 3300006880 | Bacteria | 19747 |
| 174 | Ga0075429_100013242 | 3300006880 | Bacteria | 7152 |
| 175 | Ga0075429_100016754 | 3300006880 | Bacteria | 6345 |
| 176 | Ga0075429_100017176 | 3300006880 | Bacteria | 6258 |
| 177 | Ga0075429_100023660 | 3300006880 | Bacteria | 5331 |
| 178 | Ga0075429_100039128 | 3300006880 | Bacteria | 4127 |
| 179 | Ga0075429_100050179 | 3300006880 | Bacteria | 3631 |
| 180 | Ga0075429_100109503 | 3300006880 | Bacteria | 2415 |
| 181 | Ga0075429_100190716 | 3300006880 | Bacteria | 1796 |
| 182 | Ga0075436_100000942 | 3300006914 | Bacteria | 19456 |
| 183 | Ga0075436_100059751 | 3300006914 | Bacteria | 2633 |
| 184 | Ga0075436_100111841 | 3300006914 | Bacteria | 1907 |
| 185 | Ga0097620_100008722 | 3300006931 | Bacteria | 10243 |
| 186 | Ga0097620_100079988 | 3300006931 | Bacteria | 3309 |
| 187 | Ga0097620_100158293 | 3300006931 | Bacteria | 2343 |
| 188 | Ga0075435_100002967 | 3300007076 | Bacteria | 11406 |
| 189 | Ga0075435_100004223 | 3300007076 | Bacteria | 9864 |
| 190 | Ga0075435_100015016 | 3300007076 | Bacteria | 5811 |
| 191 | Ga0075435_100058766 | 3300007076 | Bacteria | 3115 |
| 192 | Ga0075435_100091220 | 3300007076 | Bacteria | 2514 |
| 193 | Ga0075435_100228451 | 3300007076 | Bacteria | 1581 |
| 194 | Ga0099794_10014995 | 3300007265 | Bacteria | 3409 |
| 195 | Ga0099794_10031507 | 3300007265 | Bacteria | 2483 |
| 196 | Ga0111539_10000726 | 3300009094 | Bacteria | 42868 |
| 197 | Ga0111539_10000923 | 3300009094 | Bacteria | 38413 |
| 198 | Ga0114129_10000178 | 3300009147 | Bacteria | 70458 |
| 199 | Ga0114129_10000462 | 3300009147 | Bacteria | 48711 |
| 200 | Ga0114129_10000721 | 3300009147 | Bacteria | 41915 |
| 201 | Ga0114129_10001856 | 3300009147 | Bacteria | 28790 |
| 202 | Ga0114129_10003753 | 3300009147 | Bacteria | 21411 |
| 203 | Ga0114129_10008446 | 3300009147 | Bacteria | 14671 |
| 204 | Ga0114129_10011856 | 3300009147 | Bacteria | 12398 |
| 205 | Ga0114129_10011871 | 3300009147 | Bacteria | 12389 |
| 206 | Ga0114129_10013604 | 3300009147 | Bacteria | 11595 |
| 207 | Ga0114129_10021871 | 3300009147 | Bacteria | 9077 |
| 208 | Ga0114129_10026397 | 3300009147 | Bacteria | 8224 |
| 209 | Ga0114129_10053499 | 3300009147 | Bacteria | 5662 |
| 210 | Ga0114129_10060361 | 3300009147 | Bacteria | 5302 |
| 211 | Ga0114129_10112417 | 3300009147 | Bacteria | 3756 |
| 212 | Ga0114129_10170465 | 3300009147 | Bacteria | 2968 |
| 213 | Ga0114129_10179629 | 3300009147 | Bacteria | 2881 |
| 214 | Ga0114129_10229947 | 3300009147 | Bacteria | 2498 |
| 215 | Ga0105243_10102931 | 3300009148 | Bacteria | 2374 |
| 216 | Ga0105241_10002768 | 3300009174 | Bacteria | 13137 |
| 217 | Ga0105241_10094725 | 3300009174 | Bacteria | 2362 |
| 218 | Ga0105242_10035282 | 3300009176 | Bacteria | 4011 |
| 219 | Ga0105248_10308810 | 3300009177 | Bacteria | 1781 |
| 220 | Ga0105249_10005712 | 3300009553 | Bacteria | 10760 |
| 221 | Ga0105249_10189600 | 3300009553 | Bacteria | 2006 |
| 222 | Ga0157373_10000572 | 3300013100 | Bacteria | 28757 |
| 223 | Ga0163162_10002446 | 3300013306 | Bacteria | 17518 |
| 224 | Ga0157372_10001744 | 3300013307 | Bacteria | 23588 |
| 225 | Ga0157375_10050857 | 3300013308 | Bacteria | 4066 |
| 226 | Ga0163163_10069938 | 3300014325 | Bacteria | 3495 |
| 227 | Ga0157380_10108620 | 3300014326 | Bacteria | 2326 |
| 228 | Ga0157380_10188830 | 3300014326 | Bacteria | 1817 |
| 229 | Ga0182007_10033479 | 3300015262 | Bacteria | 1741 |
| 230 | Ga0163161_10044440 | 3300017792 | Bacteria | 3199 |
| 231 | Ga0207653_10005767 | 3300025885 | Bacteria | 3861 |
| 232 | Ga0207685_10071177 | 3300025905 | Unclassified | 1410 |
| 233 | Ga0207645_10003905 | 3300025907 | Bacteria | 11141 |
| 234 | Ga0207643_10000283 | 3300025908 | Bacteria | 35229 |
| 235 | Ga0207684_10000105 | 3300025910 | Bacteria | 160905 |
| 236 | Ga0207684_10004913 | 3300025910 | Bacteria | 12477 |
| 237 | Ga0207684_10016507 | 3300025910 | Bacteria | 6340 |
| 238 | Ga0207684_10018537 | 3300025910 | Bacteria | 5958 |
| 239 | Ga0207684_10055473 | 3300025910 | Bacteria | 3362 |
| 240 | Ga0207684_10221288 | 3300025910 | Unclassified | 1634 |
| 241 | Ga0207684_10237538 | 3300025910 | Bacteria | 1572 |
| 242 | Ga0207654_10004224 | 3300025911 | Bacteria | 7249 |
| 243 | Ga0207707_10012113 | 3300025912 | Bacteria | 7495 |
| 244 | Ga0207707_10261679 | 3300025912 | Bacteria | 1501 |
| 245 | Ga0207693_10011555 | 3300025915 | Bacteria | 7141 |
| 246 | Ga0207663_10216279 | 3300025916 | Bacteria | 1392 |
| 247 | Ga0207660_10001251 | 3300025917 | Bacteria | 17023 |
| 248 | Ga0207662_10054087 | 3300025918 | Bacteria | 2393 |
| 249 | Ga0207657_10005032 | 3300025919 | Bacteria | 13871 |
| 250 | Ga0207652_10005011 | 3300025921 | Bacteria | 10728 |
| 251 | Ga0207652_10081493 | 3300025921 | Bacteria | 2831 |
| 252 | Ga0207646_10004085 | 3300025922 | Bacteria | 16075 |
| 253 | Ga0207646_10006783 | 3300025922 | Bacteria | 11785 |
| 254 | Ga0207646_10008978 | 3300025922 | Bacteria | 9944 |
| 255 | Ga0207646_10011801 | 3300025922 | Bacteria | 8438 |
| 256 | Ga0207646_10017508 | 3300025922 | Bacteria | 6703 |
| 257 | Ga0207646_10029676 | 3300025922 | Bacteria | 4966 |
| 258 | Ga0207646_10051620 | 3300025922 | Bacteria | 3679 |
| 259 | Ga0207646_10365979 | 3300025922 | Bacteria | 1303 |
| 260 | Ga0207681_10008184 | 3300025923 | Bacteria | 6394 |
| 261 | Ga0207681_10032479 | 3300025923 | Bacteria | 3418 |
| 262 | Ga0207690_10005380 | 3300025932 | Bacteria | 7545 |
| 263 | Ga0207706_10002858 | 3300025933 | Bacteria | 16755 |
| 264 | Ga0207686_10082074 | 3300025934 | Bacteria | 2106 |
| 265 | Ga0207670_10018346 | 3300025936 | Bacteria | 4252 |
| 266 | Ga0207665_10056887 | 3300025939 | Bacteria | 2641 |
| 267 | Ga0207665_10167609 | 3300025939 | Bacteria | 1584 |
| 268 | Ga0207691_10091558 | 3300025940 | Bacteria | 2725 |
| 269 | Ga0207689_10000328 | 3300025942 | Bacteria | 44046 |
| 270 | Ga0207689_10009115 | 3300025942 | Bacteria | 8589 |
| 271 | Ga0207679_10000903 | 3300025945 | Bacteria | 18953 |
| 272 | Ga0207667_10007787 | 3300025949 | Bacteria | 12810 |
| 273 | Ga0207712_10047442 | 3300025961 | Bacteria | 2982 |
| 274 | Ga0207668_10068341 | 3300025972 | Bacteria | 2526 |
| 275 | Ga0207640_10004657 | 3300025981 | Bacteria | 7444 |
| 276 | Ga0207703_10431074 | 3300026035 | Bacteria | 1228 |
| 277 | Ga0207639_10032733 | 3300026041 | Bacteria | 3830 |
| 278 | Ga0207678_10002453 | 3300026067 | Bacteria | 16841 |
| 279 | Ga0207702_10052775 | 3300026078 | Bacteria | 3441 |
| 280 | Ga0207641_10099604 | 3300026088 | Bacteria | 2557 |
| 281 | Ga0207641_10180008 | 3300026088 | Bacteria | 1936 |
| 282 | Ga0207641_10319793 | 3300026088 | Bacteria | 1471 |
| 283 | Ga0207648_10034939 | 3300026089 | Bacteria | 4431 |
| 284 | Ga0207648_10428875 | 3300026089 | Bacteria | 1201 |
| 285 | Ga0207676_10023411 | 3300026095 | Bacteria | 4556 |
| 286 | Ga0207674_10004521 | 3300026116 | Bacteria | 16707 |
| 287 | Ga0207675_100001634 | 3300026118 | Bacteria | 22466 |
| 288 | Ga0207675_100100581 | 3300026118 | Bacteria | 2724 |
| 289 | Ga0209969_1004934 | 3300027360 | Bacteria | 1865 |
| 290 | Ga0210000_1009662 | 3300027462 | Bacteria | 1421 |
| 291 | Ga0209995_1002725 | 3300027471 | Bacteria | 2799 |
| 292 | Ga0209968_1004848 | 3300027526 | Bacteria | 2016 |
| 293 | Ga0209968_1006255 | 3300027526 | Bacteria | 1792 |
| 294 | Ga0209999_1000788 | 3300027543 | Bacteria | 5213 |
| 295 | Ga0209982_1001249 | 3300027552 | Bacteria | 3433 |
| 296 | Ga0210002_1001388 | 3300027617 | Bacteria | 3398 |
| 297 | Ga0209983_1000444 | 3300027665 | Bacteria | 8951 |
| 298 | Ga0209588_1038135 | 3300027671 | Bacteria | 1548 |
| 299 | Ga0209971_1000126 | 3300027682 | Bacteria | 22819 |
| 300 | Ga0209966_1000075 | 3300027695 | Bacteria | 43334 |
| 301 | Ga0209998_10000010 | 3300027717 | Bacteria | 98452 |
| 302 | Ga0209974_10001148 | 3300027876 | Bacteria | 9432 |
| 303 | Ga0207428_10000227 | 3300027907 | Bacteria | 77877 |
| 304 | Ga0207428_10000945 | 3300027907 | Bacteria | 32297 |
| 305 | Ga0207428_10074470 | 3300027907 | Bacteria | 2662 |
| 306 | Ga0207428_10205407 | 3300027907 | Bacteria | 1481 |
| 307 | Ga0268265_10012400 | 3300028380 | Bacteria | 5775 |
| 308 | Ga0268265_10019949 | 3300028380 | Bacteria | 4670 |
| 309 | Ga0268265_10031443 | 3300028380 | Bacteria | 3833 |
