F462958

General Info

Members Datasets Scaffolds Average Seq Length
554 202 554 345

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100044173|Ga0070694_1000441733
Length 371
Sequence MASRARGRSSSTPSADTVSSIDRVRVAVAGASGYMGAELLRLLLVHPRVTLTGVTSERLAGEPLARVYPHLRGLTDLAFHDLDPAWLAEAADVVFLALPHMESQRAVPVLRAAGRKVIDLSADYRLHDAEDYVTWYKAPHIDPAGLAEAVYGLPELHRKAIAGASLVASPGCYPVGAILATAPLVKNGLARLDGIVVDGKSGVTGAGAQGRKVDPMYLYTEANENVQAYGLASHRHTAEMDQELSGLAGSPVRVSFTPHLVPLNRGLFTTASVPLATALTTADALRVYREFYAGETFVRVCGEGERPATRQVVGSNYCDVAVAVDARTNRAVCVSAIDNLGKGGSANGVQCLNILFGWHERTGLDAAPVYP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.72
Rhizosphere 99.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10169639 3300005295 Bacteria 1490
2 Ga0070676_10001256 3300005328 Bacteria 12775
3 Ga0070670_100016104 3300005331 Bacteria 6416
4 Ga0068869_100004836 3300005334 Bacteria 8411
5 Ga0068869_100247280 3300005334 Bacteria 1423
6 Ga0070680_100000237 3300005336 Bacteria 36358
7 Ga0070680_100016280 3300005336 Bacteria 5851
8 Ga0070682_100002243 3300005337 Bacteria 10710
9 Ga0068868_100237605 3300005338 Bacteria 1530
10 Ga0070660_100001295 3300005339 Bacteria 17035
11 Ga0070689_100217327 3300005340 Bacteria 1567
12 Ga0070691_10009215 3300005341 Bacteria 4512
13 Ga0070691_10052172 3300005341 Bacteria 1955
14 Ga0070687_100048480 3300005343 Bacteria 2184
15 Ga0070661_100002504 3300005344 Bacteria 12587
16 Ga0070692_10001216 3300005345 Bacteria 9152
17 Ga0070692_10012115 3300005345 Bacteria 3980
18 Ga0070669_100005442 3300005353 Bacteria 9187
19 Ga0070675_100472395 3300005354 Bacteria 1127
20 Ga0070673_100043524 3300005364 Bacteria 3470
21 Ga0070659_100010671 3300005366 Bacteria 6766
22 Ga0070667_100102329 3300005367 Bacteria 2475
23 Ga0070703_10069842 3300005406 Bacteria 1171
24 Ga0070701_10002715 3300005438 Bacteria 6862
25 Ga0070711_100030553 3300005439 Bacteria 3568
26 Ga0070705_100001950 3300005440 Bacteria 10571
27 Ga0070705_100001967 3300005440 Bacteria 10505
28 Ga0070705_100028220 3300005440 Bacteria 3072
29 Ga0070705_100037908 3300005440 Bacteria 2722
30 Ga0070705_100077619 3300005440 Bacteria 2029
31 Ga0070705_100122671 3300005440 Bacteria 1680
32 Ga0070705_100150915 3300005440 Bacteria 1541
33 Ga0070700_100047226 3300005441 Bacteria 2664
34 Ga0070694_100000561 3300005444 Bacteria 20531
35 Ga0070694_100020678 3300005444 Bacteria 4197
36 Ga0070694_100044173 3300005444 Bacteria 2982
37 Ga0070694_100070657 3300005444 Bacteria 2404
38 Ga0070694_100075068 3300005444 Bacteria 2338
39 Ga0070708_100001394 3300005445 Bacteria 18464
40 Ga0070708_100011486 3300005445 Bacteria 7208
41 Ga0070708_100012472 3300005445 Bacteria 6937
42 Ga0070708_100023401 3300005445 Bacteria 5254
43 Ga0070708_100029999 3300005445 Bacteria 4696
44 Ga0070708_100046534 3300005445 Bacteria 3828
45 Ga0070708_100072136 3300005445 Bacteria 3111
46 Ga0070708_100173295 3300005445 Bacteria 2015
47 Ga0070708_100346657 3300005445 Bacteria 1399
48 Ga0070663_100002646 3300005455 Bacteria 10136
49 Ga0070662_100073826 3300005457 Bacteria 2521
50 Ga0070681_10028922 3300005458 Bacteria 5568
51 Ga0068867_100046086 3300005459 Bacteria 3201
52 Ga0070706_100002325 3300005467 Bacteria 19192
53 Ga0070706_100003002 3300005467 Bacteria 16718
54 Ga0070706_100004678 3300005467 Bacteria 13124
55 Ga0070706_100017418 3300005467 Bacteria 6630
56 Ga0070706_100092604 3300005467 Bacteria 2804
57 Ga0070706_100175774 3300005467 Bacteria 1999
58 Ga0070706_100221875 3300005467 Bacteria 1764
59 Ga0070707_100002799 3300005468 Bacteria 16605
60 Ga0070707_100005924 3300005468 Bacteria 11408
61 Ga0070707_100011047 3300005468 Bacteria 8410
62 Ga0070707_100038604 3300005468 Bacteria 4562
63 Ga0070707_100048281 3300005468 Bacteria 4078
64 Ga0070707_100248560 3300005468 Bacteria 1731
65 Ga0070707_100361273 3300005468 Bacteria 1410
66 Ga0070707_100454104 3300005468 Bacteria 1242
67 Ga0070707_100524504 3300005468 Bacteria 1146
68 Ga0070698_100000342 3300005471 Bacteria 48006
69 Ga0070698_100049745 3300005471 Bacteria 4277
70 Ga0070698_100200317 3300005471 Bacteria 1932
71 Ga0070698_100285225 3300005471 Bacteria 1582
72 Ga0070698_100368822 3300005471 Bacteria 1368
73 Ga0070699_100000272 3300005518 Bacteria 49692
74 Ga0070699_100008828 3300005518 Bacteria 8726
75 Ga0070699_100018888 3300005518 Bacteria 5926
76 Ga0070699_100086327 3300005518 Bacteria 2738
77 Ga0070699_100096716 3300005518 Bacteria 2586
78 Ga0070699_100120926 3300005518 Bacteria 2303
79 Ga0070699_100298250 3300005518 Bacteria 1446
80 Ga0070699_100379287 3300005518 Bacteria 1276
81 Ga0070679_100148206 3300005530 Bacteria 2324
82 Ga0070684_100081758 3300005535 Bacteria 2859
83 Ga0070697_100002227 3300005536 Bacteria 14874
84 Ga0070697_100005800 3300005536 Bacteria 9524
85 Ga0070697_100011418 3300005536 Bacteria 6942
86 Ga0070697_100050831 3300005536 Bacteria 3366
87 Ga0070697_100102508 3300005536 Unclassified 2378
88 Ga0070697_100287942 3300005536 Bacteria 1410
89 Ga0068853_100002255 3300005539 Bacteria 14412
90 Ga0070672_100019799 3300005543 Bacteria 4894
91 Ga0070695_100000858 3300005545 Bacteria 16376
92 Ga0070695_100003122 3300005545 Bacteria 9648
93 Ga0070695_100003453 3300005545 Bacteria 9232
94 Ga0070695_100005022 3300005545 Bacteria 7794
95 Ga0070695_100146215 3300005545 Bacteria 1645
96 Ga0070696_100004579 3300005546 Bacteria 9229
97 Ga0070696_100012332 3300005546 Bacteria 5733
98 Ga0070696_100044766 3300005546 Bacteria 3065
99 Ga0070696_100052290 3300005546 Bacteria 2842
100 Ga0070696_100131121 3300005546 Bacteria 1824
101 Ga0070693_100002327 3300005547 Bacteria 8723
102 Ga0070704_100016469 3300005549 Bacteria 4672
103 Ga0070704_100033795 3300005549 Bacteria 3461
104 Ga0070704_100098120 3300005549 Bacteria 2200
105 Ga0070704_100219637 3300005549 Bacteria 1544
106 Ga0070704_100369903 3300005549 Bacteria 1215
107 Ga0068855_100004031 3300005563 Bacteria 17929
108 Ga0070664_100031121 3300005564 Bacteria 4455
109 Ga0068854_100064425 3300005578 Bacteria 2662
110 Ga0068856_100008990 3300005614 Bacteria 9719
111 Ga0068859_100008722 3300005617 Bacteria 10243
112 Ga0068859_100079983 3300005617 Bacteria 3309
113 Ga0068859_100158282 3300005617 Bacteria 2343
114 Ga0068864_100010577 3300005618 Bacteria 7629
115 Ga0068864_100106221 3300005618 Bacteria 2496
116 Ga0068870_10001889 3300005840 Bacteria 8634
117 Ga0068863_100018304 3300005841 Bacteria 6707
118 Ga0068863_100158713 3300005841 Bacteria 2166
119 Ga0068858_100500783 3300005842 Bacteria 1173
120 Ga0068860_100004791 3300005843 Bacteria 13784
121 Ga0068860_100013341 3300005843 Bacteria 8056
122 Ga0068860_100144223 3300005843 Bacteria 2290
123 Ga0068862_100000665 3300005844 Bacteria 35287
124 Ga0068862_100026458 3300005844 Bacteria 4876
125 Ga0068862_100030919 3300005844 Bacteria 4514
126 Ga0081455_10000114 3300005937 Bacteria 91800
127 Ga0081538_10108942 3300005981 Bacteria 1366
128 Ga0081540_1019651 3300005983 Bacteria 4095
129 Ga0081539_10000002 3300005985 Bacteria 601032
130 Ga0070716_100033743 3300006173 Bacteria 2801
131 Ga0070712_100007586 3300006175 Bacteria 6780
132 Ga0075428_100000032 3300006844 Bacteria 118320
133 Ga0075428_100000552 3300006844 Bacteria 38291
134 Ga0075428_100007113 3300006844 Bacteria 12391
135 Ga0075428_100012194 3300006844 Bacteria 9558
136 Ga0075428_100112625 3300006844 Bacteria 2964
137 Ga0075428_100175275 3300006844 Bacteria 2323
138 Ga0075428_100306921 3300006844 Bacteria 1706
139 Ga0075430_100000002 3300006846 Bacteria 150510
140 Ga0075430_100002131 3300006846 Bacteria 16375
141 Ga0075430_100003919 3300006846 Bacteria 12550
142 Ga0075430_100004920 3300006846 Bacteria 11237
143 Ga0075430_100007458 3300006846 Bacteria 9233
144 Ga0075430_100054130 3300006846 Bacteria 3377
145 Ga0075430_100121292 3300006846 Bacteria 2180
146 Ga0075431_100000049 3300006847 Bacteria 63960
147 Ga0075431_100000290 3300006847 Bacteria 39379
148 Ga0075431_100000537 3300006847 Bacteria 31847
149 Ga0075431_100002652 3300006847 Bacteria 17317
150 Ga0075431_100003776 3300006847 Bacteria 14726
151 Ga0075431_100012068 3300006847 Bacteria 8718
152 Ga0075431_100016065 3300006847 Bacteria 7596
153 Ga0075431_100058633 3300006847 Bacteria 3973
154 Ga0075431_100163617 3300006847 Bacteria 2287
155 Ga0075431_100275248 3300006847 Bacteria 1705
156 Ga0075433_10000136 3300006852 Bacteria 38412
157 Ga0075433_10000288 3300006852 Bacteria 30114
158 Ga0075433_10010662 3300006852 Bacteria 7389
159 Ga0075433_10021537 3300006852 Bacteria 5406
160 Ga0075433_10087391 3300006852 Bacteria 2753
161 Ga0075433_10096599 3300006852 Bacteria 2615
162 Ga0075433_10100997 3300006852 Bacteria 2554
163 Ga0075433_10170973 3300006852 Bacteria 1934
164 Ga0075434_100000093 3300006871 Bacteria 49393
165 Ga0075434_100005272 3300006871 Bacteria 11755
166 Ga0075434_100025078 3300006871 Bacteria 5833
167 Ga0075434_100034285 3300006871 Bacteria 5012
168 Ga0075434_100049912 3300006871 Bacteria 4156
169 Ga0075434_100126370 3300006871 Bacteria 2574
170 Ga0075434_100158056 3300006871 Bacteria 2286
171 Ga0075434_100394134 3300006871 Bacteria 1405
172 Ga0075429_100000032 3300006880 Bacteria 64062
173 Ga0075429_100001393 3300006880 Bacteria 19747
174 Ga0075429_100013242 3300006880 Bacteria 7152
175 Ga0075429_100016754 3300006880 Bacteria 6345