| 310 | Ga0268265_10031461 | 3300028380 | Bacteria | 3832 |
| 311 | Ga0268265_10103190 | 3300028380 | Bacteria | 2309 |
| 312 | Ga0268264_10360872 | 3300028381 | Bacteria | 1386 |
| 313 | Ga0307408_100058310 | 3300031548 | Bacteria | 2806 |
| 314 | Ga0307416_100024357 | 3300032002 | Bacteria | 4416 |
| 315 | Ga0307411_10248900 | 3300032005 | Bacteria | 1396 |
| 316 | Ga0373930_0018160 | 3300034816 | Bacteria | 1349 |
| 317 | Ga0373950_0017949 | 3300034818 | Bacteria | 1224 |
| 318 | Ga0373940_0000389 | 3300035088 | Bacteria | 6656 |
| 319 | Ga0373940_0008152 | 3300035088 | Bacteria | 2395 |
| 320 | Ga0373949_0014970 | 3300035090 | Bacteria | 1730 |
| 321 | Ga0373932_0008437 | 3300035112 | Bacteria | 2464 |
| 322 | Ga0373939_0010091 | 3300035114 | Bacteria | 2353 |
| 323 | Ga0373939_0027558 | 3300035114 | Bacteria | 1610 |
| 324 | Ga0373941_0005411 | 3300035115 | Bacteria | 3003 |
| 325 | Ga0373943_0028052 | 3300035170 | Unclassified | 2651 |
| 326 | Ga0373931_0005118 | 3300035691 | Bacteria | 6037 |
| 327 | Ga0373931_0039258 | 3300035691 | Bacteria | 2480 |
| 328 | Ga0373931_0053557 | 3300035691 | Bacteria | 2153 |
| 329 | Ga0373925_0001592 | 3300037068 | Bacteria | 19194 |
| 330 | Ga0395900_0008828 | 3300037418 | Bacteria | 10352 |
| 331 | Ga0395898_0002138 | 3300037466 | Bacteria | 24347 |
| 332 | Ga0395905_0039395 | 3300037471 | Bacteria | 4434 |
| 333 | Ga0395901_0006593 | 3300038443 | Bacteria | 11731 |
| 334 | Ga0450889_001865 | 3300042144 | Bacteria | 2128 |
| 335 | Ga0439458_0013117 | 3300042157 | Bacteria | 1864 |
| 336 | Ga0451577_0052792 | 3300042876 | Bacteria | 3630 |
| 337 | Ga0451577_0110116 | 3300042876 | Bacteria | 2463 |
| 338 | Ga0453683_0077121 | 3300044673 | Bacteria | 2087 |
| 339 | Ga0453683_0089977 | 3300044673 | Bacteria | 1924 |
| 340 | Ga0453684_0010464 | 3300044712 | Bacteria | 15856 |
| 341 | Ga0451576_0036109 | 3300045051 | Bacteria | 5241 |
| 342 | Ga0451576_0070015 | 3300045051 | Bacteria | 3651 |
| 343 | Ga0451576_0088568 | 3300045051 | Bacteria | 3220 |
| 344 | Ga0495603_0082677 | 3300046455 | Bacteria | 1881 |
| 345 | Ga0495603_0126074 | 3300046455 | Bacteria | 1492 |
| 346 | Ga0495580_0000361 | 3300046472 | Bacteria | 37086 |
| 347 | Ga0495659_0042698 | 3300046664 | Bacteria | 1624 |
| 348 | Ga0495659_0067547 | 3300046664 | Bacteria | 1333 |
| 349 | Ga0495659_0070496 | 3300046664 | Bacteria | 1309 |
| 350 | Ga0495669_0027022 | 3300046684 | Bacteria | 2510 |
| 351 | Ga0496102_0006692 | 3300048905 | Bacteria | 9844 |
| 352 | Ga0496102_0062777 | 3300048905 | Bacteria | 3402 |
| 353 | Ga0496107_0192145 | 3300048910 | Bacteria | 1517 |
| 354 | Ga0496110_0400704 | 3300048913 | Bacteria | 1251 |
| 355 | Ga0501036_0071558 | 3300049572 | Bacteria | 2932 |
| 356 | Ga0501036_0223499 | 3300049572 | Bacteria | 1581 |
| 357 | Ga0501036_0276714 | 3300049572 | Bacteria | 1405 |
| 358 | Ga0501036_0424785 | 3300049572 | Unclassified | 1108 |
| 359 | Ga0501038_0186733 | 3300049574 | Bacteria | 1670 |
| 360 | Ga0501038_0362678 | 3300049574 | Bacteria | 1127 |
| 361 | Ga0501039_0056907 | 3300049575 | Bacteria | 3029 |
| 362 | Ga0501039_0079050 | 3300049575 | Bacteria | 2559 |
| 363 | Ga0501039_0167026 | 3300049575 | Bacteria | 1730 |
| 364 | Ga0501039_0315408 | 3300049575 | Bacteria | 1229 |
| 365 | Ga0501040_0001146 | 3300049576 | Bacteria | 16844 |
| 366 | Ga0501040_0021818 | 3300049576 | Bacteria | 4281 |
| 367 | Ga0501040_0024458 | 3300049576 | Bacteria | 4054 |
| 368 | Ga0501040_0041424 | 3300049576 | Bacteria | 3137 |
| 369 | Ga0501040_0047595 | 3300049576 | Bacteria | 2928 |
| 370 | Ga0501041_0004412 | 3300049577 | Bacteria | 8140 |
| 371 | Ga0501041_0004465 | 3300049577 | Bacteria | 8101 |
| 372 | Ga0501041_0007240 | 3300049577 | Bacteria | 6510 |
| 373 | Ga0501041_0148156 | 3300049577 | Bacteria | 1465 |
| 374 | Ga0501042_0035161 | 3300049578 | Bacteria | 3554 |
| 375 | Ga0501042_0037194 | 3300049578 | Bacteria | 3454 |
| 376 | Ga0501042_0109619 | 3300049578 | Bacteria | 1988 |
| 377 | Ga0501042_0239257 | 3300049578 | Bacteria | 1310 |
| 378 | Ga0501043_0067700 | 3300049579 | Bacteria | 2804 |
| 379 | Ga0501046_0000938 | 3300049580 | Bacteria | 28563 |
| 380 | Ga0501046_0005998 | 3300049580 | Bacteria | 10807 |
| 381 | Ga0501048_0045568 | 3300049582 | Bacteria | 3132 |
| 382 | Ga0501048_0054178 | 3300049582 | Bacteria | 2849 |
| 383 | Ga0501048_0102300 | 3300049582 | Bacteria | 2021 |
| 384 | Ga0501048_0120635 | 3300049582 | Bacteria | 1853 |
| 385 | Ga0501048_0271031 | 3300049582 | Bacteria | 1206 |
| 386 | Ga0501067_0077515 | 3300049583 | Bacteria | 1842 |
| 387 | Ga0501068_0015791 | 3300049584 | Bacteria | 4345 |
| 388 | Ga0501068_0045853 | 3300049584 | Bacteria | 2634 |
| 389 | Ga0501069_0013257 | 3300049585 | Bacteria | 4392 |
| 390 | Ga0501071_0058582 | 3300049587 | Bacteria | 2786 |
| 391 | Ga0501072_0004554 | 3300049588 | Bacteria | 10543 |
| 392 | Ga0501072_0006397 | 3300049588 | Bacteria | 8974 |
| 393 | Ga0501072_0033139 | 3300049588 | Bacteria | 4047 |
| 394 | Ga0501072_0034378 | 3300049588 | Bacteria | 3973 |
| 395 | Ga0501072_0058763 | 3300049588 | Bacteria | 3031 |
| 396 | Ga0501072_0062992 | 3300049588 | Bacteria | 2925 |
| 397 | Ga0501072_0075130 | 3300049588 | Bacteria | 2672 |
| 398 | Ga0501072_0079417 | 3300049588 | Bacteria | 2598 |
| 399 | Ga0501072_0079621 | 3300049588 | Bacteria | 2595 |
| 400 | Ga0501072_0086330 | 3300049588 | Bacteria | 2490 |
| 401 | Ga0501072_0087555 | 3300049588 | Bacteria | 2471 |
| 402 | Ga0501073_0136547 | 3300049589 | Bacteria | 1700 |
| 403 | Ga0501074_0010058 | 3300049590 | Bacteria | 6867 |
| 404 | Ga0501074_0066746 | 3300049590 | Bacteria | 2587 |
| 405 | Ga0501074_0078151 | 3300049590 | Bacteria | 2375 |
| 406 | Ga0501074_0152095 | 3300049590 | Bacteria | 1654 |
| 407 | Ga0501074_0315267 | 3300049590 | Bacteria | 1111 |
| 408 | Ga0501075_0007589 | 3300049591 | Bacteria | 7526 |
| 409 | Ga0501075_0014105 | 3300049591 | Bacteria | 5724 |
| 410 | Ga0501075_0016946 | 3300049591 | Bacteria | 5255 |
| 411 | Ga0501075_0023772 | 3300049591 | Bacteria | 4488 |
| 412 | Ga0501075_0026685 | 3300049591 | Bacteria | 4254 |
| 413 | Ga0501075_0031248 | 3300049591 | Bacteria | 3951 |
| 414 | Ga0501075_0041488 | 3300049591 | Bacteria | 3449 |
| 415 | Ga0501075_0051721 | 3300049591 | Bacteria | 3089 |
| 416 | Ga0501075_0057956 | 3300049591 | Bacteria | 2917 |
| 417 | Ga0501075_0058872 | 3300049591 | Bacteria | 2894 |
| 418 | Ga0501075_0111503 | 3300049591 | Bacteria | 2080 |
| 419 | Ga0501075_0112709 | 3300049591 | Bacteria | 2068 |
| 420 | Ga0501075_0243066 | 3300049591 | Bacteria | 1372 |
| 421 | Ga0501076_0000430 | 3300049592 | Bacteria | 26447 |
| 422 | Ga0501076_0022856 | 3300049592 | Bacteria | 4811 |
| 423 | Ga0501076_0022875 | 3300049592 | Bacteria | 4809 |
| 424 | Ga0501076_0030586 | 3300049592 | Bacteria | 4194 |
| 425 | Ga0501076_0061154 | 3300049592 | Bacteria | 2997 |
| 426 | Ga0501076_0066226 | 3300049592 | Bacteria | 2883 |
| 427 | Ga0501076_0069156 | 3300049592 | Bacteria | 2821 |
| 428 | Ga0501076_0089652 | 3300049592 | Bacteria | 2472 |
| 429 | Ga0501076_0193725 | 3300049592 | Bacteria | 1659 |
| 430 | Ga0501076_0278896 | 3300049592 | Bacteria | 1369 |
| 431 | Ga0501076_0379590 | 3300049592 | Unclassified | 1162 |
| 432 | Ga0501077_0004036 | 3300049593 | Bacteria | 8860 |
| 433 | Ga0501077_0017229 | 3300049593 | Bacteria | 4557 |
| 434 | Ga0501077_0032794 | 3300049593 | Bacteria | 3307 |
| 435 | Ga0501077_0034040 | 3300049593 | Bacteria | 3242 |
| 436 | Ga0501077_0043812 | 3300049593 | Bacteria | 2844 |
| 437 | Ga0501077_0047491 | 3300049593 | Bacteria | 2728 |
| 438 | Ga0501077_0156568 | 3300049593 | Bacteria | 1446 |
| 439 | Ga0501079_0005805 | 3300049741 | Bacteria | 9227 |
| 440 | Ga0501079_0006004 | 3300049741 | Bacteria | 9097 |
| 441 | Ga0501079_0007317 | 3300049741 | Bacteria | 8341 |
| 442 | Ga0501079_0009622 | 3300049741 | Bacteria | 7330 |
| 443 | Ga0501079_0044376 | 3300049741 | Bacteria | 3431 |
| 444 | Ga0501079_0160427 | 3300049741 | Bacteria | 1753 |
| 445 | Ga0501080_0059531 | 3300049742 | Bacteria | 3554 |
| 446 | Ga0501080_0083301 | 3300049742 | Bacteria | 2971 |
| 447 | Ga0501080_0151505 | 3300049742 | Bacteria | 2143 |
| 448 | Ga0501081_0006334 | 3300049743 | Bacteria | 7673 |
| 449 | Ga0501081_0006944 | 3300049743 | Bacteria | 7357 |
| 450 | Ga0501081_0007157 | 3300049743 | Bacteria | 7254 |
| 451 | Ga0501081_0010338 | 3300049743 | Bacteria | 6091 |
| 452 | Ga0501081_0028965 | 3300049743 | Bacteria | 3739 |
| 453 | Ga0501081_0081984 | 3300049743 | Bacteria | 2259 |
| 454 | Ga0501081_0253462 | 3300049743 | Bacteria | 1285 |
| 455 | Ga0501081_0283477 | 3300049743 | Bacteria | 1213 |
| 456 | Ga0501083_0026077 | 3300049744 | Bacteria | 4043 |
| 457 | Ga0501083_0121676 | 3300049744 | Bacteria | 1712 |
| 458 | Ga0501045_0000499 | 3300049824 | Bacteria | 24392 |
| 459 | Ga0501045_0020371 | 3300049824 | Bacteria | 4737 |
| 460 | Ga0501045_0044043 | 3300049824 | Bacteria | 3250 |
| 461 | Ga0501045_0050660 | 3300049824 | Bacteria | 3030 |
| 462 | Ga0501045_0248185 | 3300049824 | Bacteria | 1325 |
| 463 | nmdc:mga05p37_12088_c1 | 3300050507 | Bacteria | 10305 |
| 464 | nmdc:mga05p37_158981_c1 | 3300050507 | Bacteria | 2760 |
| 465 | nmdc:mga05p37_178439_c1 | 3300050507 | Bacteria | 2586 |
| 466 | nmdc:mga05p37_180055_c1 | 3300050507 | Bacteria | 2572 |
| 467 | nmdc:mga05p37_370946_c1 | 3300050507 | Bacteria | 1680 |
| 468 | nmdc:mga05p37_413398_c1 | 3300050507 | Unclassified | 1572 |
| 469 | nmdc:mga05p37_48163_c1 | 3300050507 | Bacteria | 5243 |
| 470 | nmdc:mga05p37_482301_c1 | 3300050507 | Bacteria | 1428 |
| 471 | nmdc:mga05p37_508968_c1 | 3300050507 | Bacteria | 1380 |
| 472 | nmdc:mga05p37_6_c1 | 3300050507 | Bacteria | 155503 |
| 473 | nmdc:mga05p37_7581_c1 | 3300050507 | Bacteria | 12799 |
| 474 | nmdc:mga05p37_84_c1 | 3300050507 | Bacteria | 83805 |
| 475 | nmdc:mga05p37_8769_c1 | 3300050507 | Bacteria | 11946 |
| 476 | nmdc:mga05p37_9160_c1 | 3300050507 | Bacteria | 11703 |
| 477 | nmdc:mga05p37_993_c1 | 3300050507 | Bacteria | 32348 |
| 478 | nmdc:mga09592_123933_c1 | 3300050508 | Unclassified | 2221 |
| 479 | nmdc:mga09592_1488_c1 | 3300050508 | Bacteria | 18850 |
| 480 | nmdc:mga09592_150519_c1 | 3300050508 | Bacteria | 2008 |
| 481 | nmdc:mga09592_15223_c1 | 3300050508 | Bacteria | 6285 |
| 482 | nmdc:mga09592_188890_c1 | 3300050508 | Bacteria | 1783 |
| 483 | nmdc:mga09592_30733_c1 | 3300050508 | Bacteria | 4470 |
| 484 | nmdc:mga09592_46166_c1 | 3300050508 | Bacteria | 3669 |
| 485 | nmdc:mga09592_677_c1 | 3300050508 | Bacteria | 26087 |
| 486 | nmdc:mga09592_9165_c1 | 3300050508 | Bacteria | 8051 |
| 487 | nmdc:mga0qj67_187935_c1 | 3300050509 | Bacteria | 1678 |
| 488 | nmdc:mga0qj67_23382_c1 | 3300050509 | Bacteria | 4754 |
| 489 | nmdc:mga0qj67_2640_c1 | 3300050509 | Bacteria | 12843 |
| 490 | nmdc:mga0qj67_42504_c1 | 3300050509 | Bacteria | 3578 |
| 491 | nmdc:mga0qj67_660_c1 | 3300050509 | Bacteria | 23685 |
| 492 | nmdc:mga0qj67_9768_c1 | 3300050509 | Bacteria | 7149 |
| 493 | nmdc:mga06r32_1033_c1 | 3300050510 | Bacteria | 22755 |
| 494 | nmdc:mga06r32_131776_c1 | 3300050510 | Bacteria | 2472 |
| 495 | nmdc:mga06r32_13475_c1 | 3300050510 | Bacteria | 7408 |
| 496 | nmdc:mga06r32_280190_c1 | 3300050510 | Bacteria | 1654 |
| 497 | nmdc:mga06r32_35934_c1 | 3300050510 | Bacteria | 4678 |
| 498 | nmdc:mga06r32_393_c1 | 3300050510 | Bacteria | 36896 |
| 499 | nmdc:mga06r32_49733_c1 | 3300050510 | Bacteria | 4010 |
| 500 | nmdc:mga06r32_580_c1 | 3300050510 | Bacteria | 31839 |
| 501 | nmdc:mga06r32_7251_c1 | 3300050510 | Bacteria | 9989 |
| 502 | nmdc:mga06r32_73803_c1 | 3300050510 | Bacteria | 3306 |
| 503 | nmdc:mga06r32_951_c1 | 3300050510 | Bacteria | 25814 |
| 504 | nmdc:mga08y16_36472_c1 | 3300050511 | Bacteria | 5164 |
| 505 | nmdc:mga0n895_100_c1 | 3300050512 | Bacteria | 50742 |
| 506 | nmdc:mga0n895_1076_c1 | 3300050512 | Bacteria | 19948 |
| 507 | nmdc:mga0n895_13160_c1 | 3300050512 | Bacteria | 7451 |
| 508 | nmdc:mga0n895_1643_c1 | 3300050512 | Bacteria | 16908 |
| 509 | nmdc:mga0n895_22110_c1 | 3300050512 | Bacteria | 5960 |
| 510 | nmdc:mga0n895_412750_c1 | 3300050512 | Bacteria | 1365 |
| 511 | nmdc:mga0n895_461846_c1 | 3300050512 | Bacteria | 1281 |
| 512 | nmdc:mga0n895_67212_c1 | 3300050512 | Bacteria | 3550 |
| 513 | nmdc:mga0rr50_15807_c1 | 3300050513 | Bacteria | 4992 |
| 514 | nmdc:mga0rr50_332_c1 | 3300050513 | Bacteria | 25768 |
| 515 | nmdc:mga0rr50_340776_c1 | 3300050513 | Bacteria | 1260 |
| 516 | nmdc:mga0rr50_6554_c1 | 3300050513 | Bacteria | 7105 |
| 517 | nmdc:mga0rr50_84509_c1 | 3300050513 | Bacteria | 2458 |
| 518 | nmdc:mga08x19_1054_c1 | 3300050514 | Bacteria | 17231 |
| 519 | nmdc:mga08x19_207780_c1 | 3300050514 | Bacteria | 1344 |
| 520 | nmdc:mga0a205_1101_c1 | 3300050515 | Bacteria | 22410 |
| 521 | nmdc:mga0a205_147487_c1 | 3300050515 | Bacteria | 2253 |
| 522 | nmdc:mga0a205_151291_c1 | 3300050515 | Bacteria | 2220 |
| 523 | nmdc:mga0a205_155298_c1 | 3300050515 | Bacteria | 2187 |
| 524 | nmdc:mga0a205_157139_c1 | 3300050515 | Bacteria | 2172 |
| 525 | nmdc:mga0a205_18888_c1 | 3300050515 | Bacteria | 6493 |
| 526 | nmdc:mga0a205_21692_c1 | 3300050515 | Bacteria | 6073 |
| 527 | nmdc:mga0a205_288_c1 | 3300050515 | Bacteria | 37035 |
| 528 | nmdc:mga0a205_61696_c1 | 3300050515 | Bacteria | 3621 |
| 529 | nmdc:mga0a205_66882_c1 | 3300050515 | Bacteria | 3472 |
| 530 | nmdc:mga0a205_721_c1 | 3300050515 | Bacteria | 26623 |
| 531 | Ga0501084_0002157 | 3300054114 | Bacteria | 15751 |
| 532 | Ga0501084_0002783 | 3300054114 | Bacteria | 14127 |
| 533 | Ga0501084_0006300 | 3300054114 | Bacteria | 9751 |
| 534 | Ga0501084_0014318 | 3300054114 | Bacteria | 6571 |
| 535 | Ga0501084_0036912 | 3300054114 | Bacteria | 4083 |
| 536 | Ga0501084_0055645 | 3300054114 | Bacteria | 3310 |
| 537 | Ga0501084_0070211 | 3300054114 | Bacteria | 2933 |
| 538 | Ga0501084_0087678 | 3300054114 | Bacteria | 2613 |
| 539 | Ga0501084_0109723 | 3300054114 | Bacteria | 2318 |
| 540 | Ga0501084_0165364 | 3300054114 | Bacteria | 1867 |
| 541 | Ga0501084_0284643 | 3300054114 | Bacteria | 1396 |
| 542 | Ga0501082_0005462 | 3300060353 | Bacteria | 11037 |
| 543 | Ga0501082_0011012 | 3300060353 | Bacteria | 7776 |
| 544 | Ga0501082_0013371 | 3300060353 | Bacteria | 7057 |
| 545 | Ga0501082_0088986 | 3300060353 | Bacteria | 2665 |
| 546 | Ga0501082_0112021 | 3300060353 | Bacteria | 2362 |
| 547 | Ga0501082_0119333 | 3300060353 | Bacteria | 2285 |
| 548 | Ga0501082_0220424 | 3300060353 | Bacteria | 1650 |
| 549 | Ga0530510_0001605 | 3300061734 | Bacteria | 15267 |
| 550 | Ga0530510_0006591 | 3300061734 | Bacteria | 8097 |
| 551 | Ga0530510_0016525 | 3300061734 | Bacteria | 5226 |
| 552 | Ga0530510_0022820 | 3300061734 | Bacteria | 4459 |
| 553 | Ga0530510_0042134 | 3300061734 | Bacteria | 3298 |
| 554 | Ga0530510_0116730 | 3300061734 | Bacteria | 1957 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0193725 | Ga0501076_0193725_677_1633 | 293 |
| 2 | 3300025923 | Ga0207681_10032479 | Ga0207681_100324792 | 301 |
| 3 | 3300006844 | Ga0075428_100175275 | Ga0075428_1001752752 | 310 |
| 4 | 3300006847 | Ga0075431_100058633 | Ga0075431_1000586333 | 310 |
| 5 | 3300050508 | nmdc:mga09592_46166_c1 | nmdc:mga09592_46166_c1_977_2026 | 310 |
| 6 | 3300050510 | nmdc:mga06r32_49733_c1 | nmdc:mga06r32_49733_c1_2028_3077 | 310 |
| 7 | 3300050507 | nmdc:mga05p37_48163_c1 | nmdc:mga05p37_48163_c1_2858_3874 | 312 |
| 8 | 3300050510 | nmdc:mga06r32_131776_c1 | nmdc:mga06r32_131776_c1_164_1180 | 312 |
| 9 | 3300006871 | Ga0075434_100394134 | Ga0075434_1003941341 | 314 |
| 10 | 3300009147 | Ga0114129_10003753 | Ga0114129_100037536 | 314 |
| 11 | 3300005468 | Ga0070707_100248560 | Ga0070707_1002485601 | 317 |
| 12 | 3300005985 | Ga0081539_10000002 | Ga0081539_10000002136 | 317 |
| 13 | 3300049588 | Ga0501072_0087555 | Ga0501072_0087555_22_978 | 317 |
| 14 | 3300049590 | Ga0501074_0315267 | Ga0501074_0315267_53_1009 | 317 |
| 15 | 3300049742 | Ga0501080_0083301 | Ga0501080_0083301_143_1156 | 317 |
| 16 | 3300042876 | Ga0451577_0110116 | Ga0451577_0110116_1154_2167 | 318 |
| 17 | 3300045051 | Ga0451576_0036109 | Ga0451576_0036109_2816_3829 | 318 |
| 18 | 3300049743 | Ga0501081_0253462 | Ga0501081_0253462_127_1140 | 318 |
| 19 | 3300006844 | Ga0075428_100000552 | Ga0075428_10000055233 | 319 |
| 20 | 3300006847 | Ga0075431_100000049 | Ga0075431_10000004964 | 319 |
| 21 | 3300006880 | Ga0075429_100017176 | Ga0075429_1000171765 | 319 |
| 22 | 3300009147 | Ga0114129_10000721 | Ga0114129_1000072113 | 319 |
| 23 | 3300049572 | Ga0501036_0276714 | Ga0501036_0276714_424_1386 | 319 |