176 Ga0075429_100017176 3300006880 Bacteria 6258
177 Ga0075429_100023660 3300006880 Bacteria 5331
178 Ga0075429_100039128 3300006880 Bacteria 4127
179 Ga0075429_100050179 3300006880 Bacteria 3631
180 Ga0075429_100109503 3300006880 Bacteria 2415
181 Ga0075429_100190716 3300006880 Bacteria 1796
182 Ga0075436_100000942 3300006914 Bacteria 19456
183 Ga0075436_100059751 3300006914 Bacteria 2633
184 Ga0075436_100111841 3300006914 Bacteria 1907
185 Ga0097620_100008722 3300006931 Bacteria 10243
186 Ga0097620_100079988 3300006931 Bacteria 3309
187 Ga0097620_100158293 3300006931 Bacteria 2343
188 Ga0075435_100002967 3300007076 Bacteria 11406
189 Ga0075435_100004223 3300007076 Bacteria 9864
190 Ga0075435_100015016 3300007076 Bacteria 5811
191 Ga0075435_100058766 3300007076 Bacteria 3115
192 Ga0075435_100091220 3300007076 Bacteria 2514
193 Ga0075435_100228451 3300007076 Bacteria 1581
194 Ga0099794_10014995 3300007265 Bacteria 3409
195 Ga0099794_10031507 3300007265 Bacteria 2483
196 Ga0111539_10000726 3300009094 Bacteria 42868
197 Ga0111539_10000923 3300009094 Bacteria 38413
198 Ga0114129_10000178 3300009147 Bacteria 70458
199 Ga0114129_10000462 3300009147 Bacteria 48711
200 Ga0114129_10000721 3300009147 Bacteria 41915
201 Ga0114129_10001856 3300009147 Bacteria 28790
202 Ga0114129_10003753 3300009147 Bacteria 21411
203 Ga0114129_10008446 3300009147 Bacteria 14671
204 Ga0114129_10011856 3300009147 Bacteria 12398
205 Ga0114129_10011871 3300009147 Bacteria 12389
206 Ga0114129_10013604 3300009147 Bacteria 11595
207 Ga0114129_10021871 3300009147 Bacteria 9077
208 Ga0114129_10026397 3300009147 Bacteria 8224
209 Ga0114129_10053499 3300009147 Bacteria 5662
210 Ga0114129_10060361 3300009147 Bacteria 5302
211 Ga0114129_10112417 3300009147 Bacteria 3756
212 Ga0114129_10170465 3300009147 Bacteria 2968
213 Ga0114129_10179629 3300009147 Bacteria 2881
214 Ga0114129_10229947 3300009147 Bacteria 2498
215 Ga0105243_10102931 3300009148 Bacteria 2374
216 Ga0105241_10002768 3300009174 Bacteria 13137
217 Ga0105241_10094725 3300009174 Bacteria 2362
218 Ga0105242_10035282 3300009176 Bacteria 4011
219 Ga0105248_10308810 3300009177 Bacteria 1781
220 Ga0105249_10005712 3300009553 Bacteria 10760
221 Ga0105249_10189600 3300009553 Bacteria 2006
222 Ga0157373_10000572 3300013100 Bacteria 28757
223 Ga0163162_10002446 3300013306 Bacteria 17518
224 Ga0157372_10001744 3300013307 Bacteria 23588
225 Ga0157375_10050857 3300013308 Bacteria 4066
226 Ga0163163_10069938 3300014325 Bacteria 3495
227 Ga0157380_10108620 3300014326 Bacteria 2326
228 Ga0157380_10188830 3300014326 Bacteria 1817
229 Ga0182007_10033479 3300015262 Bacteria 1741
230 Ga0163161_10044440 3300017792 Bacteria 3199
231 Ga0207653_10005767 3300025885 Bacteria 3861
232 Ga0207685_10071177 3300025905 Unclassified 1410
233 Ga0207645_10003905 3300025907 Bacteria 11141
234 Ga0207643_10000283 3300025908 Bacteria 35229
235 Ga0207684_10000105 3300025910 Bacteria 160905
236 Ga0207684_10004913 3300025910 Bacteria 12477
237 Ga0207684_10016507 3300025910 Bacteria 6340
238 Ga0207684_10018537 3300025910 Bacteria 5958
239 Ga0207684_10055473 3300025910 Bacteria 3362
240 Ga0207684_10221288 3300025910 Unclassified 1634
241 Ga0207684_10237538 3300025910 Bacteria 1572
242 Ga0207654_10004224 3300025911 Bacteria 7249
243 Ga0207707_10012113 3300025912 Bacteria 7495
244 Ga0207707_10261679 3300025912 Bacteria 1501
245 Ga0207693_10011555 3300025915 Bacteria 7141
246 Ga0207663_10216279 3300025916 Bacteria 1392
247 Ga0207660_10001251 3300025917 Bacteria 17023
248 Ga0207662_10054087 3300025918 Bacteria 2393
249 Ga0207657_10005032 3300025919 Bacteria 13871
250 Ga0207652_10005011 3300025921 Bacteria 10728
251 Ga0207652_10081493 3300025921 Bacteria 2831
252 Ga0207646_10004085 3300025922 Bacteria 16075
253 Ga0207646_10006783 3300025922 Bacteria 11785
254 Ga0207646_10008978 3300025922 Bacteria 9944
255 Ga0207646_10011801 3300025922 Bacteria 8438
256 Ga0207646_10017508 3300025922 Bacteria 6703
257 Ga0207646_10029676 3300025922 Bacteria 4966
258 Ga0207646_10051620 3300025922 Bacteria 3679
259 Ga0207646_10365979 3300025922 Bacteria 1303
260 Ga0207681_10008184 3300025923 Bacteria 6394
261 Ga0207681_10032479 3300025923 Bacteria 3418
262 Ga0207690_10005380 3300025932 Bacteria 7545
263 Ga0207706_10002858 3300025933 Bacteria 16755
264 Ga0207686_10082074 3300025934 Bacteria 2106
265 Ga0207670_10018346 3300025936 Bacteria 4252
266 Ga0207665_10056887 3300025939 Bacteria 2641
267 Ga0207665_10167609 3300025939 Bacteria 1584
268 Ga0207691_10091558 3300025940 Bacteria 2725
269 Ga0207689_10000328 3300025942 Bacteria 44046
270 Ga0207689_10009115 3300025942 Bacteria 8589
271 Ga0207679_10000903 3300025945 Bacteria 18953
272 Ga0207667_10007787 3300025949 Bacteria 12810
273 Ga0207712_10047442 3300025961 Bacteria 2982
274 Ga0207668_10068341 3300025972 Bacteria 2526
275 Ga0207640_10004657 3300025981 Bacteria 7444
276 Ga0207703_10431074 3300026035 Bacteria 1228
277 Ga0207639_10032733 3300026041 Bacteria 3830
278 Ga0207678_10002453 3300026067 Bacteria 16841
279 Ga0207702_10052775 3300026078 Bacteria 3441
280 Ga0207641_10099604 3300026088 Bacteria 2557
281 Ga0207641_10180008 3300026088 Bacteria 1936
282 Ga0207641_10319793 3300026088 Bacteria 1471
283 Ga0207648_10034939 3300026089 Bacteria 4431
284 Ga0207648_10428875 3300026089 Bacteria 1201
285 Ga0207676_10023411 3300026095 Bacteria 4556
286 Ga0207674_10004521 3300026116 Bacteria 16707
287 Ga0207675_100001634 3300026118 Bacteria 22466
288 Ga0207675_100100581 3300026118 Bacteria 2724
289 Ga0209969_1004934 3300027360 Bacteria 1865
290 Ga0210000_1009662 3300027462 Bacteria 1421
291 Ga0209995_1002725 3300027471 Bacteria 2799
292 Ga0209968_1004848 3300027526 Bacteria 2016
293 Ga0209968_1006255 3300027526 Bacteria 1792
294 Ga0209999_1000788 3300027543 Bacteria 5213
295 Ga0209982_1001249 3300027552 Bacteria 3433
296 Ga0210002_1001388 3300027617 Bacteria 3398
297 Ga0209983_1000444 3300027665 Bacteria 8951
298 Ga0209588_1038135 3300027671 Bacteria 1548
299 Ga0209971_1000126 3300027682 Bacteria 22819
300 Ga0209966_1000075 3300027695 Bacteria 43334
301 Ga0209998_10000010 3300027717 Bacteria 98452
302 Ga0209974_10001148 3300027876 Bacteria 9432
303 Ga0207428_10000227 3300027907 Bacteria 77877
304 Ga0207428_10000945 3300027907 Bacteria 32297
305 Ga0207428_10074470 3300027907 Bacteria 2662
306 Ga0207428_10205407 3300027907 Bacteria 1481
307 Ga0268265_10012400 3300028380 Bacteria 5775
308 Ga0268265_10019949 3300028380 Bacteria 4670
309 Ga0268265_10031443 3300028380 Bacteria 3833
310 Ga0268265_10031461 3300028380 Bacteria 3832
311 Ga0268265_10103190 3300028380 Bacteria 2309
312 Ga0268264_10360872 3300028381 Bacteria 1386
313 Ga0307408_100058310 3300031548 Bacteria 2806
314 Ga0307416_100024357 3300032002 Bacteria 4416
315 Ga0307411_10248900 3300032005 Bacteria 1396
316 Ga0373930_0018160 3300034816 Bacteria 1349
317 Ga0373950_0017949 3300034818 Bacteria 1224
318 Ga0373940_0000389 3300035088 Bacteria 6656
319 Ga0373940_0008152 3300035088 Bacteria 2395
320 Ga0373949_0014970 3300035090 Bacteria 1730
321 Ga0373932_0008437 3300035112 Bacteria 2464
322 Ga0373939_0010091 3300035114 Bacteria 2353
323 Ga0373939_0027558 3300035114 Bacteria 1610
324 Ga0373941_0005411 3300035115 Bacteria 3003
325 Ga0373943_0028052 3300035170 Unclassified 2651
326 Ga0373931_0005118 3300035691 Bacteria 6037
327 Ga0373931_0039258 3300035691 Bacteria 2480
328 Ga0373931_0053557 3300035691 Bacteria 2153
329 Ga0373925_0001592 3300037068 Bacteria 19194
330 Ga0395900_0008828 3300037418 Bacteria 10352
331 Ga0395898_0002138 3300037466 Bacteria 24347
332 Ga0395905_0039395 3300037471 Bacteria 4434
333 Ga0395901_0006593 3300038443 Bacteria 11731
334 Ga0450889_001865 3300042144 Bacteria 2128
335 Ga0439458_0013117 3300042157 Bacteria 1864
336 Ga0451577_0052792 3300042876 Bacteria 3630
337 Ga0451577_0110116 3300042876 Bacteria 2463
338 Ga0453683_0077121 3300044673 Bacteria 2087
339 Ga0453683_0089977 3300044673 Bacteria 1924
340 Ga0453684_0010464 3300044712 Bacteria 15856
341 Ga0451576_0036109 3300045051 Bacteria 5241
342 Ga0451576_0070015 3300045051 Bacteria 3651
343 Ga0451576_0088568 3300045051 Bacteria 3220
344 Ga0495603_0082677 3300046455 Bacteria 1881
345 Ga0495603_0126074 3300046455 Bacteria 1492
346 Ga0495580_0000361 3300046472 Bacteria 37086
347 Ga0495659_0042698 3300046664 Bacteria 1624
348 Ga0495659_0067547 3300046664 Bacteria 1333
349 Ga0495659_0070496 3300046664 Bacteria 1309
350 Ga0495669_0027022 3300046684 Bacteria 2510
351 Ga0496102_0006692 3300048905 Bacteria 9844
352 Ga0496102_0062777 3300048905 Bacteria 3402
353 Ga0496107_0192145 3300048910 Bacteria 1517
354 Ga0496110_0400704 3300048913 Bacteria 1251
355 Ga0501036_0071558 3300049572 Bacteria 2932
356 Ga0501036_0223499 3300049572 Bacteria 1581
357 Ga0501036_0276714 3300049572 Bacteria 1405
358 Ga0501036_0424785 3300049572 Unclassified 1108
359 Ga0501038_0186733 3300049574 Bacteria 1670
360 Ga0501038_0362678 3300049574 Bacteria 1127
361 Ga0501039_0056907 3300049575 Bacteria 3029
362 Ga0501039_0079050 3300049575 Bacteria 2559
363 Ga0501039_0167026 3300049575 Bacteria 1730
364 Ga0501039_0315408 3300049575 Bacteria 1229
365 Ga0501040_0001146 3300049576 Bacteria 16844
366 Ga0501040_0021818 3300049576 Bacteria 4281