| 24 | 3300050507 | nmdc:mga05p37_84_c1 | nmdc:mga05p37_84_c1_33147_34163 | 319 |
| 25 | 3300050508 | nmdc:mga09592_677_c1 | nmdc:mga09592_677_c1_21124_22140 | 319 |
| 26 | 3300050510 | nmdc:mga06r32_951_c1 | nmdc:mga06r32_951_c1_19673_20689 | 319 |
| 27 | 3300049576 | Ga0501040_0021818 | Ga0501040_0021818_1844_2857 | 320 |
| 28 | 3300049590 | Ga0501074_0078151 | Ga0501074_0078151_11_1024 | 320 |
| 29 | 3300049591 | Ga0501075_0243066 | Ga0501075_0243066_260_1273 | 320 |
| 30 | 3300049593 | Ga0501077_0043812 | Ga0501077_0043812_1709_2722 | 320 |
| 31 | 3300050513 | nmdc:mga0rr50_84509_c1 | nmdc:mga0rr50_84509_c1_57_1070 | 320 |
| 32 | 3300050514 | nmdc:mga08x19_207780_c1 | nmdc:mga08x19_207780_c1_275_1288 | 320 |
| 33 | 3300050515 | nmdc:mga0a205_721_c1 | nmdc:mga0a205_721_c1_21810_22823 | 320 |
| 34 | 3300054114 | Ga0501084_0087678 | Ga0501084_0087678_133_1146 | 320 |
| 35 | 3300006847 | Ga0075431_100163617 | Ga0075431_1001636173 | 324 |
| 36 | 3300054114 | Ga0501084_0070211 | Ga0501084_0070211_435_1502 | 324 |
| 37 | 3300061734 | Ga0530510_0116730 | Ga0530510_0116730_642_1709 | 324 |
| 38 | 3300005467 | Ga0070706_100092604 | Ga0070706_1000926042 | 329 |
| 39 | 3300005468 | Ga0070707_100005924 | Ga0070707_10000592412 | 329 |
| 40 | 3300005444 | Ga0070694_100000561 | Ga0070694_10000056121 | 330 |
| 41 | 3300005545 | Ga0070695_100003122 | Ga0070695_10000312210 | 330 |
| 42 | 3300007265 | Ga0099794_10031507 | Ga0099794_100315072 | 330 |
| 43 | 3300005440 | Ga0070705_100077619 | Ga0070705_1000776192 | 332 |
| 44 | 3300005445 | Ga0070708_100001394 | Ga0070708_10000139416 | 332 |
| 45 | 3300005467 | Ga0070706_100003002 | Ga0070706_10000300216 | 332 |
| 46 | 3300005468 | Ga0070707_100524504 | Ga0070707_1005245041 | 332 |
| 47 | 3300005471 | Ga0070698_100000342 | Ga0070698_10000034225 | 332 |
| 48 | 3300005471 | Ga0070698_100200317 | Ga0070698_1002003171 | 332 |
| 49 | 3300005518 | Ga0070699_100000272 | Ga0070699_10000027223 | 332 |
| 50 | 3300006173 | Ga0070716_100033743 | Ga0070716_1000337433 | 332 |
| 51 | 3300006852 | Ga0075433_10100997 | Ga0075433_101009972 | 332 |
| 52 | 3300006871 | Ga0075434_100034285 | Ga0075434_1000342855 | 332 |
| 53 | 3300025910 | Ga0207684_10000105 | Ga0207684_1000010558 | 332 |
| 54 | 3300025922 | Ga0207646_10004085 | Ga0207646_1000408515 | 332 |
| 55 | 3300025939 | Ga0207665_10056887 | Ga0207665_100568872 | 332 |
| 56 | 3300005334 | Ga0068869_100247280 | Ga0068869_1002472802 | 335 |
| 57 | 3300005336 | Ga0070680_100016280 | Ga0070680_1000162804 | 335 |
| 58 | 3300005341 | Ga0070691_10009215 | Ga0070691_100092155 | 335 |
| 59 | 3300005345 | Ga0070692_10012115 | Ga0070692_100121152 | 335 |
| 60 | 3300005438 | Ga0070701_10002715 | Ga0070701_100027152 | 335 |
| 61 | 3300005440 | Ga0070705_100001950 | Ga0070705_1000019505 | 335 |
| 62 | 3300005444 | Ga0070694_100070657 | Ga0070694_1000706572 | 335 |
| 63 | 3300005518 | Ga0070699_100120926 | Ga0070699_1001209264 | 335 |
| 64 | 3300005545 | Ga0070695_100005022 | Ga0070695_1000050227 | 335 |
| 65 | 3300005546 | Ga0070696_100052290 | Ga0070696_1000522903 | 335 |
| 66 | 3300005549 | Ga0070704_100033795 | Ga0070704_1000337954 | 335 |
| 67 | 3300009148 | Ga0105243_10102931 | Ga0105243_101029312 | 335 |
| 68 | 3300009176 | Ga0105242_10035282 | Ga0105242_100352823 | 335 |
| 69 | 3300025885 | Ga0207653_10005767 | Ga0207653_100057675 | 335 |
| 70 | 3300028380 | Ga0268265_10103190 | Ga0268265_101031901 | 335 |
| 71 | 3300044673 | Ga0453683_0089977 | Ga0453683_0089977_689_1738 | 335 |
| 72 | 3300035170 | Ga0373943_0028052 | Ga0373943_0028052_1335_2348 | 336 |
| 73 | 3300037068 | Ga0373925_0001592 | Ga0373925_0001592_17362_18375 | 336 |
| 74 | 3300005353 | Ga0070669_100005442 | Ga0070669_1000054425 | 337 |
| 75 | 3300005445 | Ga0070708_100046534 | Ga0070708_1000465344 | 337 |
| 76 | 3300005445 | Ga0070708_100072136 | Ga0070708_1000721365 | 337 |
| 77 | 3300005467 | Ga0070706_100002325 | Ga0070706_10000232512 | 337 |
| 78 | 3300005536 | Ga0070697_100005800 | Ga0070697_1000058008 | 337 |
| 79 | 3300005543 | Ga0070672_100019799 | Ga0070672_1000197992 | 337 |
| 80 | 3300005546 | Ga0070696_100131121 | Ga0070696_1001311212 | 337 |
| 81 | 3300005841 | Ga0068863_100158713 | Ga0068863_1001587132 | 337 |
| 82 | 3300005843 | Ga0068860_100013341 | Ga0068860_1000133418 | 337 |
| 83 | 3300005981 | Ga0081538_10108942 | Ga0081538_101089422 | 337 |
| 84 | 3300006844 | Ga0075428_100007113 | Ga0075428_10000711312 | 337 |
| 85 | 3300006844 | Ga0075428_100012194 | Ga0075428_1000121946 | 337 |
| 86 | 3300006847 | Ga0075431_100000290 | Ga0075431_10000029012 | 337 |
| 87 | 3300006852 | Ga0075433_10000288 | Ga0075433_1000028816 | 337 |
| 88 | 3300006871 | Ga0075434_100158056 | Ga0075434_1001580562 | 337 |
| 89 | 3300006880 | Ga0075429_100023660 | Ga0075429_1000236602 | 337 |
| 90 | 3300006880 | Ga0075429_100190716 | Ga0075429_1001907162 | 337 |
| 91 | 3300006914 | Ga0075436_100000942 | Ga0075436_1000009422 | 337 |
| 92 | 3300007076 | Ga0075435_100004223 | Ga0075435_1000042232 | 337 |
| 93 | 3300009094 | Ga0111539_10000923 | Ga0111539_1000092332 | 337 |
| 94 | 3300009147 | Ga0114129_10000178 | Ga0114129_1000017845 | 337 |
| 95 | 3300009147 | Ga0114129_10000462 | Ga0114129_100004625 | 337 |
| 96 | 3300009147 | Ga0114129_10011856 | Ga0114129_1001185612 | 337 |
| 97 | 3300009147 | Ga0114129_10026397 | Ga0114129_100263979 | 337 |
| 98 | 3300009174 | Ga0105241_10094725 | Ga0105241_100947251 | 337 |
| 99 | 3300013306 | Ga0163162_10002446 | Ga0163162_1000244615 | 337 |
| 100 | 3300013308 | Ga0157375_10050857 | Ga0157375_100508573 | 337 |
| 101 | 3300017792 | Ga0163161_10044440 | Ga0163161_100444402 | 337 |
| 102 | 3300025923 | Ga0207681_10008184 | Ga0207681_100081842 | 337 |
| 103 | 3300025934 | Ga0207686_10082074 | Ga0207686_100820743 | 337 |
| 104 | 3300025940 | Ga0207691_10091558 | Ga0207691_100915583 | 337 |
| 105 | 3300025972 | Ga0207668_10068341 | Ga0207668_100683412 | 337 |
| 106 | 3300026088 | Ga0207641_10319793 | Ga0207641_103197932 | 337 |
| 107 | 3300026089 | Ga0207648_10428875 | Ga0207648_104288751 | 337 |
| 108 | 3300027907 | Ga0207428_10205407 | Ga0207428_102054072 | 337 |
| 109 | 3300034818 | Ga0373950_0017949 | Ga0373950_0017949_195_1208 | 337 |
| 110 | 3300035088 | Ga0373940_0000389 | Ga0373940_0000389_3389_4402 | 337 |
| 111 | 3300035112 | Ga0373932_0008437 | Ga0373932_0008437_1430_2443 | 337 |
| 112 | 3300035114 | Ga0373939_0010091 | Ga0373939_0010091_207_1220 | 337 |
| 113 | 3300035691 | Ga0373931_0053557 | Ga0373931_0053557_189_1202 | 337 |
| 114 | 3300037471 | Ga0395905_0039395 | Ga0395905_0039395_1070_2086 | 337 |
| 115 | 3300046455 | Ga0495603_0126074 | Ga0495603_0126074_264_1277 | 337 |
| 116 | 3300049572 | Ga0501036_0223499 | Ga0501036_0223499_551_1564 | 337 |
| 117 | 3300049572 | Ga0501036_0424785 | Ga0501036_0424785_53_1066 | 337 |
| 118 | 3300049574 | Ga0501038_0362678 | Ga0501038_0362678_101_1114 | 337 |
| 119 | 3300049575 | Ga0501039_0079050 | Ga0501039_0079050_1313_2326 | 337 |
| 120 | 3300049578 | Ga0501042_0109619 | Ga0501042_0109619_939_1952 | 337 |
| 121 | 3300049582 | Ga0501048_0271031 | Ga0501048_0271031_26_1039 | 337 |
| 122 | 3300049588 | Ga0501072_0033139 | Ga0501072_0033139_1771_2784 | 337 |
| 123 | 3300049588 | Ga0501072_0058763 | Ga0501072_0058763_1900_2913 | 337 |
| 124 | 3300049588 | Ga0501072_0075130 | Ga0501072_0075130_189_1202 | 337 |
| 125 | 3300049588 | Ga0501072_0079621 | Ga0501072_0079621_662_1675 | 337 |
| 126 | 3300049588 | Ga0501072_0086330 | Ga0501072_0086330_1190_2203 | 337 |
| 127 | 3300049591 | Ga0501075_0016946 | Ga0501075_0016946_2381_3394 | 337 |
| 128 | 3300049591 | Ga0501075_0051721 | Ga0501075_0051721_1977_2990 | 337 |
| 129 | 3300049592 | Ga0501076_0022856 | Ga0501076_0022856_556_1569 | 337 |
| 130 | 3300049592 | Ga0501076_0066226 | Ga0501076_0066226_104_1117 | 337 |
| 131 | 3300049592 | Ga0501076_0089652 | Ga0501076_0089652_718_1731 | 337 |
| 132 | 3300049592 | Ga0501076_0278896 | Ga0501076_0278896_274_1287 | 337 |
| 133 | 3300049593 | Ga0501077_0004036 | Ga0501077_0004036_5304_6317 | 337 |
| 134 | 3300049593 | Ga0501077_0047491 | Ga0501077_0047491_192_1205 | 337 |
| 135 | 3300049741 | Ga0501079_0007317 | Ga0501079_0007317_4892_5905 | 337 |
| 136 | 3300049743 | Ga0501081_0007157 | Ga0501081_0007157_4894_5907 | 337 |
| 137 | 3300049743 | Ga0501081_0081984 | Ga0501081_0081984_494_1507 | 337 |
| 138 | 3300049744 | Ga0501083_0121676 | Ga0501083_0121676_629_1642 | 337 |
| 139 | 3300049824 | Ga0501045_0050660 | Ga0501045_0050660_662_1675 | 337 |
| 140 | 3300050507 | nmdc:mga05p37_370946_c1 | nmdc:mga05p37_370946_c1_95_1108 | 337 |
| 141 | 3300050507 | nmdc:mga05p37_413398_c1 | nmdc:mga05p37_413398_c1_15_1031 | 337 |
| 142 | 3300050507 | nmdc:mga05p37_482301_c1 | nmdc:mga05p37_482301_c1_273_1286 | 337 |
| 143 | 3300050507 | nmdc:mga05p37_6_c1 | nmdc:mga05p37_6_c1_49155_50171 | 337 |
| 144 | 3300050507 | nmdc:mga05p37_9160_c1 | nmdc:mga05p37_9160_c1_9428_10441 | 337 |
| 145 | 3300050507 | nmdc:mga05p37_993_c1 | nmdc:mga05p37_993_c1_30989_32005 | 337 |
| 146 | 3300050508 | nmdc:mga09592_123933_c1 | nmdc:mga09592_123933_c1_1136_2149 | 337 |
| 147 | 3300050508 | nmdc:mga09592_150519_c1 | nmdc:mga09592_150519_c1_901_1914 | 337 |
| 148 | 3300050508 | nmdc:mga09592_9165_c1 | nmdc:mga09592_9165_c1_3265_4281 | 337 |
| 149 | 3300050509 | nmdc:mga0qj67_23382_c1 | nmdc:mga0qj67_23382_c1_1205_2218 | 337 |
| 150 | 3300050509 | nmdc:mga0qj67_42504_c1 | nmdc:mga0qj67_42504_c1_150_1163 | 337 |
| 151 | 3300050509 | nmdc:mga0qj67_9768_c1 | nmdc:mga0qj67_9768_c1_4542_5555 | 337 |
| 152 | 3300050510 | nmdc:mga06r32_1033_c1 | nmdc:mga06r32_1033_c1_19543_20556 | 337 |
| 153 | 3300050510 | nmdc:mga06r32_13475_c1 | nmdc:mga06r32_13475_c1_749_1762 | 337 |
| 154 | 3300050510 | nmdc:mga06r32_35934_c1 | nmdc:mga06r32_35934_c1_3571_4584 | 337 |
| 155 | 3300050511 | nmdc:mga08y16_36472_c1 | nmdc:mga08y16_36472_c1_3461_4474 | 337 |
| 156 | 3300050512 | nmdc:mga0n895_100_c1 | nmdc:mga0n895_100_c1_49471_50487 | 337 |
| 157 | 3300050512 | nmdc:mga0n895_412750_c1 | nmdc:mga0n895_412750_c1_171_1184 | 337 |
| 158 | 3300050512 | nmdc:mga0n895_461846_c1 | nmdc:mga0n895_461846_c1_146_1159 | 337 |
| 159 | 3300050513 | nmdc:mga0rr50_332_c1 | nmdc:mga0rr50_332_c1_20477_21493 | 337 |
| 160 | 3300050514 | nmdc:mga08x19_1054_c1 | nmdc:mga08x19_1054_c1_9700_10716 | 337 |
| 161 | 3300050515 | nmdc:mga0a205_147487_c1 | nmdc:mga0a205_147487_c1_392_1405 | 337 |
| 162 | 3300050515 | nmdc:mga0a205_288_c1 | nmdc:mga0a205_288_c1_13476_14492 | 337 |
| 163 | 3300050515 | nmdc:mga0a205_61696_c1 | nmdc:mga0a205_61696_c1_2190_3203 | 337 |
| 164 | 3300054114 | Ga0501084_0002783 | Ga0501084_0002783_10598_11611 | 337 |
| 165 | 3300054114 | Ga0501084_0165364 | Ga0501084_0165364_240_1253 | 337 |
| 166 | 3300060353 | Ga0501082_0112021 | Ga0501082_0112021_54_1067 | 337 |
| 167 | 3300060353 | Ga0501082_0119333 | Ga0501082_0119333_850_1863 | 337 |
| 168 | 3300061734 | Ga0530510_0001605 | Ga0530510_0001605_5006_6019 | 337 |
| 169 | 3300061734 | Ga0530510_0016525 | Ga0530510_0016525_409_1422 | 337 |
| 170 | 3300006846 | Ga0075430_100121292 | Ga0075430_1001212924 | 341 |
| 171 | 3300006847 | Ga0075431_100012068 | Ga0075431_1000120682 | 341 |
| 172 | 3300006880 | Ga0075429_100016754 | Ga0075429_1000167543 | 341 |
| 173 | 3300027526 | Ga0209968_1006255 | Ga0209968_10062552 | 341 |
| 174 | 3300005406 | Ga0070703_10069842 | Ga0070703_100698421 | 342 |
| 175 | 3300005440 | Ga0070705_100037908 | Ga0070705_1000379084 | 342 |
| 176 | 3300005440 | Ga0070705_100150915 | Ga0070705_1001509151 | 342 |
| 177 | 3300005518 | Ga0070699_100379287 | Ga0070699_1003792872 | 342 |
| 178 | 3300006846 | Ga0075430_100004920 | Ga0075430_1000049204 | 342 |
| 179 | 3300006880 | Ga0075429_100109503 | Ga0075429_1001095032 | 342 |
| 180 | 3300027671 | Ga0209588_1038135 | Ga0209588_10381352 | 342 |
| 181 | 3300005468 | Ga0070707_100002799 | Ga0070707_1000027996 | 344 |
| 182 | 3300005536 | Ga0070697_100002227 | Ga0070697_1000022275 | 344 |
| 183 | 3300009147 | Ga0114129_10112417 | Ga0114129_101124172 | 348 |
| 184 | 3300049591 | Ga0501075_0112709 | Ga0501075_0112709_102_1157 | 348 |
| 185 | 3300049592 | Ga0501076_0022875 | Ga0501076_0022875_2709_3764 | 348 |
| 186 | 3300049743 | Ga0501081_0028965 | Ga0501081_0028965_1001_2056 | 348 |
| 187 | 3300049824 | Ga0501045_0044043 | Ga0501045_0044043_2104_3150 | 348 |
| 188 | 3300054114 | Ga0501084_0055645 | Ga0501084_0055645_789_1844 | 348 |
| 189 | 3300054114 | Ga0501084_0109723 | Ga0501084_0109723_1126_2172 | 348 |
| 190 | 3300005295 | Ga0065707_10169639 | Ga0065707_101696391 | 349 |
| 191 | 3300005328 | Ga0070676_10001256 | Ga0070676_100012565 | 349 |
| 192 | 3300005331 | Ga0070670_100016104 | Ga0070670_1000161044 | 349 |
| 193 | 3300005334 | Ga0068869_100004836 | Ga0068869_1000048367 | 349 |
| 194 | 3300005336 | Ga0070680_100000237 | Ga0070680_1000002378 | 349 |
| 195 | 3300005337 | Ga0070682_100002243 | Ga0070682_1000022436 | 349 |
| 196 | 3300005338 | Ga0068868_100237605 | Ga0068868_1002376052 | 349 |
| 197 | 3300005339 | Ga0070660_100001295 | Ga0070660_1000012956 | 349 |
| 198 | 3300005340 | Ga0070689_100217327 | Ga0070689_1002173272 | 349 |
| 199 | 3300005341 | Ga0070691_10052172 | Ga0070691_100521722 | 349 |
| 200 | 3300005343 | Ga0070687_100048480 | Ga0070687_1000484803 | 349 |
| 201 | 3300005344 | Ga0070661_100002504 | Ga0070661_1000025049 | 349 |
| 202 | 3300005345 | Ga0070692_10001216 | Ga0070692_100012166 | 349 |
| 203 | 3300005354 | Ga0070675_100472395 | Ga0070675_1004723951 | 349 |
| 204 | 3300005364 | Ga0070673_100043524 | Ga0070673_1000435246 | 349 |
| 205 | 3300005366 | Ga0070659_100010671 | Ga0070659_1000106715 | 349 |
| 206 | 3300005367 | Ga0070667_100102329 | Ga0070667_1001023293 | 349 |
| 207 | 3300005439 | Ga0070711_100030553 | Ga0070711_1000305532 | 349 |
| 208 | 3300005440 | Ga0070705_100001967 | Ga0070705_1000019672 | 349 |
| 209 | 3300005440 | Ga0070705_100028220 | Ga0070705_1000282202 | 349 |
| 210 | 3300005440 | Ga0070705_100122671 | Ga0070705_1001226712 | 349 |
| 211 | 3300005441 | Ga0070700_100047226 | Ga0070700_1000472262 | 349 |
| 212 | 3300005444 | Ga0070694_100020678 | Ga0070694_1000206785 | 349 |
| 213 | 3300005444 | Ga0070694_100044173 | Ga0070694_1000441733 | 349 |
| 214 | 3300005444 | Ga0070694_100075068 | Ga0070694_1000750683 | 349 |
| 215 | 3300005445 | Ga0070708_100011486 | Ga0070708_1000114868 | 349 |
| 216 | 3300005445 | Ga0070708_100012472 | Ga0070708_1000124723 | 349 |
| 217 | 3300005445 | Ga0070708_100023401 | Ga0070708_1000234015 | 349 |
| 218 | 3300005445 | Ga0070708_100029999 | Ga0070708_1000299993 | 349 |
| 219 | 3300005445 | Ga0070708_100173295 | Ga0070708_1001732951 | 349 |
| 220 | 3300005445 | Ga0070708_100346657 | Ga0070708_1003466572 | 349 |
| 221 | 3300005455 | Ga0070663_100002646 | Ga0070663_10000264611 | 349 |
| 222 | 3300005457 | Ga0070662_100073826 | Ga0070662_1000738262 | 349 |
| 223 | 3300005458 | Ga0070681_10028922 | Ga0070681_100289228 | 349 |
| 224 | 3300005459 | Ga0068867_100046086 | Ga0068867_1000460862 | 349 |
| 225 | 3300005467 | Ga0070706_100004678 | Ga0070706_10000467813 | 349 |
| 226 | 3300005467 | Ga0070706_100017418 | Ga0070706_1000174183 | 349 |
| 227 | 3300005467 | Ga0070706_100175774 | Ga0070706_1001757743 | 349 |
| 228 | 3300005467 | Ga0070706_100221875 | Ga0070706_1002218752 | 349 |
| 229 | 3300005468 | Ga0070707_100011047 | Ga0070707_1000110479 | 349 |
| 230 | 3300005468 | Ga0070707_100038604 | Ga0070707_1000386044 | 349 |
| 231 | 3300005468 | Ga0070707_100048281 | Ga0070707_1000482814 | 349 |
| 232 | 3300005468 | Ga0070707_100361273 | Ga0070707_1003612732 | 349 |
| 233 | 3300005468 | Ga0070707_100454104 | Ga0070707_1004541041 | 349 |
| 234 | 3300005471 | Ga0070698_100049745 | Ga0070698_1000497453 | 349 |
| 235 | 3300005471 | Ga0070698_100285225 | Ga0070698_1002852252 | 349 |
| 236 | 3300005471 | Ga0070698_100368822 | Ga0070698_1003688221 | 349 |
| 237 | 3300005518 | Ga0070699_100008828 | Ga0070699_1000088289 | 349 |
| 238 | 3300005518 | Ga0070699_100018888 | Ga0070699_1000188888 | 349 |
| 239 | 3300005518 | Ga0070699_100086327 | Ga0070699_1000863274 | 349 |
| 240 | 3300005518 | Ga0070699_100096716 | Ga0070699_1000967163 | 349 |
| 241 | 3300005518 | Ga0070699_100298250 | Ga0070699_1002982502 | 349 |
| 242 | 3300005530 | Ga0070679_100148206 | Ga0070679_1001482063 | 349 |
| 243 | 3300005535 | Ga0070684_100081758 | Ga0070684_1000817582 | 349 |
| 244 | 3300005536 | Ga0070697_100011418 | Ga0070697_1000114186 | 349 |
| 245 | 3300005536 | Ga0070697_100050831 | Ga0070697_1000508312 | 349 |