367 Ga0501040_0024458 3300049576 Bacteria 4054
368 Ga0501040_0041424 3300049576 Bacteria 3137
369 Ga0501040_0047595 3300049576 Bacteria 2928
370 Ga0501041_0004412 3300049577 Bacteria 8140
371 Ga0501041_0004465 3300049577 Bacteria 8101
372 Ga0501041_0007240 3300049577 Bacteria 6510
373 Ga0501041_0148156 3300049577 Bacteria 1465
374 Ga0501042_0035161 3300049578 Bacteria 3554
375 Ga0501042_0037194 3300049578 Bacteria 3454
376 Ga0501042_0109619 3300049578 Bacteria 1988
377 Ga0501042_0239257 3300049578 Bacteria 1310
378 Ga0501043_0067700 3300049579 Bacteria 2804
379 Ga0501046_0000938 3300049580 Bacteria 28563
380 Ga0501046_0005998 3300049580 Bacteria 10807
381 Ga0501048_0045568 3300049582 Bacteria 3132
382 Ga0501048_0054178 3300049582 Bacteria 2849
383 Ga0501048_0102300 3300049582 Bacteria 2021
384 Ga0501048_0120635 3300049582 Bacteria 1853
385 Ga0501048_0271031 3300049582 Bacteria 1206
386 Ga0501067_0077515 3300049583 Bacteria 1842
387 Ga0501068_0015791 3300049584 Bacteria 4345
388 Ga0501068_0045853 3300049584 Bacteria 2634
389 Ga0501069_0013257 3300049585 Bacteria 4392
390 Ga0501071_0058582 3300049587 Bacteria 2786
391 Ga0501072_0004554 3300049588 Bacteria 10543
392 Ga0501072_0006397 3300049588 Bacteria 8974
393 Ga0501072_0033139 3300049588 Bacteria 4047
394 Ga0501072_0034378 3300049588 Bacteria 3973
395 Ga0501072_0058763 3300049588 Bacteria 3031
396 Ga0501072_0062992 3300049588 Bacteria 2925
397 Ga0501072_0075130 3300049588 Bacteria 2672
398 Ga0501072_0079417 3300049588 Bacteria 2598
399 Ga0501072_0079621 3300049588 Bacteria 2595
400 Ga0501072_0086330 3300049588 Bacteria 2490
401 Ga0501072_0087555 3300049588 Bacteria 2471
402 Ga0501073_0136547 3300049589 Bacteria 1700
403 Ga0501074_0010058 3300049590 Bacteria 6867
404 Ga0501074_0066746 3300049590 Bacteria 2587
405 Ga0501074_0078151 3300049590 Bacteria 2375
406 Ga0501074_0152095 3300049590 Bacteria 1654
407 Ga0501074_0315267 3300049590 Bacteria 1111
408 Ga0501075_0007589 3300049591 Bacteria 7526
409 Ga0501075_0014105 3300049591 Bacteria 5724
410 Ga0501075_0016946 3300049591 Bacteria 5255
411 Ga0501075_0023772 3300049591 Bacteria 4488
412 Ga0501075_0026685 3300049591 Bacteria 4254
413 Ga0501075_0031248 3300049591 Bacteria 3951
414 Ga0501075_0041488 3300049591 Bacteria 3449
415 Ga0501075_0051721 3300049591 Bacteria 3089
416 Ga0501075_0057956 3300049591 Bacteria 2917
417 Ga0501075_0058872 3300049591 Bacteria 2894
418 Ga0501075_0111503 3300049591 Bacteria 2080
419 Ga0501075_0112709 3300049591 Bacteria 2068
420 Ga0501075_0243066 3300049591 Bacteria 1372
421 Ga0501076_0000430 3300049592 Bacteria 26447
422 Ga0501076_0022856 3300049592 Bacteria 4811
423 Ga0501076_0022875 3300049592 Bacteria 4809
424 Ga0501076_0030586 3300049592 Bacteria 4194
425 Ga0501076_0061154 3300049592 Bacteria 2997
426 Ga0501076_0066226 3300049592 Bacteria 2883
427 Ga0501076_0069156 3300049592 Bacteria 2821
428 Ga0501076_0089652 3300049592 Bacteria 2472
429 Ga0501076_0193725 3300049592 Bacteria 1659
430 Ga0501076_0278896 3300049592 Bacteria 1369
431 Ga0501076_0379590 3300049592 Unclassified 1162
432 Ga0501077_0004036 3300049593 Bacteria 8860
433 Ga0501077_0017229 3300049593 Bacteria 4557
434 Ga0501077_0032794 3300049593 Bacteria 3307
435 Ga0501077_0034040 3300049593 Bacteria 3242
436 Ga0501077_0043812 3300049593 Bacteria 2844
437 Ga0501077_0047491 3300049593 Bacteria 2728
438 Ga0501077_0156568 3300049593 Bacteria 1446
439 Ga0501079_0005805 3300049741 Bacteria 9227
440 Ga0501079_0006004 3300049741 Bacteria 9097
441 Ga0501079_0007317 3300049741 Bacteria 8341
442 Ga0501079_0009622 3300049741 Bacteria 7330
443 Ga0501079_0044376 3300049741 Bacteria 3431
444 Ga0501079_0160427 3300049741 Bacteria 1753
445 Ga0501080_0059531 3300049742 Bacteria 3554
446 Ga0501080_0083301 3300049742 Bacteria 2971
447 Ga0501080_0151505 3300049742 Bacteria 2143
448 Ga0501081_0006334 3300049743 Bacteria 7673
449 Ga0501081_0006944 3300049743 Bacteria 7357
450 Ga0501081_0007157 3300049743 Bacteria 7254
451 Ga0501081_0010338 3300049743 Bacteria 6091
452 Ga0501081_0028965 3300049743 Bacteria 3739
453 Ga0501081_0081984 3300049743 Bacteria 2259
454 Ga0501081_0253462 3300049743 Bacteria 1285
455 Ga0501081_0283477 3300049743 Bacteria 1213
456 Ga0501083_0026077 3300049744 Bacteria 4043
457 Ga0501083_0121676 3300049744 Bacteria 1712
458 Ga0501045_0000499 3300049824 Bacteria 24392
459 Ga0501045_0020371 3300049824 Bacteria 4737
460 Ga0501045_0044043 3300049824 Bacteria 3250
461 Ga0501045_0050660 3300049824 Bacteria 3030
462 Ga0501045_0248185 3300049824 Bacteria 1325
463 nmdc:mga05p37_12088_c1 3300050507 Bacteria 10305
464 nmdc:mga05p37_158981_c1 3300050507 Bacteria 2760
465 nmdc:mga05p37_178439_c1 3300050507 Bacteria 2586
466 nmdc:mga05p37_180055_c1 3300050507 Bacteria 2572
467 nmdc:mga05p37_370946_c1 3300050507 Bacteria 1680
468 nmdc:mga05p37_413398_c1 3300050507 Unclassified 1572
469 nmdc:mga05p37_48163_c1 3300050507 Bacteria 5243
470 nmdc:mga05p37_482301_c1 3300050507 Bacteria 1428
471 nmdc:mga05p37_508968_c1 3300050507 Bacteria 1380
472 nmdc:mga05p37_6_c1 3300050507 Bacteria 155503
473 nmdc:mga05p37_7581_c1 3300050507 Bacteria 12799
474 nmdc:mga05p37_84_c1 3300050507 Bacteria 83805
475 nmdc:mga05p37_8769_c1 3300050507 Bacteria 11946
476 nmdc:mga05p37_9160_c1 3300050507 Bacteria 11703
477 nmdc:mga05p37_993_c1 3300050507 Bacteria 32348
478 nmdc:mga09592_123933_c1 3300050508 Unclassified 2221
479 nmdc:mga09592_1488_c1 3300050508 Bacteria 18850
480 nmdc:mga09592_150519_c1 3300050508 Bacteria 2008
481 nmdc:mga09592_15223_c1 3300050508 Bacteria 6285
482 nmdc:mga09592_188890_c1 3300050508 Bacteria 1783
483 nmdc:mga09592_30733_c1 3300050508 Bacteria 4470
484 nmdc:mga09592_46166_c1 3300050508 Bacteria 3669
485 nmdc:mga09592_677_c1 3300050508 Bacteria 26087
486 nmdc:mga09592_9165_c1 3300050508 Bacteria 8051
487 nmdc:mga0qj67_187935_c1 3300050509 Bacteria 1678
488 nmdc:mga0qj67_23382_c1 3300050509 Bacteria 4754
489 nmdc:mga0qj67_2640_c1 3300050509 Bacteria 12843
490 nmdc:mga0qj67_42504_c1 3300050509 Bacteria 3578
491 nmdc:mga0qj67_660_c1 3300050509 Bacteria 23685
492 nmdc:mga0qj67_9768_c1 3300050509 Bacteria 7149
493 nmdc:mga06r32_1033_c1 3300050510 Bacteria 22755
494 nmdc:mga06r32_131776_c1 3300050510 Bacteria 2472
495 nmdc:mga06r32_13475_c1 3300050510 Bacteria 7408
496 nmdc:mga06r32_280190_c1 3300050510 Bacteria 1654
497 nmdc:mga06r32_35934_c1 3300050510 Bacteria 4678
498 nmdc:mga06r32_393_c1 3300050510 Bacteria 36896
499 nmdc:mga06r32_49733_c1 3300050510 Bacteria 4010
500 nmdc:mga06r32_580_c1 3300050510 Bacteria 31839
501 nmdc:mga06r32_7251_c1 3300050510 Bacteria 9989
502 nmdc:mga06r32_73803_c1 3300050510 Bacteria 3306
503 nmdc:mga06r32_951_c1 3300050510 Bacteria 25814
504 nmdc:mga08y16_36472_c1 3300050511 Bacteria 5164
505 nmdc:mga0n895_100_c1 3300050512 Bacteria 50742
506 nmdc:mga0n895_1076_c1 3300050512 Bacteria 19948
507 nmdc:mga0n895_13160_c1 3300050512 Bacteria 7451
508 nmdc:mga0n895_1643_c1 3300050512 Bacteria 16908
509 nmdc:mga0n895_22110_c1 3300050512 Bacteria 5960
510 nmdc:mga0n895_412750_c1 3300050512 Bacteria 1365
511 nmdc:mga0n895_461846_c1 3300050512 Bacteria 1281
512 nmdc:mga0n895_67212_c1 3300050512 Bacteria 3550
513 nmdc:mga0rr50_15807_c1 3300050513 Bacteria 4992
514 nmdc:mga0rr50_332_c1 3300050513 Bacteria 25768
515 nmdc:mga0rr50_340776_c1 3300050513 Bacteria 1260
516 nmdc:mga0rr50_6554_c1 3300050513 Bacteria 7105
517 nmdc:mga0rr50_84509_c1 3300050513 Bacteria 2458
518 nmdc:mga08x19_1054_c1 3300050514 Bacteria 17231
519 nmdc:mga08x19_207780_c1 3300050514 Bacteria 1344
520 nmdc:mga0a205_1101_c1 3300050515 Bacteria 22410
521 nmdc:mga0a205_147487_c1 3300050515 Bacteria 2253
522 nmdc:mga0a205_151291_c1 3300050515 Bacteria 2220
523 nmdc:mga0a205_155298_c1 3300050515 Bacteria 2187
524 nmdc:mga0a205_157139_c1 3300050515 Bacteria 2172
525 nmdc:mga0a205_18888_c1 3300050515 Bacteria 6493
526 nmdc:mga0a205_21692_c1 3300050515 Bacteria 6073
527 nmdc:mga0a205_288_c1 3300050515 Bacteria 37035
528 nmdc:mga0a205_61696_c1 3300050515 Bacteria 3621
529 nmdc:mga0a205_66882_c1 3300050515 Bacteria 3472
530 nmdc:mga0a205_721_c1 3300050515 Bacteria 26623
531 Ga0501084_0002157 3300054114 Bacteria 15751
532 Ga0501084_0002783 3300054114 Bacteria 14127
533 Ga0501084_0006300 3300054114 Bacteria 9751
534 Ga0501084_0014318 3300054114 Bacteria 6571
535 Ga0501084_0036912 3300054114 Bacteria 4083
536 Ga0501084_0055645 3300054114 Bacteria 3310
537 Ga0501084_0070211 3300054114 Bacteria 2933
538 Ga0501084_0087678 3300054114 Bacteria 2613
539 Ga0501084_0109723 3300054114 Bacteria 2318
540 Ga0501084_0165364 3300054114 Bacteria 1867
541 Ga0501084_0284643 3300054114 Bacteria 1396
542 Ga0501082_0005462 3300060353 Bacteria 11037
543 Ga0501082_0011012 3300060353 Bacteria 7776
544 Ga0501082_0013371 3300060353 Bacteria 7057
545 Ga0501082_0088986 3300060353 Bacteria 2665
546 Ga0501082_0112021 3300060353 Bacteria 2362
547 Ga0501082_0119333 3300060353 Bacteria 2285
548 Ga0501082_0220424 3300060353 Bacteria 1650
549 Ga0530510_0001605 3300061734 Bacteria 15267
550 Ga0530510_0006591 3300061734 Bacteria 8097
551 Ga0530510_0016525 3300061734 Bacteria 5226
552 Ga0530510_0022820 3300061734 Bacteria 4459
553 Ga0530510_0042134 3300061734 Bacteria 3298
554 Ga0530510_0116730 3300061734 Bacteria 1957

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0193725 Ga0501076_0193725_677_1633 293
2 3300025923 Ga0207681_10032479 Ga0207681_100324792 301
3 3300006844 Ga0075428_100175275 Ga0075428_1001752752 310
4 3300006847 Ga0075431_100058633 Ga0075431_1000586333 310
5 3300050508 nmdc:mga09592_46166_c1 nmdc:mga09592_46166_c1_977_2026 310
6 3300050510 nmdc:mga06r32_49733_c1 nmdc:mga06r32_49733_c1_2028_3077 310
7 3300050507 nmdc:mga05p37_48163_c1 nmdc:mga05p37_48163_c1_2858_3874 312
8 3300050510 nmdc:mga06r32_131776_c1 nmdc:mga06r32_131776_c1_164_1180 312
9 3300006871 Ga0075434_100394134 Ga0075434_1003941341 314
10 3300009147 Ga0114129_10003753 Ga0114129_100037536 314
11 3300005468 Ga0070707_100248560 Ga0070707_1002485601 317
12 3300005985 Ga0081539_10000002 Ga0081539_10000002136 317
13 3300049588 Ga0501072_0087555 Ga0501072_0087555_22_978 317
14 3300049590 Ga0501074_0315267 Ga0501074_0315267_53_1009 317
15 3300049742 Ga0501080_0083301 Ga0501080_0083301_143_1156 317
16 3300042876 Ga0451577_0110116 Ga0451577_0110116_1154_2167 318
17 3300045051 Ga0451576_0036109 Ga0451576_0036109_2816_3829 318
18 3300049743 Ga0501081_0253462 Ga0501081_0253462_127_1140 318
19 3300006844 Ga0075428_100000552 Ga0075428_10000055233 319
20 3300006847 Ga0075431_100000049 Ga0075431_10000004964 319
21 3300006880 Ga0075429_100017176 Ga0075429_1000171765 319
22 3300009147 Ga0114129_10000721 Ga0114129_1000072113 319
23 3300049572 Ga0501036_0276714 Ga0501036_0276714_424_1386 319
24 3300050507 nmdc:mga05p37_84_c1 nmdc:mga05p37_84_c1_33147_34163 319
25 3300050508 nmdc:mga09592_677_c1 nmdc:mga09592_677_c1_21124_22140 319
26 3300050510 nmdc:mga06r32_951_c1 nmdc:mga06r32_951_c1_19673_20689 319
27 3300049576 Ga0501040_0021818 Ga0501040_0021818_1844_2857 320
28 3300049590 Ga0501074_0078151 Ga0501074_0078151_11_1024 320
29 3300049591 Ga0501075_0243066 Ga0501075_0243066_260_1273 320
30 3300049593 Ga0501077_0043812 Ga0501077_0043812_1709_2722 320
31 3300050513 nmdc:mga0rr50_84509_c1 nmdc:mga0rr50_84509_c1_57_1070 320
32 3300050514 nmdc:mga08x19_207780_c1 nmdc:mga08x19_207780_c1_275_1288 320
33 3300050515 nmdc:mga0a205_721_c1 nmdc:mga0a205_721_c1_21810_22823 320
34 3300054114 Ga0501084_0087678 Ga0501084_0087678_133_1146 320
35 3300006847 Ga0075431_100163617 Ga0075431_1001636173 324
36 3300054114 Ga0501084_0070211 Ga0501084_0070211_435_1502 324
37 3300061734 Ga0530510_0116730 Ga0530510_0116730_642_1709 324
38 3300005467 Ga0070706_100092604 Ga0070706_1000926042 329
39 3300005468 Ga0070707_100005924 Ga0070707_10000592412 329
40 3300005444 Ga0070694_100000561 Ga0070694_10000056121 330
41 3300005545 Ga0070695_100003122 Ga0070695_10000312210 330
42 3300007265 Ga0099794_10031507 Ga0099794_100315072 330
43 3300005440 Ga0070705_100077619 Ga0070705_1000776192 332
44 3300005445 Ga0070708_100001394 Ga0070708_10000139416 332
45 3300005467 Ga0070706_100003002 Ga0070706_10000300216 332
46 3300005468 Ga0070707_100524504 Ga0070707_1005245041 332
47 3300005471 Ga0070698_100000342 Ga0070698_10000034225 332
48 3300005471 Ga0070698_100200317 Ga0070698_1002003171 332
49 3300005518 Ga0070699_100000272 Ga0070699_10000027223 332
50 3300006173 Ga0070716_100033743 Ga0070716_1000337433 332
51 3300006852 Ga0075433_10100997 Ga0075433_101009972 332
52 3300006871 Ga0075434_100034285 Ga0075434_1000342855 332
53 3300025910 Ga0207684_10000105 Ga0207684_1000010558 332
54 3300025922 Ga0207646_10004085 Ga0207646_1000408515 332
55 3300025939 Ga0207665_10056887 Ga0207665_100568872 332
56 3300005334 Ga0068869_100247280 Ga0068869_1002472802 335
57 3300005336 Ga0070680_100016280 Ga0070680_1000162804 335
58 3300005341 Ga0070691_10009215 Ga0070691_100092155 335
59 3300005345 Ga0070692_10012115 Ga0070692_100121152 335
60 3300005438 Ga0070701_10002715 Ga0070701_100027152 335
61 3300005440 Ga0070705_100001950 Ga0070705_1000019505 335
62 3300005444 Ga0070694_100070657 Ga0070694_1000706572 335
63 3300005518 Ga0070699_100120926 Ga0070699_1001209264 335
64 3300005545 Ga0070695_100005022 Ga0070695_1000050227 335
65 3300005546 Ga0070696_100052290 Ga0070696_1000522903 335
66 3300005549 Ga0070704_100033795 Ga0070704_1000337954 335
67 3300009148 Ga0105243_10102931 Ga0105243_101029312 335
68 3300009176 Ga0105242_10035282 Ga0105242_100352823 335
69 3300025885 Ga0207653_10005767 Ga0207653_100057675 335
70 3300028380 Ga0268265_10103190 Ga0268265_101031901 335
71 3300044673 Ga0453683_0089977 Ga0453683_0089977_689_1738 335
72 3300035170 Ga0373943_0028052 Ga0373943_0028052_1335_2348 336
73 3300037068 Ga0373925_0001592 Ga0373925_0001592_17362_18375 336
74 3300005353 Ga0070669_100005442 Ga0070669_1000054425 337
75 3300005445 Ga0070708_100046534 Ga0070708_1000465344 337
76 3300005445 Ga0070708_100072136 Ga0070708_1000721365 337
77 3300005467 Ga0070706_100002325 Ga0070706_10000232512 337
78 3300005536 Ga0070697_100005800 Ga0070697_1000058008 337
79 3300005543 Ga0070672_100019799 Ga0070672_1000197992 337
80 3300005546 Ga0070696_100131121 Ga0070696_1001311212 337
81 3300005841 Ga0068863_100158713 Ga0068863_1001587132 337
82 3300005843 Ga0068860_100013341 Ga0068860_1000133418 337
83 3300005981 Ga0081538_10108942 Ga0081538_101089422 337
84 3300006844 Ga0075428_100007113 Ga0075428_10000711312 337
85 3300006844 Ga0075428_100012194 Ga0075428_1000121946 337
86 3300006847 Ga0075431_100000290 Ga0075431_10000029012 337
87 3300006852 Ga0075433_10000288 Ga0075433_1000028816 337
88 3300006871 Ga0075434_100158056 Ga0075434_1001580562 337
89 3300006880 Ga0075429_100023660 Ga0075429_1000236602 337
90 3300006880 Ga0075429_100190716 Ga0075429_1001907162 337
91 3300006914 Ga0075436_100000942 Ga0075436_1000009422 337
92 3300007076 Ga0075435_100004223 Ga0075435_1000042232 337
93 3300009094 Ga0111539_10000923 Ga0111539_1000092332 337
94 3300009147 Ga0114129_10000178 Ga0114129_1000017845 337
95 3300009147 Ga0114129_10000462 Ga0114129_100004625 337
96 3300009147 Ga0114129_10011856 Ga0114129_1001185612 337
97 3300009147 Ga0114129_10026397 Ga0114129_100263979 337
98 3300009174 Ga0105241_10094725 Ga0105241_100947251 337
99 3300013306 Ga0163162_10002446 Ga0163162_1000244615 337
100 3300013308 Ga0157375_10050857 Ga0157375_100508573 337
101 3300017792 Ga0163161_10044440 Ga0163161_100444402 337
102 3300025923 Ga0207681_10008184 Ga0207681_100081842 337
103 3300025934 Ga0207686_10082074 Ga0207686_100820743 337
104 3300025940 Ga0207691_10091558 Ga0207691_100915583 337
105 3300025972 Ga0207668_10068341 Ga0207668_100683412 337
106 3300026088 Ga0207641_10319793 Ga0207641_103197932 337
107 3300026089 Ga0207648_10428875 Ga0207648_104288751 337
108 3300027907 Ga0207428_10205407 Ga0207428_102054072 337
109 3300034818 Ga0373950_0017949 Ga0373950_0017949_195_1208 337
110 3300035088 Ga0373940_0000389 Ga0373940_0000389_3389_4402 337
111 3300035112 Ga0373932_0008437 Ga0373932_0008437_1430_2443 337
112 3300035114 Ga0373939_0010091 Ga0373939_0010091_207_1220 337
113 3300035691 Ga0373931_0053557 Ga0373931_0053557_189_1202 337
114 3300037471 Ga0395905_0039395 Ga0395905_0039395_1070_2086 337
115 3300046455 Ga0495603_0126074 Ga0495603_0126074_264_1277 337
116 3300049572 Ga0501036_0223499 Ga0501036_0223499_551_1564 337
117 3300049572 Ga0501036_0424785 Ga0501036_0424785_53_1066 337
118 3300049574 Ga0501038_0362678 Ga0501038_0362678_101_1114 337
119 3300049575 Ga0501039_0079050 Ga0501039_0079050_1313_2326 337
120 3300049578 Ga0501042_0109619 Ga0501042_0109619_939_1952 337
121 3300049582 Ga0501048_0271031 Ga0501048_0271031_26_1039 337
122 3300049588 Ga0501072_0033139 Ga0501072_0033139_1771_2784 337
123 3300049588 Ga0501072_0058763 Ga0501072_0058763_1900_2913 337
124 3300049588 Ga0501072_0075130 Ga0501072_0075130_189_1202 337
125 3300049588 Ga0501072_0079621 Ga0501072_0079621_662_1675 337
126 3300049588 Ga0501072_0086330 Ga0501072_0086330_1190_2203 337
127 3300049591 Ga0501075_0016946 Ga0501075_0016946_2381_3394 337
128 3300049591 Ga0501075_0051721 Ga0501075_0051721_1977_2990 337
129 3300049592 Ga0501076_0022856 Ga0501076_0022856_556_1569 337
130 3300049592 Ga0501076_0066226 Ga0501076_0066226_104_1117 337
131 3300049592 Ga0501076_0089652 Ga0501076_0089652_718_1731 337
132 3300049592 Ga0501076_0278896 Ga0501076_0278896_274_1287 337
133 3300049593 Ga0501077_0004036 Ga0501077_0004036_5304_6317 337
134 3300049593 Ga0501077_0047491 Ga0501077_0047491_192_1205 337
135 3300049741 Ga0501079_0007317 Ga0501079_0007317_4892_5905 337
136 3300049743 Ga0501081_0007157 Ga0501081_0007157_4894_5907 337
137 3300049743 Ga0501081_0081984 Ga0501081_0081984_494_1507 337
138 3300049744 Ga0501083_0121676 Ga0501083_0121676_629_1642 337
139 3300049824 Ga0501045_0050660 Ga0501045_0050660_662_1675 337
140 3300050507 nmdc:mga05p37_370946_c1 nmdc:mga05p37_370946_c1_95_1108 337