| 246 | 3300005536 | Ga0070697_100102508 | Ga0070697_1001025082 | 349 |
| 247 | 3300005536 | Ga0070697_100287942 | Ga0070697_1002879422 | 349 |
| 248 | 3300005539 | Ga0068853_100002255 | Ga0068853_1000022556 | 349 |
| 249 | 3300005545 | Ga0070695_100000858 | Ga0070695_1000008588 | 349 |
| 250 | 3300005545 | Ga0070695_100003453 | Ga0070695_1000034538 | 349 |
| 251 | 3300005545 | Ga0070695_100146215 | Ga0070695_1001462152 | 349 |
| 252 | 3300005546 | Ga0070696_100004579 | Ga0070696_1000045799 | 349 |
| 253 | 3300005546 | Ga0070696_100012332 | Ga0070696_1000123323 | 349 |
| 254 | 3300005546 | Ga0070696_100044766 | Ga0070696_1000447662 | 349 |
| 255 | 3300005547 | Ga0070693_100002327 | Ga0070693_10000232710 | 349 |
| 256 | 3300005549 | Ga0070704_100016469 | Ga0070704_1000164695 | 349 |
| 257 | 3300005549 | Ga0070704_100098120 | Ga0070704_1000981202 | 349 |
| 258 | 3300005549 | Ga0070704_100219637 | Ga0070704_1002196372 | 349 |
| 259 | 3300005549 | Ga0070704_100369903 | Ga0070704_1003699031 | 349 |
| 260 | 3300005563 | Ga0068855_100004031 | Ga0068855_1000040316 | 349 |
| 261 | 3300005564 | Ga0070664_100031121 | Ga0070664_1000311214 | 349 |
| 262 | 3300005578 | Ga0068854_100064425 | Ga0068854_1000644252 | 349 |
| 263 | 3300005614 | Ga0068856_100008990 | Ga0068856_1000089906 | 349 |
| 264 | 3300005617 | Ga0068859_100008722 | Ga0068859_1000087228 | 349 |
| 265 | 3300005617 | Ga0068859_100079983 | Ga0068859_1000799833 | 349 |
| 266 | 3300005617 | Ga0068859_100158282 | Ga0068859_1001582822 | 349 |
| 267 | 3300005618 | Ga0068864_100010577 | Ga0068864_1000105777 | 349 |
| 268 | 3300005618 | Ga0068864_100106221 | Ga0068864_1001062212 | 349 |
| 269 | 3300005840 | Ga0068870_10001889 | Ga0068870_100018898 | 349 |
| 270 | 3300005841 | Ga0068863_100018304 | Ga0068863_1000183047 | 349 |
| 271 | 3300005842 | Ga0068858_100500783 | Ga0068858_1005007831 | 349 |
| 272 | 3300005843 | Ga0068860_100004791 | Ga0068860_1000047918 | 349 |
| 273 | 3300005843 | Ga0068860_100144223 | Ga0068860_1001442232 | 349 |
| 274 | 3300005844 | Ga0068862_100000665 | Ga0068862_10000066522 | 349 |
| 275 | 3300005844 | Ga0068862_100026458 | Ga0068862_1000264585 | 349 |
| 276 | 3300005844 | Ga0068862_100030919 | Ga0068862_1000309195 | 349 |
| 277 | 3300005937 | Ga0081455_10000114 | Ga0081455_1000011453 | 349 |
| 278 | 3300005983 | Ga0081540_1019651 | Ga0081540_10196513 | 349 |
| 279 | 3300006175 | Ga0070712_100007586 | Ga0070712_1000075862 | 349 |
| 280 | 3300006844 | Ga0075428_100000032 | Ga0075428_10000003234 | 349 |
| 281 | 3300006844 | Ga0075428_100112625 | Ga0075428_1001126254 | 349 |
| 282 | 3300006844 | Ga0075428_100306921 | Ga0075428_1003069212 | 349 |
| 283 | 3300006846 | Ga0075430_100000002 | Ga0075430_10000000220 | 349 |
| 284 | 3300006846 | Ga0075430_100002131 | Ga0075430_10000213116 | 349 |
| 285 | 3300006846 | Ga0075430_100003919 | Ga0075430_10000391910 | 349 |
| 286 | 3300006846 | Ga0075430_100007458 | Ga0075430_1000074585 | 349 |
| 287 | 3300006846 | Ga0075430_100054130 | Ga0075430_1000541305 | 349 |
| 288 | 3300006847 | Ga0075431_100000537 | Ga0075431_1000005376 | 349 |
| 289 | 3300006847 | Ga0075431_100002652 | Ga0075431_10000265210 | 349 |
| 290 | 3300006847 | Ga0075431_100003776 | Ga0075431_10000377615 | 349 |
| 291 | 3300006847 | Ga0075431_100016065 | Ga0075431_1000160656 | 349 |
| 292 | 3300006847 | Ga0075431_100275248 | Ga0075431_1002752482 | 349 |
| 293 | 3300006852 | Ga0075433_10000136 | Ga0075433_1000013625 | 349 |
| 294 | 3300006852 | Ga0075433_10010662 | Ga0075433_100106627 | 349 |
| 295 | 3300006852 | Ga0075433_10021537 | Ga0075433_100215375 | 349 |
| 296 | 3300006852 | Ga0075433_10087391 | Ga0075433_100873913 | 349 |
| 297 | 3300006852 | Ga0075433_10096599 | Ga0075433_100965992 | 349 |
| 298 | 3300006852 | Ga0075433_10170973 | Ga0075433_101709732 | 349 |
| 299 | 3300006871 | Ga0075434_100000093 | Ga0075434_10000009311 | 349 |
| 300 | 3300006871 | Ga0075434_100005272 | Ga0075434_1000052725 | 349 |
| 301 | 3300006871 | Ga0075434_100025078 | Ga0075434_1000250782 | 349 |
| 302 | 3300006871 | Ga0075434_100049912 | Ga0075434_1000499122 | 349 |
| 303 | 3300006871 | Ga0075434_100126370 | Ga0075434_1001263702 | 349 |
| 304 | 3300006880 | Ga0075429_100000032 | Ga0075429_10000003269 | 349 |
| 305 | 3300006880 | Ga0075429_100001393 | Ga0075429_1000013937 | 349 |
| 306 | 3300006880 | Ga0075429_100013242 | Ga0075429_1000132423 | 349 |
| 307 | 3300006880 | Ga0075429_100039128 | Ga0075429_1000391283 | 349 |
| 308 | 3300006880 | Ga0075429_100050179 | Ga0075429_1000501792 | 349 |
| 309 | 3300006914 | Ga0075436_100059751 | Ga0075436_1000597512 | 349 |
| 310 | 3300006914 | Ga0075436_100111841 | Ga0075436_1001118412 | 349 |
| 311 | 3300006931 | Ga0097620_100008722 | Ga0097620_1000087228 | 349 |
| 312 | 3300006931 | Ga0097620_100079988 | Ga0097620_1000799883 | 349 |
| 313 | 3300006931 | Ga0097620_100158293 | Ga0097620_1001582932 | 349 |
| 314 | 3300007076 | Ga0075435_100002967 | Ga0075435_1000029675 | 349 |
| 315 | 3300007076 | Ga0075435_100015016 | Ga0075435_1000150167 | 349 |
| 316 | 3300007076 | Ga0075435_100058766 | Ga0075435_1000587663 | 349 |
| 317 | 3300007076 | Ga0075435_100091220 | Ga0075435_1000912202 | 349 |
| 318 | 3300007076 | Ga0075435_100228451 | Ga0075435_1002284512 | 349 |
| 319 | 3300007265 | Ga0099794_10014995 | Ga0099794_100149953 | 349 |
| 320 | 3300009094 | Ga0111539_10000726 | Ga0111539_1000072633 | 349 |
| 321 | 3300009147 | Ga0114129_10001856 | Ga0114129_1000185610 | 349 |
| 322 | 3300009147 | Ga0114129_10008446 | Ga0114129_100084468 | 349 |
| 323 | 3300009147 | Ga0114129_10011871 | Ga0114129_100118715 | 349 |
| 324 | 3300009147 | Ga0114129_10013604 | Ga0114129_100136044 | 349 |
| 325 | 3300009147 | Ga0114129_10021871 | Ga0114129_1002187110 | 349 |
| 326 | 3300009147 | Ga0114129_10053499 | Ga0114129_100534992 | 349 |
| 327 | 3300009147 | Ga0114129_10060361 | Ga0114129_100603616 | 349 |
| 328 | 3300009147 | Ga0114129_10170465 | Ga0114129_101704651 | 349 |
| 329 | 3300009147 | Ga0114129_10179629 | Ga0114129_101796294 | 349 |
| 330 | 3300009147 | Ga0114129_10229947 | Ga0114129_102299472 | 349 |
| 331 | 3300009174 | Ga0105241_10002768 | Ga0105241_100027682 | 349 |
| 332 | 3300009177 | Ga0105248_10308810 | Ga0105248_103088102 | 349 |
| 333 | 3300009553 | Ga0105249_10005712 | Ga0105249_1000571210 | 349 |
| 334 | 3300009553 | Ga0105249_10189600 | Ga0105249_101896002 | 349 |
| 335 | 3300013100 | Ga0157373_10000572 | Ga0157373_1000057212 | 349 |
| 336 | 3300013307 | Ga0157372_10001744 | Ga0157372_100017443 | 349 |
| 337 | 3300014325 | Ga0163163_10069938 | Ga0163163_100699382 | 349 |
| 338 | 3300014326 | Ga0157380_10108620 | Ga0157380_101086202 | 349 |
| 339 | 3300014326 | Ga0157380_10188830 | Ga0157380_101888302 | 349 |
| 340 | 3300015262 | Ga0182007_10033479 | Ga0182007_100334791 | 349 |
| 341 | 3300025905 | Ga0207685_10071177 | Ga0207685_100711771 | 349 |
| 342 | 3300025907 | Ga0207645_10003905 | Ga0207645_1000390513 | 349 |
| 343 | 3300025908 | Ga0207643_10000283 | Ga0207643_1000028338 | 349 |
| 344 | 3300025910 | Ga0207684_10004913 | Ga0207684_1000491312 | 349 |
| 345 | 3300025910 | Ga0207684_10016507 | Ga0207684_100165076 | 349 |
| 346 | 3300025910 | Ga0207684_10018537 | Ga0207684_100185375 | 349 |
| 347 | 3300025910 | Ga0207684_10055473 | Ga0207684_100554732 | 349 |
| 348 | 3300025910 | Ga0207684_10221288 | Ga0207684_102212882 | 349 |
| 349 | 3300025910 | Ga0207684_10237538 | Ga0207684_102375381 | 349 |
| 350 | 3300025911 | Ga0207654_10004224 | Ga0207654_100042245 | 349 |
| 351 | 3300025912 | Ga0207707_10012113 | Ga0207707_100121137 | 349 |
| 352 | 3300025912 | Ga0207707_10261679 | Ga0207707_102616792 | 349 |
| 353 | 3300025915 | Ga0207693_10011555 | Ga0207693_100115553 | 349 |
| 354 | 3300025916 | Ga0207663_10216279 | Ga0207663_102162792 | 349 |
| 355 | 3300025917 | Ga0207660_10001251 | Ga0207660_100012516 | 349 |
| 356 | 3300025918 | Ga0207662_10054087 | Ga0207662_100540872 | 349 |
| 357 | 3300025919 | Ga0207657_10005032 | Ga0207657_1000503215 | 349 |
| 358 | 3300025921 | Ga0207652_10005011 | Ga0207652_1000501112 | 349 |
| 359 | 3300025921 | Ga0207652_10081493 | Ga0207652_100814932 | 349 |
| 360 | 3300025922 | Ga0207646_10006783 | Ga0207646_100067836 | 349 |
| 361 | 3300025922 | Ga0207646_10008978 | Ga0207646_100089789 | 349 |