141 3300050507 nmdc:mga05p37_413398_c1 nmdc:mga05p37_413398_c1_15_1031 337
142 3300050507 nmdc:mga05p37_482301_c1 nmdc:mga05p37_482301_c1_273_1286 337
143 3300050507 nmdc:mga05p37_6_c1 nmdc:mga05p37_6_c1_49155_50171 337
144 3300050507 nmdc:mga05p37_9160_c1 nmdc:mga05p37_9160_c1_9428_10441 337
145 3300050507 nmdc:mga05p37_993_c1 nmdc:mga05p37_993_c1_30989_32005 337
146 3300050508 nmdc:mga09592_123933_c1 nmdc:mga09592_123933_c1_1136_2149 337
147 3300050508 nmdc:mga09592_150519_c1 nmdc:mga09592_150519_c1_901_1914 337
148 3300050508 nmdc:mga09592_9165_c1 nmdc:mga09592_9165_c1_3265_4281 337
149 3300050509 nmdc:mga0qj67_23382_c1 nmdc:mga0qj67_23382_c1_1205_2218 337
150 3300050509 nmdc:mga0qj67_42504_c1 nmdc:mga0qj67_42504_c1_150_1163 337
151 3300050509 nmdc:mga0qj67_9768_c1 nmdc:mga0qj67_9768_c1_4542_5555 337
152 3300050510 nmdc:mga06r32_1033_c1 nmdc:mga06r32_1033_c1_19543_20556 337
153 3300050510 nmdc:mga06r32_13475_c1 nmdc:mga06r32_13475_c1_749_1762 337
154 3300050510 nmdc:mga06r32_35934_c1 nmdc:mga06r32_35934_c1_3571_4584 337
155 3300050511 nmdc:mga08y16_36472_c1 nmdc:mga08y16_36472_c1_3461_4474 337
156 3300050512 nmdc:mga0n895_100_c1 nmdc:mga0n895_100_c1_49471_50487 337
157 3300050512 nmdc:mga0n895_412750_c1 nmdc:mga0n895_412750_c1_171_1184 337
158 3300050512 nmdc:mga0n895_461846_c1 nmdc:mga0n895_461846_c1_146_1159 337
159 3300050513 nmdc:mga0rr50_332_c1 nmdc:mga0rr50_332_c1_20477_21493 337
160 3300050514 nmdc:mga08x19_1054_c1 nmdc:mga08x19_1054_c1_9700_10716 337
161 3300050515 nmdc:mga0a205_147487_c1 nmdc:mga0a205_147487_c1_392_1405 337
162 3300050515 nmdc:mga0a205_288_c1 nmdc:mga0a205_288_c1_13476_14492 337
163 3300050515 nmdc:mga0a205_61696_c1 nmdc:mga0a205_61696_c1_2190_3203 337
164 3300054114 Ga0501084_0002783 Ga0501084_0002783_10598_11611 337
165 3300054114 Ga0501084_0165364 Ga0501084_0165364_240_1253 337
166 3300060353 Ga0501082_0112021 Ga0501082_0112021_54_1067 337
167 3300060353 Ga0501082_0119333 Ga0501082_0119333_850_1863 337
168 3300061734 Ga0530510_0001605 Ga0530510_0001605_5006_6019 337
169 3300061734 Ga0530510_0016525 Ga0530510_0016525_409_1422 337
170 3300006846 Ga0075430_100121292 Ga0075430_1001212924 341
171 3300006847 Ga0075431_100012068 Ga0075431_1000120682 341
172 3300006880 Ga0075429_100016754 Ga0075429_1000167543 341
173 3300027526 Ga0209968_1006255 Ga0209968_10062552 341
174 3300005406 Ga0070703_10069842 Ga0070703_100698421 342
175 3300005440 Ga0070705_100037908 Ga0070705_1000379084 342
176 3300005440 Ga0070705_100150915 Ga0070705_1001509151 342
177 3300005518 Ga0070699_100379287 Ga0070699_1003792872 342
178 3300006846 Ga0075430_100004920 Ga0075430_1000049204 342
179 3300006880 Ga0075429_100109503 Ga0075429_1001095032 342
180 3300027671 Ga0209588_1038135 Ga0209588_10381352 342
181 3300005468 Ga0070707_100002799 Ga0070707_1000027996 344
182 3300005536 Ga0070697_100002227 Ga0070697_1000022275 344
183 3300009147 Ga0114129_10112417 Ga0114129_101124172 348
184 3300049591 Ga0501075_0112709 Ga0501075_0112709_102_1157 348
185 3300049592 Ga0501076_0022875 Ga0501076_0022875_2709_3764 348
186 3300049743 Ga0501081_0028965 Ga0501081_0028965_1001_2056 348
187 3300049824 Ga0501045_0044043 Ga0501045_0044043_2104_3150 348
188 3300054114 Ga0501084_0055645 Ga0501084_0055645_789_1844 348
189 3300054114 Ga0501084_0109723 Ga0501084_0109723_1126_2172 348
190 3300005295 Ga0065707_10169639 Ga0065707_101696391 349
191 3300005328 Ga0070676_10001256 Ga0070676_100012565 349
192 3300005331 Ga0070670_100016104 Ga0070670_1000161044 349
193 3300005334 Ga0068869_100004836 Ga0068869_1000048367 349
194 3300005336 Ga0070680_100000237 Ga0070680_1000002378 349
195 3300005337 Ga0070682_100002243 Ga0070682_1000022436 349
196 3300005338 Ga0068868_100237605 Ga0068868_1002376052 349
197 3300005339 Ga0070660_100001295 Ga0070660_1000012956 349
198 3300005340 Ga0070689_100217327 Ga0070689_1002173272 349
199 3300005341 Ga0070691_10052172 Ga0070691_100521722 349
200 3300005343 Ga0070687_100048480 Ga0070687_1000484803 349
201 3300005344 Ga0070661_100002504 Ga0070661_1000025049 349
202 3300005345 Ga0070692_10001216 Ga0070692_100012166 349
203 3300005354 Ga0070675_100472395 Ga0070675_1004723951 349
204 3300005364 Ga0070673_100043524 Ga0070673_1000435246 349
205 3300005366 Ga0070659_100010671 Ga0070659_1000106715 349
206 3300005367 Ga0070667_100102329 Ga0070667_1001023293 349
207 3300005439 Ga0070711_100030553 Ga0070711_1000305532 349
208 3300005440 Ga0070705_100001967 Ga0070705_1000019672 349
209 3300005440 Ga0070705_100028220 Ga0070705_1000282202 349
210 3300005440 Ga0070705_100122671 Ga0070705_1001226712 349
211 3300005441 Ga0070700_100047226 Ga0070700_1000472262 349
212 3300005444 Ga0070694_100020678 Ga0070694_1000206785 349
213 3300005444 Ga0070694_100044173 Ga0070694_1000441733 349
214 3300005444 Ga0070694_100075068 Ga0070694_1000750683 349
215 3300005445 Ga0070708_100011486 Ga0070708_1000114868 349
216 3300005445 Ga0070708_100012472 Ga0070708_1000124723 349
217 3300005445 Ga0070708_100023401 Ga0070708_1000234015 349
218 3300005445 Ga0070708_100029999 Ga0070708_1000299993 349
219 3300005445 Ga0070708_100173295 Ga0070708_1001732951 349
220 3300005445 Ga0070708_100346657 Ga0070708_1003466572 349
221 3300005455 Ga0070663_100002646 Ga0070663_10000264611 349
222 3300005457 Ga0070662_100073826 Ga0070662_1000738262 349
223 3300005458 Ga0070681_10028922 Ga0070681_100289228 349
224 3300005459 Ga0068867_100046086 Ga0068867_1000460862 349
225 3300005467 Ga0070706_100004678 Ga0070706_10000467813 349
226 3300005467 Ga0070706_100017418 Ga0070706_1000174183 349
227 3300005467 Ga0070706_100175774 Ga0070706_1001757743 349
228 3300005467 Ga0070706_100221875 Ga0070706_1002218752 349
229 3300005468 Ga0070707_100011047 Ga0070707_1000110479 349
230 3300005468 Ga0070707_100038604 Ga0070707_1000386044 349
231 3300005468 Ga0070707_100048281 Ga0070707_1000482814 349
232 3300005468 Ga0070707_100361273 Ga0070707_1003612732 349
233 3300005468 Ga0070707_100454104 Ga0070707_1004541041 349
234 3300005471 Ga0070698_100049745 Ga0070698_1000497453 349
235 3300005471 Ga0070698_100285225 Ga0070698_1002852252 349
236 3300005471 Ga0070698_100368822 Ga0070698_1003688221 349
237 3300005518 Ga0070699_100008828 Ga0070699_1000088289 349
238 3300005518 Ga0070699_100018888 Ga0070699_1000188888 349
239 3300005518 Ga0070699_100086327 Ga0070699_1000863274 349
240 3300005518 Ga0070699_100096716 Ga0070699_1000967163 349
241 3300005518 Ga0070699_100298250 Ga0070699_1002982502 349
242 3300005530 Ga0070679_100148206 Ga0070679_1001482063 349
243 3300005535 Ga0070684_100081758 Ga0070684_1000817582 349
244 3300005536 Ga0070697_100011418 Ga0070697_1000114186 349
245 3300005536 Ga0070697_100050831 Ga0070697_1000508312 349
246 3300005536 Ga0070697_100102508 Ga0070697_1001025082 349
247 3300005536 Ga0070697_100287942 Ga0070697_1002879422 349
248 3300005539 Ga0068853_100002255 Ga0068853_1000022556 349
249 3300005545 Ga0070695_100000858 Ga0070695_1000008588 349
250 3300005545 Ga0070695_100003453 Ga0070695_1000034538 349
251 3300005545 Ga0070695_100146215 Ga0070695_1001462152 349
252 3300005546 Ga0070696_100004579 Ga0070696_1000045799 349
253 3300005546 Ga0070696_100012332 Ga0070696_1000123323 349
254 3300005546 Ga0070696_100044766 Ga0070696_1000447662 349
255 3300005547 Ga0070693_100002327 Ga0070693_10000232710 349
256 3300005549 Ga0070704_100016469 Ga0070704_1000164695 349
257 3300005549 Ga0070704_100098120 Ga0070704_1000981202 349
258 3300005549 Ga0070704_100219637 Ga0070704_1002196372 349
259 3300005549 Ga0070704_100369903 Ga0070704_1003699031 349
260 3300005563 Ga0068855_100004031 Ga0068855_1000040316 349
261 3300005564 Ga0070664_100031121 Ga0070664_1000311214 349
262 3300005578 Ga0068854_100064425 Ga0068854_1000644252 349
263 3300005614 Ga0068856_100008990 Ga0068856_1000089906 349
264 3300005617 Ga0068859_100008722 Ga0068859_1000087228 349
265 3300005617 Ga0068859_100079983 Ga0068859_1000799833 349
266 3300005617 Ga0068859_100158282 Ga0068859_1001582822 349
267 3300005618 Ga0068864_100010577 Ga0068864_1000105777 349
268 3300005618 Ga0068864_100106221 Ga0068864_1001062212 349
269 3300005840 Ga0068870_10001889 Ga0068870_100018898 349
270 3300005841 Ga0068863_100018304 Ga0068863_1000183047 349
271 3300005842 Ga0068858_100500783 Ga0068858_1005007831 349
272 3300005843 Ga0068860_100004791 Ga0068860_1000047918 349
273 3300005843 Ga0068860_100144223 Ga0068860_1001442232 349
274 3300005844 Ga0068862_100000665 Ga0068862_10000066522 349
275 3300005844 Ga0068862_100026458 Ga0068862_1000264585 349
276 3300005844 Ga0068862_100030919 Ga0068862_1000309195 349
277 3300005937 Ga0081455_10000114 Ga0081455_1000011453 349
278 3300005983 Ga0081540_1019651 Ga0081540_10196513 349
279 3300006175 Ga0070712_100007586 Ga0070712_1000075862 349
280 3300006844 Ga0075428_100000032 Ga0075428_10000003234 349
281 3300006844 Ga0075428_100112625 Ga0075428_1001126254 349
282 3300006844 Ga0075428_100306921 Ga0075428_1003069212 349
283 3300006846 Ga0075430_100000002 Ga0075430_10000000220 349
284 3300006846 Ga0075430_100002131 Ga0075430_10000213116 349
285 3300006846 Ga0075430_100003919 Ga0075430_10000391910 349
286 3300006846 Ga0075430_100007458 Ga0075430_1000074585 349
287 3300006846 Ga0075430_100054130 Ga0075430_1000541305 349
288 3300006847 Ga0075431_100000537 Ga0075431_1000005376 349
289 3300006847 Ga0075431_100002652 Ga0075431_10000265210 349
290 3300006847 Ga0075431_100003776 Ga0075431_10000377615 349
291 3300006847 Ga0075431_100016065 Ga0075431_1000160656 349
292 3300006847 Ga0075431_100275248 Ga0075431_1002752482 349
293 3300006852 Ga0075433_10000136 Ga0075433_1000013625 349
294 3300006852 Ga0075433_10010662 Ga0075433_100106627 349
295 3300006852 Ga0075433_10021537 Ga0075433_100215375 349
296 3300006852 Ga0075433_10087391 Ga0075433_100873913 349
297 3300006852 Ga0075433_10096599 Ga0075433_100965992 349
298 3300006852 Ga0075433_10170973 Ga0075433_101709732 349
299 3300006871 Ga0075434_100000093 Ga0075434_10000009311 349
300 3300006871 Ga0075434_100005272 Ga0075434_1000052725 349
301 3300006871 Ga0075434_100025078 Ga0075434_1000250782 349
302 3300006871 Ga0075434_100049912 Ga0075434_1000499122 349
303 3300006871 Ga0075434_100126370 Ga0075434_1001263702 349
304 3300006880 Ga0075429_100000032 Ga0075429_10000003269 349
305 3300006880 Ga0075429_100001393 Ga0075429_1000013937 349
306 3300006880 Ga0075429_100013242 Ga0075429_1000132423 349
307 3300006880 Ga0075429_100039128 Ga0075429_1000391283 349
308 3300006880 Ga0075429_100050179 Ga0075429_1000501792 349
309 3300006914 Ga0075436_100059751 Ga0075436_1000597512 349
310 3300006914 Ga0075436_100111841 Ga0075436_1001118412 349
311 3300006931 Ga0097620_100008722 Ga0097620_1000087228 349
312 3300006931 Ga0097620_100079988 Ga0097620_1000799883 349
313 3300006931 Ga0097620_100158293 Ga0097620_1001582932 349
314 3300007076 Ga0075435_100002967 Ga0075435_1000029675 349
315 3300007076 Ga0075435_100015016 Ga0075435_1000150167 349
316 3300007076 Ga0075435_100058766 Ga0075435_1000587663 349
317 3300007076 Ga0075435_100091220 Ga0075435_1000912202 349
318 3300007076 Ga0075435_100228451 Ga0075435_1002284512 349
319 3300007265 Ga0099794_10014995 Ga0099794_100149953 349
320 3300009094 Ga0111539_10000726 Ga0111539_1000072633 349
321 3300009147 Ga0114129_10001856 Ga0114129_1000185610 349
322 3300009147 Ga0114129_10008446 Ga0114129_100084468 349
323 3300009147 Ga0114129_10011871 Ga0114129_100118715 349
324 3300009147 Ga0114129_10013604 Ga0114129_100136044 349
325 3300009147 Ga0114129_10021871 Ga0114129_1002187110 349
326 3300009147 Ga0114129_10053499 Ga0114129_100534992 349
327 3300009147 Ga0114129_10060361 Ga0114129_100603616 349
328 3300009147 Ga0114129_10170465 Ga0114129_101704651 349
329 3300009147 Ga0114129_10179629 Ga0114129_101796294 349
330 3300009147 Ga0114129_10229947 Ga0114129_102299472 349
331 3300009174 Ga0105241_10002768 Ga0105241_100027682 349
332 3300009177 Ga0105248_10308810 Ga0105248_103088102 349
333 3300009553 Ga0105249_10005712 Ga0105249_1000571210 349
334 3300009553 Ga0105249_10189600 Ga0105249_101896002 349
335 3300013100 Ga0157373_10000572 Ga0157373_1000057212 349
336 3300013307 Ga0157372_10001744 Ga0157372_100017443 349
337 3300014325 Ga0163163_10069938 Ga0163163_100699382 349
338 3300014326 Ga0157380_10108620 Ga0157380_101086202 349
339 3300014326 Ga0157380_10188830 Ga0157380_101888302 349
340 3300015262 Ga0182007_10033479 Ga0182007_100334791 349
341 3300025905 Ga0207685_10071177 Ga0207685_100711771 349
342 3300025907 Ga0207645_10003905 Ga0207645_1000390513 349
343 3300025908 Ga0207643_10000283 Ga0207643_1000028338 349
344 3300025910 Ga0207684_10004913 Ga0207684_1000491312 349
345 3300025910 Ga0207684_10016507 Ga0207684_100165076 349
346 3300025910 Ga0207684_10018537 Ga0207684_100185375 349
347 3300025910 Ga0207684_10055473 Ga0207684_100554732 349
348 3300025910 Ga0207684_10221288 Ga0207684_102212882 349
349 3300025910 Ga0207684_10237538 Ga0207684_102375381 349
350 3300025911 Ga0207654_10004224 Ga0207654_100042245 349
351 3300025912 Ga0207707_10012113 Ga0207707_100121137 349
352 3300025912 Ga0207707_10261679 Ga0207707_102616792 349
353 3300025915 Ga0207693_10011555 Ga0207693_100115553 349
354 3300025916 Ga0207663_10216279 Ga0207663_102162792 349
355 3300025917 Ga0207660_10001251 Ga0207660_100012516 349
356 3300025918 Ga0207662_10054087 Ga0207662_100540872 349
357 3300025919 Ga0207657_10005032 Ga0207657_1000503215 349
358 3300025921 Ga0207652_10005011 Ga0207652_1000501112 349
359 3300025921 Ga0207652_10081493 Ga0207652_100814932 349
360 3300025922 Ga0207646_10006783 Ga0207646_100067836 349
361 3300025922 Ga0207646_10008978 Ga0207646_100089789 349
362 3300025922 Ga0207646_10011801 Ga0207646_100118013 349
363 3300025922 Ga0207646_10017508 Ga0207646_100175084 349
364 3300025922 Ga0207646_10029676 Ga0207646_100296761 349
365 3300025922 Ga0207646_10051620 Ga0207646_100516203 349
366 3300025922 Ga0207646_10365979 Ga0207646_103659792 349
367 3300025932 Ga0207690_10005380 Ga0207690_100053803 349
368 3300025933 Ga0207706_10002858 Ga0207706_1000285814 349
369 3300025936 Ga0207670_10018346 Ga0207670_100183465 349
370 3300025939 Ga0207665_10167609 Ga0207665_101676091 349
371 3300025942 Ga0207689_10000328 Ga0207689_1000032831 349
372 3300025942 Ga0207689_10009115 Ga0207689_100091154 349
373 3300025945 Ga0207679_10000903 Ga0207679_1000090320 349
374 3300025949 Ga0207667_10007787 Ga0207667_1000778711 349
375 3300025961 Ga0207712_10047442 Ga0207712_100474422 349
376 3300025981 Ga0207640_10004657 Ga0207640_100046576 349
377 3300026035 Ga0207703_10431074 Ga0207703_104310741 349
378 3300026041 Ga0207639_10032733 Ga0207639_100327335 349
379 3300026067 Ga0207678_10002453 Ga0207678_100024535 349
380 3300026078 Ga0207702_10052775 Ga0207702_100527755 349
381 3300026088 Ga0207641_10099604 Ga0207641_100996042 349
382 3300026088 Ga0207641_10180008 Ga0207641_101800082 349
383 3300026089 Ga0207648_10034939 Ga0207648_100349394 349
384 3300026095 Ga0207676_10023411 Ga0207676_100234114 349
385 3300026116 Ga0207674_10004521 Ga0207674_1000452114 349
386 3300026118 Ga0207675_100001634 Ga0207675_10000163412 349
387 3300026118 Ga0207675_100100581 Ga0207675_1001005813 349
388 3300027360 Ga0209969_1004934 Ga0209969_10049342 349
389 3300027462 Ga0210000_1009662 Ga0210000_10096622 349
390 3300027471 Ga0209995_1002725 Ga0209995_10027254 349
391 3300027526 Ga0209968_1004848 Ga0209968_10048482 349
392 3300027543 Ga0209999_1000788 Ga0209999_10007887 349
393 3300027552 Ga0209982_1001249 Ga0209982_10012492 349
394 3300027617 Ga0210002_1001388 Ga0210002_10013885 349
395 3300027665 Ga0209983_1000444 Ga0209983_10004446 349
396 3300027682 Ga0209971_1000126 Ga0209971_100012617 349
397 3300027695 Ga0209966_1000075 Ga0209966_100007517 349
398 3300027717 Ga0209998_10000010 Ga0209998_100000103 349
399 3300027876 Ga0209974_10001148 Ga0209974_100011486 349
400 3300027907 Ga0207428_10000227 Ga0207428_1000022723 349
401 3300027907 Ga0207428_10000945 Ga0207428_1000094524 349
402 3300027907 Ga0207428_10074470 Ga0207428_100744702 349
403 3300028380 Ga0268265_10012400 Ga0268265_100124007 349
404 3300028380 Ga0268265_10019949 Ga0268265_100199493 349
405 3300028380 Ga0268265_10031443 Ga0268265_100314432 349
406 3300028380 Ga0268265_10031461 Ga0268265_100314611 349
407 3300028381 Ga0268264_10360872 Ga0268264_103608721 349
408 3300031548 Ga0307408_100058310 Ga0307408_1000583102 349
409 3300032002 Ga0307416_100024357 Ga0307416_1000243572 349
410 3300032005 Ga0307411_10248900 Ga0307411_102489002 349
411 3300034816 Ga0373930_0018160 Ga0373930_0018160_31_1095 349
412 3300035088 Ga0373940_0008152 Ga0373940_0008152_819_1874 349
413 3300035090 Ga0373949_0014970 Ga0373949_0014970_603_1667 349
414 3300035114 Ga0373939_0027558 Ga0373939_0027558_66_1121 349
415 3300035115 Ga0373941_0005411 Ga0373941_0005411_1623_2687 349
416 3300035691 Ga0373931_0005118 Ga0373931_0005118_408_1472 349
417 3300035691 Ga0373931_0039258 Ga0373931_0039258_1103_2158 349
418 3300037418 Ga0395900_0008828 Ga0395900_0008828_4189_5253 349
419 3300037466 Ga0395898_0002138 Ga0395898_0002138_14648_15712 349
420 3300038443 Ga0395901_0006593 Ga0395901_0006593_6228_7292 349
421 3300042144 Ga0450889_001865 Ga0450889_001865_627_1676 349
422 3300042157 Ga0439458_0013117 Ga0439458_0013117_791_1840 349
423 3300042876 Ga0451577_0052792 Ga0451577_0052792_1603_2658 349
424 3300044673 Ga0453683_0077121 Ga0453683_0077121_612_1661 349
425 3300044712 Ga0453684_0010464 Ga0453684_0010464_3005_4054 349
426 3300045051 Ga0451576_0070015 Ga0451576_0070015_2267_3316 349
427 3300045051 Ga0451576_0088568 Ga0451576_0088568_1729_2793 349
428 3300046455 Ga0495603_0082677 Ga0495603_0082677_39_1094 349
429 3300046472 Ga0495580_0000361 Ga0495580_0000361_20849_21904 349
430 3300046664 Ga0495659_0042698 Ga0495659_0042698_312_1361 349
431 3300046664 Ga0495659_0067547 Ga0495659_0067547_189_1238 349
432 3300046664 Ga0495659_0070496 Ga0495659_0070496_97_1161 349
433 3300046684 Ga0495669_0027022 Ga0495669_0027022_889_1944 349
434 3300048905 Ga0496102_0006692 Ga0496102_0006692_4862_5926 349
435 3300048905 Ga0496102_0062777 Ga0496102_0062777_968_2017 349
436 3300048910 Ga0496107_0192145 Ga0496107_0192145_295_1359 349
437 3300048913 Ga0496110_0400704 Ga0496110_0400704_85_1134 349
438 3300049572 Ga0501036_0071558 Ga0501036_0071558_1177_2235 349
439 3300049574 Ga0501038_0186733 Ga0501038_0186733_210_1286 349
440 3300049575 Ga0501039_0056907 Ga0501039_0056907_1854_2903 349
441 3300049575 Ga0501039_0167026 Ga0501039_0167026_408_1472 349
442 3300049575 Ga0501039_0315408 Ga0501039_0315408_99_1157 349
443 3300049576 Ga0501040_0001146 Ga0501040_0001146_1833_2882 349
444 3300049576 Ga0501040_0024458 Ga0501040_0024458_1598_2662 349
445 3300049576 Ga0501040_0041424 Ga0501040_0041424_1314_2375 349
446 3300049576 Ga0501040_0047595 Ga0501040_0047595_347_1423 349
447 3300049577 Ga0501041_0004412 Ga0501041_0004412_3830_4894 349
448 3300049577 Ga0501041_0004465 Ga0501041_0004465_1341_2399 349
449 3300049577 Ga0501041_0007240 Ga0501041_0007240_1553_2602 349
450 3300049577 Ga0501041_0148156 Ga0501041_0148156_46_1110 349
451 3300049578 Ga0501042_0035161 Ga0501042_0035161_721_1785 349
452 3300049578 Ga0501042_0037194 Ga0501042_0037194_1462_2511 349
453 3300049578 Ga0501042_0239257 Ga0501042_0239257_191_1240 349
454 3300049579 Ga0501043_0067700 Ga0501043_0067700_1227_2276 349
455 3300049580 Ga0501046_0000938 Ga0501046_0000938_21211_22260 349
456 3300049580 Ga0501046_0005998 Ga0501046_0005998_8581_9645 349
457 3300049582 Ga0501048_0045568 Ga0501048_0045568_616_1680 349
458 3300049582 Ga0501048_0054178 Ga0501048_0054178_361_1410 349
459 3300049582 Ga0501048_0102300 Ga0501048_0102300_202_1260 349
460 3300049582 Ga0501048_0120635 Ga0501048_0120635_691_1755 349
461 3300049583 Ga0501067_0077515 Ga0501067_0077515_31_1080 349
462 3300049584 Ga0501068_0015791 Ga0501068_0015791_1171_2229 349
463 3300049584 Ga0501068_0045853 Ga0501068_0045853_534_1598 349
464 3300049585 Ga0501069_0013257 Ga0501069_0013257_420_1484 349
465 3300049587 Ga0501071_0058582 Ga0501071_0058582_1406_2482 349
466 3300049588 Ga0501072_0004554 Ga0501072_0004554_5079_6143 349
467 3300049588 Ga0501072_0006397 Ga0501072_0006397_2342_3406 349
468 3300049588 Ga0501072_0034378 Ga0501072_0034378_1242_2291 349
469 3300049588 Ga0501072_0062992 Ga0501072_0062992_1289_2353 349
470 3300049588 Ga0501072_0079417 Ga0501072_0079417_1386_2450 349
471 3300049589 Ga0501073_0136547 Ga0501073_0136547_36_1112 349
472 3300049590 Ga0501074_0010058 Ga0501074_0010058_3209_4273 349
473 3300049590 Ga0501074_0066746 Ga0501074_0066746_311_1360 349
474 3300049590 Ga0501074_0152095 Ga0501074_0152095_136_1185 349
475 3300049591 Ga0501075_0007589 Ga0501075_0007589_4840_5904 349
476 3300049591 Ga0501075_0014105 Ga0501075_0014105_505_1554 349
477 3300049591 Ga0501075_0023772 Ga0501075_0023772_30_1088 349
478 3300049591 Ga0501075_0026685 Ga0501075_0026685_759_1823 349
479 3300049591 Ga0501075_0031248 Ga0501075_0031248_12_1088 349
480 3300049591 Ga0501075_0041488 Ga0501075_0041488_2201_3265 349
481 3300049591 Ga0501075_0057956 Ga0501075_0057956_644_1711 349
482 3300049591 Ga0501075_0058872 Ga0501075_0058872_433_1482 349
483 3300049591 Ga0501075_0111503 Ga0501075_0111503_890_1954 349
484 3300049592 Ga0501076_0000430 Ga0501076_0000430_22182_23240 349
485 3300049592 Ga0501076_0030586 Ga0501076_0030586_1585_2649 349
486 3300049592 Ga0501076_0061154 Ga0501076_0061154_1751_2800 349
487 3300049592 Ga0501076_0069156 Ga0501076_0069156_1574_2650 349
488 3300049592 Ga0501076_0379590 Ga0501076_0379590_51_1100 349
489 3300049593 Ga0501077_0017229 Ga0501077_0017229_2604_3653 349
490 3300049593 Ga0501077_0032794 Ga0501077_0032794_1085_2143 349
491 3300049593 Ga0501077_0034040 Ga0501077_0034040_1044_2120 349
492 3300049593 Ga0501077_0156568 Ga0501077_0156568_385_1434 349
493 3300049741 Ga0501079_0005805 Ga0501079_0005805_5471_6535 349
494 3300049741 Ga0501079_0006004 Ga0501079_0006004_3761_4810 349
495 3300049741 Ga0501079_0009622 Ga0501079_0009622_1405_2454 349
496 3300049741 Ga0501079_0044376 Ga0501079_0044376_1174_2232 349
497 3300049741 Ga0501079_0160427 Ga0501079_0160427_287_1363 349
498 3300049742 Ga0501080_0059531 Ga0501080_0059531_1834_2883 349
499 3300049742 Ga0501080_0151505 Ga0501080_0151505_10_1068 349
500 3300049743 Ga0501081_0006334 Ga0501081_0006334_6463_7521 349
501 3300049743 Ga0501081_0006944 Ga0501081_0006944_4829_5893 349
502 3300049743 Ga0501081_0010338 Ga0501081_0010338_1495_2544 349
503 3300049743 Ga0501081_0283477 Ga0501081_0283477_25_1089 349
504 3300049744 Ga0501083_0026077 Ga0501083_0026077_1432_2496 349
505 3300049824 Ga0501045_0000499 Ga0501045_0000499_15857_16906 349
506 3300049824 Ga0501045_0020371 Ga0501045_0020371_543_1607 349
507 3300049824 Ga0501045_0248185 Ga0501045_0248185_39_1103 349
508 3300050507 nmdc:mga05p37_12088_c1 nmdc:mga05p37_12088_c1_5939_7003 349
509 3300050507 nmdc:mga05p37_158981_c1 nmdc:mga05p37_158981_c1_1195_2244 349
510 3300050507 nmdc:mga05p37_178439_c1 nmdc:mga05p37_178439_c1_1035_2099 349
511 3300050507 nmdc:mga05p37_180055_c1 nmdc:mga05p37_180055_c1_584_1633 349
512 3300050507 nmdc:mga05p37_508968_c1 nmdc:mga05p37_508968_c1_73_1122 349
513 3300050507 nmdc:mga05p37_7581_c1 nmdc:mga05p37_7581_c1_4867_5919 349
514 3300050507 nmdc:mga05p37_8769_c1 nmdc:mga05p37_8769_c1_8204_9268 349
515 3300050508 nmdc:mga09592_1488_c1 nmdc:mga09592_1488_c1_597_1661 349
516 3300050508 nmdc:mga09592_15223_c1 nmdc:mga09592_15223_c1_4555_5607 349
517 3300050508 nmdc:mga09592_188890_c1 nmdc:mga09592_188890_c1_713_1768 349
518 3300050508 nmdc:mga09592_30733_c1 nmdc:mga09592_30733_c1_2825_3889 349
519 3300050509 nmdc:mga0qj67_187935_c1 nmdc:mga0qj67_187935_c1_386_1441 349
520 3300050509 nmdc:mga0qj67_2640_c1 nmdc:mga0qj67_2640_c1_3835_4899 349
521 3300050509 nmdc:mga0qj67_660_c1 nmdc:mga0qj67_660_c1_20874_21938 349
522 3300050510 nmdc:mga06r32_280190_c1 nmdc:mga06r32_280190_c1_487_1536 349
523 3300050510 nmdc:mga06r32_393_c1 nmdc:mga06r32_393_c1_4727_5776 349
524 3300050510 nmdc:mga06r32_580_c1 nmdc:mga06r32_580_c1_11793_12857 349
525 3300050510 nmdc:mga06r32_7251_c1 nmdc:mga06r32_7251_c1_3721_4785 349
526 3300050510 nmdc:mga06r32_73803_c1 nmdc:mga06r32_73803_c1_2004_3059 349
527 3300050512 nmdc:mga0n895_1076_c1 nmdc:mga0n895_1076_c1_9207_10256 349
528 3300050512 nmdc:mga0n895_13160_c1 nmdc:mga0n895_13160_c1_6037_7101 349
529 3300050512 nmdc:mga0n895_1643_c1 nmdc:mga0n895_1643_c1_3097_4149 349
530 3300050512 nmdc:mga0n895_22110_c1 nmdc:mga0n895_22110_c1_2818_3867 349
531 3300050512 nmdc:mga0n895_67212_c1 nmdc:mga0n895_67212_c1_579_1634 349
532 3300050513 nmdc:mga0rr50_15807_c1 nmdc:mga0rr50_15807_c1_1643_2698 349
533 3300050513 nmdc:mga0rr50_340776_c1 nmdc:mga0rr50_340776_c1_78_1133 349
534 3300050513 nmdc:mga0rr50_6554_c1 nmdc:mga0rr50_6554_c1_3679_4728 349
535 3300050515 nmdc:mga0a205_1101_c1 nmdc:mga0a205_1101_c1_20097_21146 349
536 3300050515 nmdc:mga0a205_151291_c1 nmdc:mga0a205_151291_c1_1078_2127 349
537 3300050515 nmdc:mga0a205_155298_c1 nmdc:mga0a205_155298_c1_140_1189 349
538 3300050515 nmdc:mga0a205_157139_c1 nmdc:mga0a205_157139_c1_943_2007 349
539 3300050515 nmdc:mga0a205_18888_c1 nmdc:mga0a205_18888_c1_579_1634 349
540 3300050515 nmdc:mga0a205_21692_c1 nmdc:mga0a205_21692_c1_4329_5381 349
541 3300050515 nmdc:mga0a205_66882_c1 nmdc:mga0a205_66882_c1_402_1451 349
542 3300054114 Ga0501084_0002157 Ga0501084_0002157_4157_5206 349
543 3300054114 Ga0501084_0006300 Ga0501084_0006300_4908_5957 349
544 3300054114 Ga0501084_0014318 Ga0501084_0014318_2881_3945 349
545 3300054114 Ga0501084_0036912 Ga0501084_0036912_1401_2459 349
546 3300054114 Ga0501084_0284643 Ga0501084_0284643_258_1322 349
547 3300060353 Ga0501082_0005462 Ga0501082_0005462_5463_6527 349
548 3300060353 Ga0501082_0011012 Ga0501082_0011012_2756_3805 349
549 3300060353 Ga0501082_0013371 Ga0501082_0013371_1200_2258 349
550 3300060353 Ga0501082_0088986 Ga0501082_0088986_46_1095 349
551 3300060353 Ga0501082_0220424 Ga0501082_0220424_238_1314 349
552 3300061734 Ga0530510_0006591 Ga0530510_0006591_5496_6560 349
553 3300061734 Ga0530510_0022820 Ga0530510_0022820_2020_3078 349
554 3300061734 Ga0530510_0042134 Ga0530510_0042134_1982_3058 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02774

Semialdhyde_dhC

Semialdehyde dehydrogenase, dimerisation domain

181

342

0.98

PF22698

Semialdhyde_dhC_1

Semialdehyde dehydrogenase, dimerisation domain

172

339

0.98

PF01118

Semialdhyde_dh

Semialdehyde dehydrogenase, NAD binding domain

25

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8afu-assembly2.cif.gz_A-2 daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9143 1 341
8afu-assembly2.cif.gz_B daargc - n-acetyl-gamma-glutamyl-phosphate reductase of denitrovibrio acetiphilus 0.9115 1 342
1vkn-assembly1.cif.gz_B crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9067 1 349
1xyg-assembly1.cif.gz_D x-ray structure of gene product from arabidopsis thaliana at2g19940 0.9061 2 349
1vkn-assembly1.cif.gz_C crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (tm1782) from thermotoga maritima at 1.80 a resolution 0.9059 1 349
ID Description Score Start End Superfamily
1vknA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 1 147 3.40.50.720
af_Q93Z70_59_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9237 3 146 3.40.50.720
af_Q2G1H4_5_166_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9175 6 165 3.40.50.720
2g17A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9105 2 148 3.40.50.720
af_Q2G1H4_2_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.91 3 148 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A538R4F2-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9879 2 167 GO:0003942
GO:0008652
GO:0051287
AF-A0A3D1NFJ0-F1-model_v4 deleted 0.977 2 166
AF-T0Z9Y6-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase 0.9733 1 166 GO:0003942
GO:0006526
GO:0051287
AF-A0A7X9AWL7-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9702 2 144 GO:0003942
GO:0006526
GO:0051287
AF-A0A7C0YP79-F1-model_v4 N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) 0.9681 1 166 GO:0003942
GO:0006526
GO:0051287

Feature Viewer

pLDDT pTM Quality
86.63 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map