| 362 | 3300025922 | Ga0207646_10011801 | Ga0207646_100118013 | 349 |
| 363 | 3300025922 | Ga0207646_10017508 | Ga0207646_100175084 | 349 |
| 364 | 3300025922 | Ga0207646_10029676 | Ga0207646_100296761 | 349 |
| 365 | 3300025922 | Ga0207646_10051620 | Ga0207646_100516203 | 349 |
| 366 | 3300025922 | Ga0207646_10365979 | Ga0207646_103659792 | 349 |
| 367 | 3300025932 | Ga0207690_10005380 | Ga0207690_100053803 | 349 |
| 368 | 3300025933 | Ga0207706_10002858 | Ga0207706_1000285814 | 349 |
| 369 | 3300025936 | Ga0207670_10018346 | Ga0207670_100183465 | 349 |
| 370 | 3300025939 | Ga0207665_10167609 | Ga0207665_101676091 | 349 |
| 371 | 3300025942 | Ga0207689_10000328 | Ga0207689_1000032831 | 349 |
| 372 | 3300025942 | Ga0207689_10009115 | Ga0207689_100091154 | 349 |
| 373 | 3300025945 | Ga0207679_10000903 | Ga0207679_1000090320 | 349 |
| 374 | 3300025949 | Ga0207667_10007787 | Ga0207667_1000778711 | 349 |
| 375 | 3300025961 | Ga0207712_10047442 | Ga0207712_100474422 | 349 |
| 376 | 3300025981 | Ga0207640_10004657 | Ga0207640_100046576 | 349 |
| 377 | 3300026035 | Ga0207703_10431074 | Ga0207703_104310741 | 349 |
| 378 | 3300026041 | Ga0207639_10032733 | Ga0207639_100327335 | 349 |
| 379 | 3300026067 | Ga0207678_10002453 | Ga0207678_100024535 | 349 |
| 380 | 3300026078 | Ga0207702_10052775 | Ga0207702_100527755 | 349 |
| 381 | 3300026088 | Ga0207641_10099604 | Ga0207641_100996042 | 349 |
| 382 | 3300026088 | Ga0207641_10180008 | Ga0207641_101800082 | 349 |
| 383 | 3300026089 | Ga0207648_10034939 | Ga0207648_100349394 | 349 |
| 384 | 3300026095 | Ga0207676_10023411 | Ga0207676_100234114 | 349 |
| 385 | 3300026116 | Ga0207674_10004521 | Ga0207674_1000452114 | 349 |
| 386 | 3300026118 | Ga0207675_100001634 | Ga0207675_10000163412 | 349 |
| 387 | 3300026118 | Ga0207675_100100581 | Ga0207675_1001005813 | 349 |
| 388 | 3300027360 | Ga0209969_1004934 | Ga0209969_10049342 | 349 |
| 389 | 3300027462 | Ga0210000_1009662 | Ga0210000_10096622 | 349 |
| 390 | 3300027471 | Ga0209995_1002725 | Ga0209995_10027254 | 349 |
| 391 | 3300027526 | Ga0209968_1004848 | Ga0209968_10048482 | 349 |
| 392 | 3300027543 | Ga0209999_1000788 | Ga0209999_10007887 | 349 |
| 393 | 3300027552 | Ga0209982_1001249 | Ga0209982_10012492 | 349 |
| 394 | 3300027617 | Ga0210002_1001388 | Ga0210002_10013885 | 349 |
| 395 | 3300027665 | Ga0209983_1000444 | Ga0209983_10004446 | 349 |
| 396 | 3300027682 | Ga0209971_1000126 | Ga0209971_100012617 | 349 |
| 397 | 3300027695 | Ga0209966_1000075 | Ga0209966_100007517 | 349 |
| 398 | 3300027717 | Ga0209998_10000010 | Ga0209998_100000103 | 349 |
| 399 | 3300027876 | Ga0209974_10001148 | Ga0209974_100011486 | 349 |
| 400 | 3300027907 | Ga0207428_10000227 | Ga0207428_1000022723 | 349 |
| 401 | 3300027907 | Ga0207428_10000945 | Ga0207428_1000094524 | 349 |
| 402 | 3300027907 | Ga0207428_10074470 | Ga0207428_100744702 | 349 |
| 403 | 3300028380 | Ga0268265_10012400 | Ga0268265_100124007 | 349 |
| 404 | 3300028380 | Ga0268265_10019949 | Ga0268265_100199493 | 349 |
| 405 | 3300028380 | Ga0268265_10031443 | Ga0268265_100314432 | 349 |
| 406 | 3300028380 | Ga0268265_10031461 | Ga0268265_100314611 | 349 |
| 407 | 3300028381 | Ga0268264_10360872 | Ga0268264_103608721 | 349 |
| 408 | 3300031548 | Ga0307408_100058310 | Ga0307408_1000583102 | 349 |
| 409 | 3300032002 | Ga0307416_100024357 | Ga0307416_1000243572 | 349 |
| 410 | 3300032005 | Ga0307411_10248900 | Ga0307411_102489002 | 349 |
| 411 | 3300034816 | Ga0373930_0018160 | Ga0373930_0018160_31_1095 | 349 |
| 412 | 3300035088 | Ga0373940_0008152 | Ga0373940_0008152_819_1874 | 349 |
| 413 | 3300035090 | Ga0373949_0014970 | Ga0373949_0014970_603_1667 | 349 |
| 414 | 3300035114 | Ga0373939_0027558 | Ga0373939_0027558_66_1121 | 349 |
| 415 | 3300035115 | Ga0373941_0005411 | Ga0373941_0005411_1623_2687 | 349 |
| 416 | 3300035691 | Ga0373931_0005118 | Ga0373931_0005118_408_1472 | 349 |
| 417 | 3300035691 | Ga0373931_0039258 | Ga0373931_0039258_1103_2158 | 349 |
| 418 | 3300037418 | Ga0395900_0008828 | Ga0395900_0008828_4189_5253 | 349 |
| 419 | 3300037466 | Ga0395898_0002138 | Ga0395898_0002138_14648_15712 | 349 |
| 420 | 3300038443 | Ga0395901_0006593 | Ga0395901_0006593_6228_7292 | 349 |
| 421 | 3300042144 | Ga0450889_001865 | Ga0450889_001865_627_1676 | 349 |
| 422 | 3300042157 | Ga0439458_0013117 | Ga0439458_0013117_791_1840 | 349 |
| 423 | 3300042876 | Ga0451577_0052792 | Ga0451577_0052792_1603_2658 | 349 |
| 424 | 3300044673 | Ga0453683_0077121 | Ga0453683_0077121_612_1661 | 349 |
| 425 | 3300044712 | Ga0453684_0010464 | Ga0453684_0010464_3005_4054 | 349 |
| 426 | 3300045051 | Ga0451576_0070015 | Ga0451576_0070015_2267_3316 | 349 |
| 427 | 3300045051 | Ga0451576_0088568 | Ga0451576_0088568_1729_2793 | 349 |
| 428 | 3300046455 | Ga0495603_0082677 | Ga0495603_0082677_39_1094 | 349 |
| 429 | 3300046472 | Ga0495580_0000361 | Ga0495580_0000361_20849_21904 | 349 |
| 430 | 3300046664 | Ga0495659_0042698 | Ga0495659_0042698_312_1361 | 349 |
| 431 | 3300046664 | Ga0495659_0067547 | Ga0495659_0067547_189_1238 | 349 |
| 432 | 3300046664 | Ga0495659_0070496 | Ga0495659_0070496_97_1161 | 349 |
| 433 | 3300046684 | Ga0495669_0027022 | Ga0495669_0027022_889_1944 | 349 |
| 434 | 3300048905 | Ga0496102_0006692 | Ga0496102_0006692_4862_5926 | 349 |
| 435 | 3300048905 | Ga0496102_0062777 | Ga0496102_0062777_968_2017 | 349 |
| 436 | 3300048910 | Ga0496107_0192145 | Ga0496107_0192145_295_1359 | 349 |
| 437 | 3300048913 | Ga0496110_0400704 | Ga0496110_0400704_85_1134 | 349 |
| 438 | 3300049572 | Ga0501036_0071558 | Ga0501036_0071558_1177_2235 | 349 |
| 439 | 3300049574 | Ga0501038_0186733 | Ga0501038_0186733_210_1286 | 349 |
| 440 | 3300049575 | Ga0501039_0056907 | Ga0501039_0056907_1854_2903 | 349 |
| 441 | 3300049575 | Ga0501039_0167026 | Ga0501039_0167026_408_1472 | 349 |
| 442 | 3300049575 | Ga0501039_0315408 | Ga0501039_0315408_99_1157 | 349 |
| 443 | 3300049576 | Ga0501040_0001146 | Ga0501040_0001146_1833_2882 | 349 |
| 444 | 3300049576 | Ga0501040_0024458 | Ga0501040_0024458_1598_2662 | 349 |
| 445 | 3300049576 | Ga0501040_0041424 | Ga0501040_0041424_1314_2375 | 349 |
| 446 | 3300049576 | Ga0501040_0047595 | Ga0501040_0047595_347_1423 | 349 |
| 447 | 3300049577 | Ga0501041_0004412 | Ga0501041_0004412_3830_4894 | 349 |
| 448 | 3300049577 | Ga0501041_0004465 | Ga0501041_0004465_1341_2399 | 349 |
| 449 | 3300049577 | Ga0501041_0007240 | Ga0501041_0007240_1553_2602 | 349 |
| 450 | 3300049577 | Ga0501041_0148156 | Ga0501041_0148156_46_1110 | 349 |
| 451 | 3300049578 | Ga0501042_0035161 | Ga0501042_0035161_721_1785 | 349 |
| 452 | 3300049578 | Ga0501042_0037194 | Ga0501042_0037194_1462_2511 | 349 |
| 453 | 3300049578 | Ga0501042_0239257 | Ga0501042_0239257_191_1240 | 349 |
| 454 | 3300049579 | Ga0501043_0067700 | Ga0501043_0067700_1227_2276 | 349 |
| 455 | 3300049580 | Ga0501046_0000938 | Ga0501046_0000938_21211_22260 | 349 |
| 456 | 3300049580 | Ga0501046_0005998 | Ga0501046_0005998_8581_9645 | 349 |
| 457 | 3300049582 | Ga0501048_0045568 | Ga0501048_0045568_616_1680 | 349 |
| 458 | 3300049582 | Ga0501048_0054178 | Ga0501048_0054178_361_1410 | 349 |
| 459 | 3300049582 | Ga0501048_0102300 | Ga0501048_0102300_202_1260 | 349 |
| 460 | 3300049582 | Ga0501048_0120635 | Ga0501048_0120635_691_1755 | 349 |
| 461 | 3300049583 | Ga0501067_0077515 | Ga0501067_0077515_31_1080 | 349 |
| 462 | 3300049584 | Ga0501068_0015791 | Ga0501068_0015791_1171_2229 | 349 |
| 463 | 3300049584 | Ga0501068_0045853 | Ga0501068_0045853_534_1598 | 349 |
| 464 | 3300049585 | Ga0501069_0013257 | Ga0501069_0013257_420_1484 | 349 |
| 465 | 3300049587 | Ga0501071_0058582 | Ga0501071_0058582_1406_2482 | 349 |
| 466 | 3300049588 | Ga0501072_0004554 | Ga0501072_0004554_5079_6143 | 349 |
| 467 | 3300049588 | Ga0501072_0006397 | Ga0501072_0006397_2342_3406 | 349 |
| 468 | 3300049588 | Ga0501072_0034378 | Ga0501072_0034378_1242_2291 | 349 |
| 469 | 3300049588 | Ga0501072_0062992 | Ga0501072_0062992_1289_2353 | 349 |
| 470 | 3300049588 | Ga0501072_0079417 | Ga0501072_0079417_1386_2450 | 349 |
| 471 | 3300049589 | Ga0501073_0136547 | Ga0501073_0136547_36_1112 | 349 |
| 472 | 3300049590 | Ga0501074_0010058 | Ga0501074_0010058_3209_4273 | 349 |
| 473 | 3300049590 | Ga0501074_0066746 | Ga0501074_0066746_311_1360 | 349 |
| 474 | 3300049590 | Ga0501074_0152095 | Ga0501074_0152095_136_1185 | 349 |
| 475 | 3300049591 | Ga0501075_0007589 | Ga0501075_0007589_4840_5904 | 349 |
| 476 | 3300049591 | Ga0501075_0014105 | Ga0501075_0014105_505_1554 | 349 |
| 477 | 3300049591 | Ga0501075_0023772 | Ga0501075_0023772_30_1088 | 349 |
| 478 | 3300049591 | Ga0501075_0026685 | Ga0501075_0026685_759_1823 | 349 |
| 479 | 3300049591 | Ga0501075_0031248 | Ga0501075_0031248_12_1088 | 349 |
| 480 | 3300049591 | Ga0501075_0041488 | Ga0501075_0041488_2201_3265 | 349 |
| 481 | 3300049591 | Ga0501075_0057956 | Ga0501075_0057956_644_1711 | 349 |
| 482 | 3300049591 | Ga0501075_0058872 | Ga0501075_0058872_433_1482 | 349 |
| 483 | 3300049591 | Ga0501075_0111503 | Ga0501075_0111503_890_1954 | 349 |
| 484 | 3300049592 | Ga0501076_0000430 | Ga0501076_0000430_22182_23240 | 349 |
| 485 | 3300049592 | Ga0501076_0030586 | Ga0501076_0030586_1585_2649 | 349 |
| 486 | 3300049592 | Ga0501076_0061154 | Ga0501076_0061154_1751_2800 | 349 |
| 487 | 3300049592 | Ga0501076_0069156 | Ga0501076_0069156_1574_2650 | 349 |
| 488 | 3300049592 | Ga0501076_0379590 | Ga0501076_0379590_51_1100 | 349 |
| 489 | 3300049593 | Ga0501077_0017229 | Ga0501077_0017229_2604_3653 | 349 |
| 490 | 3300049593 | Ga0501077_0032794 | Ga0501077_0032794_1085_2143 | 349 |
| 491 | 3300049593 | Ga0501077_0034040 | Ga0501077_0034040_1044_2120 | 349 |
| 492 | 3300049593 | Ga0501077_0156568 | Ga0501077_0156568_385_1434 | 349 |
| 493 | 3300049741 | Ga0501079_0005805 | Ga0501079_0005805_5471_6535 | 349 |
| 494 | 3300049741 | Ga0501079_0006004 | Ga0501079_0006004_3761_4810 | 349 |
| 495 | 3300049741 | Ga0501079_0009622 | Ga0501079_0009622_1405_2454 | 349 |
| 496 | 3300049741 | Ga0501079_0044376 | Ga0501079_0044376_1174_2232 | 349 |
| 497 | 3300049741 | Ga0501079_0160427 | Ga0501079_0160427_287_1363 | 349 |
| 498 | 3300049742 | Ga0501080_0059531 | Ga0501080_0059531_1834_2883 | 349 |
| 499 | 3300049742 | Ga0501080_0151505 | Ga0501080_0151505_10_1068 | 349 |
| 500 | 3300049743 | Ga0501081_0006334 | Ga0501081_0006334_6463_7521 | 349 |
| 501 | 3300049743 | Ga0501081_0006944 | Ga0501081_0006944_4829_5893 | 349 |
| 502 | 3300049743 | Ga0501081_0010338 | Ga0501081_0010338_1495_2544 | 349 |
| 503 | 3300049743 | Ga0501081_0283477 | Ga0501081_0283477_25_1089 | 349 |
| 504 | 3300049744 | Ga0501083_0026077 | Ga0501083_0026077_1432_2496 | 349 |
| 505 | 3300049824 | Ga0501045_0000499 | Ga0501045_0000499_15857_16906 | 349 |
| 506 | 3300049824 | Ga0501045_0020371 | Ga0501045_0020371_543_1607 | 349 |
| 507 | 3300049824 | Ga0501045_0248185 | Ga0501045_0248185_39_1103 | 349 |
| 508 | 3300050507 | nmdc:mga05p37_12088_c1 | nmdc:mga05p37_12088_c1_5939_7003 | 349 |
| 509 | 3300050507 | nmdc:mga05p37_158981_c1 | nmdc:mga05p37_158981_c1_1195_2244 | 349 |
| 510 | 3300050507 | nmdc:mga05p37_178439_c1 | nmdc:mga05p37_178439_c1_1035_2099 | 349 |
| 511 | 3300050507 | nmdc:mga05p37_180055_c1 | nmdc:mga05p37_180055_c1_584_1633 | 349 |
| 512 | 3300050507 | nmdc:mga05p37_508968_c1 | nmdc:mga05p37_508968_c1_73_1122 | 349 |
| 513 | 3300050507 | nmdc:mga05p37_7581_c1 | nmdc:mga05p37_7581_c1_4867_5919 | 349 |
| 514 | 3300050507 | nmdc:mga05p37_8769_c1 | nmdc:mga05p37_8769_c1_8204_9268 | 349 |
| 515 | 3300050508 | nmdc:mga09592_1488_c1 | nmdc:mga09592_1488_c1_597_1661 | 349 |
| 516 | 3300050508 | nmdc:mga09592_15223_c1 | nmdc:mga09592_15223_c1_4555_5607 | 349 |
| 517 | 3300050508 | nmdc:mga09592_188890_c1 | nmdc:mga09592_188890_c1_713_1768 | 349 |
| 518 | 3300050508 | nmdc:mga09592_30733_c1 | nmdc:mga09592_30733_c1_2825_3889 | 349 |
| 519 | 3300050509 | nmdc:mga0qj67_187935_c1 | nmdc:mga0qj67_187935_c1_386_1441 | 349 |
| 520 | 3300050509 | nmdc:mga0qj67_2640_c1 | nmdc:mga0qj67_2640_c1_3835_4899 | 349 |
| 521 | 3300050509 | nmdc:mga0qj67_660_c1 | nmdc:mga0qj67_660_c1_20874_21938 | 349 |
| 522 | 3300050510 | nmdc:mga06r32_280190_c1 | nmdc:mga06r32_280190_c1_487_1536 | 349 |
| 523 | 3300050510 | nmdc:mga06r32_393_c1 | nmdc:mga06r32_393_c1_4727_5776 | 349 |
| 524 | 3300050510 | nmdc:mga06r32_580_c1 | nmdc:mga06r32_580_c1_11793_12857 | 349 |
| 525 | 3300050510 | nmdc:mga06r32_7251_c1 | nmdc:mga06r32_7251_c1_3721_4785 | 349 |
| 526 | 3300050510 | nmdc:mga06r32_73803_c1 | nmdc:mga06r32_73803_c1_2004_3059 | 349 |
| 527 | 3300050512 | nmdc:mga0n895_1076_c1 | nmdc:mga0n895_1076_c1_9207_10256 | 349 |
| 528 | 3300050512 | nmdc:mga0n895_13160_c1 | nmdc:mga0n895_13160_c1_6037_7101 | 349 |
| 529 | 3300050512 | nmdc:mga0n895_1643_c1 | nmdc:mga0n895_1643_c1_3097_4149 | 349 |
| 530 | 3300050512 | nmdc:mga0n895_22110_c1 | nmdc:mga0n895_22110_c1_2818_3867 | 349 |
| 531 | 3300050512 | nmdc:mga0n895_67212_c1 | nmdc:mga0n895_67212_c1_579_1634 | 349 |
| 532 | 3300050513 | nmdc:mga0rr50_15807_c1 | nmdc:mga0rr50_15807_c1_1643_2698 | 349 |
| 533 | 3300050513 | nmdc:mga0rr50_340776_c1 | nmdc:mga0rr50_340776_c1_78_1133 | 349 |
| 534 | 3300050513 | nmdc:mga0rr50_6554_c1 | nmdc:mga0rr50_6554_c1_3679_4728 | 349 |
| 535 | 3300050515 | nmdc:mga0a205_1101_c1 | nmdc:mga0a205_1101_c1_20097_21146 | 349 |
| 536 | 3300050515 | nmdc:mga0a205_151291_c1 | nmdc:mga0a205_151291_c1_1078_2127 | 349 |
| 537 | 3300050515 | nmdc:mga0a205_155298_c1 | nmdc:mga0a205_155298_c1_140_1189 | 349 |
| 538 | 3300050515 | nmdc:mga0a205_157139_c1 | nmdc:mga0a205_157139_c1_943_2007 | 349 |
| 539 | 3300050515 | nmdc:mga0a205_18888_c1 | nmdc:mga0a205_18888_c1_579_1634 | 349 |
| 540 | 3300050515 | nmdc:mga0a205_21692_c1 | nmdc:mga0a205_21692_c1_4329_5381 | 349 |
| 541 | 3300050515 | nmdc:mga0a205_66882_c1 | nmdc:mga0a205_66882_c1_402_1451 | 349 |
| 542 | 3300054114 | Ga0501084_0002157 | Ga0501084_0002157_4157_5206 | 349 |
| 543 | 3300054114 | Ga0501084_0006300 | Ga0501084_0006300_4908_5957 | 349 |
| 544 | 3300054114 | Ga0501084_0014318 | Ga0501084_0014318_2881_3945 | 349 |
| 545 | 3300054114 | Ga0501084_0036912 | Ga0501084_0036912_1401_2459 | 349 |
| 546 | 3300054114 | Ga0501084_0284643 | Ga0501084_0284643_258_1322 | 349 |
| 547 | 3300060353 | Ga0501082_0005462 | Ga0501082_0005462_5463_6527 | 349 |
| 548 | 3300060353 | Ga0501082_0011012 | Ga0501082_0011012_2756_3805 | 349 |
| 549 | 3300060353 | Ga0501082_0013371 | Ga0501082_0013371_1200_2258 | 349 |
| 550 | 3300060353 | Ga0501082_0088986 | Ga0501082_0088986_46_1095 | 349 |
| 551 | 3300060353 | Ga0501082_0220424 | Ga0501082_0220424_238_1314 | 349 |
| 552 | 3300061734 | Ga0530510_0006591 | Ga0530510_0006591_5496_6560 | 349 |
| 553 | 3300061734 | Ga0530510_0022820 | Ga0530510_0022820_2020_3078 | 349 |
| 554 | 3300061734 | Ga0530510_0042134 | Ga0530510_0042134_1982_3058 | 349 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8afu-assembly2.cif.gz_A-2 | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.9143 | 1 | 341 |
| 8afu-assembly2.cif.gz_B | daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus | 0.9115 | 1 | 342 |
| 1vkn-assembly1.cif.gz_B | crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution | 0.9067 | 1 | 349 |
| 1xyg-assembly1.cif.gz_D | x-ray structure of gene product from arabidopsis thaliana at2g19940 | 0.9061 | 2 | 349 |
| 1vkn-assembly1.cif.gz_C | crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution | 0.9059 | 1 | 349 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vknA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9306 | 1 | 147 | 3.40.50.720 |
| af_Q93Z70_59_202_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9237 | 3 | 146 | 3.40.50.720 |
| af_Q2G1H4_5_166_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9175 | 6 | 165 | 3.40.50.720 |
| 2g17A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9105 | 2 | 148 | 3.40.50.720 |
| af_Q2G1H4_2_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.91 | 3 | 148 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538R4F2-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9879 | 2 | 167 |
GO:0003942
GO:0008652 GO:0051287 |
| AF-A0A3D1NFJ0-F1-model_v4 | deleted | 0.977 | 2 | 166 |
|
| AF-T0Z9Y6-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase | 0.9733 | 1 | 166 |
GO:0003942
GO:0006526 GO:0051287 |
| AF-A0A7X9AWL7-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9702 | 2 | 144 |
GO:0003942
GO:0006526 GO:0051287 |
| AF-A0A7C0YP79-F1-model_v4 | N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) | 0.9681 | 1 | 166 |
GO:0003942
GO:0006526 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar