F462948

General Info

Members Datasets Scaffolds Average Seq Length
554 285 554 165

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10236344|Ga0070666_102363441
Length 187
Sequence MQVVMGIDPGAANLGFGVVRVEGNRMVALDGGVVETGPEMPMERRLEKIHTALGELMAWHEPRALALEQVYFGRNVGSAMVVGQASGVAMLAAAQRGIPCTAYTPQAIKMAVCGSGAADKAQVQRMVGTLLGLPEPPTPDHAADALAVAICHGGGEGRRQAVAQSAGASTPSTAGPSKPRFAPRVAG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
257 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
279 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
280 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
281 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.33
Nodule 0
Rhizoplane 10.65
Rhizosphere 83.39
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000066 3300001977 Bacteria 10886
2 JGI24740J21852_10038891 3300001979 Bacteria 1456
3 JGI24751J29686_10080653 3300002459 Bacteria 674
4 JGI25407J50210_10104246 3300003373 Bacteria 700
5 Ga0070683_100006889 3300005329 Bacteria 9547
6 Ga0070683_100029530 3300005329 Bacteria 4965
7 Ga0070683_100040821 3300005329 Bacteria 4266
8 Ga0070683_100125663 3300005329 Bacteria 2425
9 Ga0070666_10236344 3300005335 Bacteria 1291
10 Ga0070682_100000011 3300005337 Bacteria 266253
11 Ga0070682_100000052 3300005337 Bacteria 118879
12 Ga0070682_100451150 3300005337 Bacteria 985
13 Ga0068868_100193814 3300005338 Bacteria 1691
14 Ga0070691_10000138 3300005341 Bacteria 22836
15 Ga0070661_100000058 3300005344 Bacteria 87363
16 Ga0070668_100011596 3300005347 Bacteria 6561
17 Ga0070668_100053864 3300005347 Bacteria 3102
18 Ga0070668_100296340 3300005347 Unclassified 1355
19 Ga0070675_100000036 3300005354 Bacteria 85959
20 Ga0070674_100012503 3300005356 Bacteria 5214
21 Ga0070688_100000228 3300005365 Bacteria 29601
22 Ga0070688_100000360 3300005365 Bacteria 23047
23 Ga0070688_100129950 3300005365 Bacteria 1698
24 Ga0070688_100215996 3300005365 Bacteria 1349
25 Ga0070659_100019249 3300005366 Bacteria 5169
26 Ga0070667_100001076 3300005367 Bacteria 24988
27 Ga0070667_100830801 3300005367 Unclassified 858
28 Ga0070709_10723285 3300005434 Bacteria 776
29 Ga0070714_100010661 3300005435 Bacteria 7271
30 Ga0070713_100000047 3300005436 Bacteria 76760
31 Ga0070713_100743614 3300005436 Bacteria 938
32 Ga0070701_10189878 3300005438 Bacteria 1208
33 Ga0070711_100036522 3300005439 Bacteria 3291
34 Ga0070711_100102386 3300005439 Bacteria 2086
35 Ga0070678_100696433 3300005456 Bacteria 915
36 Ga0070662_100000002 3300005457 Bacteria 253208
37 Ga0070681_10045866 3300005458 Bacteria 4371
38 Ga0068867_100002402 3300005459 Bacteria 13169
39 Ga0070685_10000019 3300005466 Bacteria 105881
40 Ga0070685_10000020 3300005466 Bacteria 104332
41 Ga0070685_10047925 3300005466 Bacteria 2459
42 Ga0070685_10076519 3300005466 Bacteria 1996
43 Ga0070684_100081124 3300005535 Bacteria 2870
44 Ga0070684_100119090 3300005535 Bacteria 2374
45 Ga0070684_100219769 3300005535 Bacteria 1733
46 Ga0070684_100228485 3300005535 Bacteria 1699
47 Ga0070684_100520933 3300005535 Bacteria 1102
48 Ga0070684_100920396 3300005535 Bacteria 819
49 Ga0068853_100320462 3300005539 Bacteria 1437
50 Ga0070672_100000001 3300005543 Bacteria 204624
51 Ga0070686_100237400 3300005544 Unclassified 1325
52 Ga0070693_100000470 3300005547 Bacteria 18108
53 Ga0070665_100028178 3300005548 Bacteria 5656
54 Ga0070665_100045460 3300005548 Bacteria 4409
55 Ga0070665_100107489 3300005548 Bacteria 2792
56 Ga0070665_100204160 3300005548 Bacteria 1977
57 Ga0070665_100242923 3300005548 Bacteria 1801
58 Ga0068855_100592659 3300005563 Bacteria 1196
59 Ga0070664_100293109 3300005564 Unclassified 1469
60 Ga0070664_100826209 3300005564 Unclassified 867
61 Ga0068856_100002498 3300005614 Bacteria 18913
62 Ga0068856_100013571 3300005614 Bacteria 7887
63 Ga0068852_100000002 3300005616 Bacteria 268221
64 Ga0068852_100579401 3300005616 Bacteria 1125
65 Ga0068859_100403446 3300005617 Bacteria 1463
66 Ga0068864_100000015 3300005618 Bacteria 303368
67 Ga0068866_10000003 3300005718 Bacteria 281675
68 Ga0068866_10849261 3300005718 Bacteria 638
69 Ga0068861_100142746 3300005719 Bacteria 1956
70 Ga0068851_10000730 3300005834 Bacteria 14041
71 Ga0068863_100000022 3300005841 Bacteria 188278
72 Ga0068858_100000118 3300005842 Bacteria 83359
73 Ga0068860_100004743 3300005843 Bacteria 13853
74 Ga0068860_100030106 3300005843 Bacteria 5221
75 Ga0068862_100023531 3300005844 Bacteria 5163
76 Ga0081455_10019712 3300005937 Bacteria 6370
77 Ga0081455_10126628 3300005937 Bacteria 2003
78 Ga0081455_10222993 3300005937 Bacteria 1396
79 Ga0081538_10000812 3300005981 Bacteria 33866
80 Ga0075365_10015429 3300006038 Bacteria 4623
81 Ga0075365_10057875 3300006038 Bacteria 2579
82 Ga0075365_10090699 3300006038 Bacteria 2082
83 Ga0075363_100029719 3300006048 Bacteria 2823
84 Ga0075363_100169532 3300006048 Bacteria 1239
85 Ga0075363_100226182 3300006048 Bacteria 1073
86 Ga0075364_10089117 3300006051 Bacteria 2046
87 Ga0075364_10223369 3300006051 Unclassified 1279
88 Ga0075364_10246715 3300006051 Bacteria 1213
89 Ga0070715_10000029 3300006163 Bacteria 88994
90 Ga0070715_10053407 3300006163 Bacteria 1746
91 Ga0070712_100079139 3300006175 Bacteria 2375
92 Ga0075367_10154694 3300006178 Bacteria 1424
93 Ga0075367_10471481 3300006178 Bacteria 796
94 Ga0068871_100146311 3300006358 Bacteria 2012
95 Ga0075428_100122655 3300006844 Bacteria 2829
96 Ga0075430_100128225 3300006846 Bacteria 2115
97 Ga0075431_100004050 3300006847 Bacteria 14282
98 Ga0075431_100288537 3300006847 Bacteria 1660
99 Ga0075433_10003354 3300006852 Bacteria 12382
100 Ga0075429_100848079 3300006880 Bacteria 800
101 Ga0068865_100174445 3300006881 Bacteria 1651
102 Ga0097620_100403477 3300006931 Bacteria 1463
103 Ga0105240_10246468 3300009093 Bacteria 2069
104 Ga0105240_11325785 3300009093 Bacteria 758
105 Ga0111539_10623848 3300009094 Bacteria 1255
106 Ga0105245_10000125 3300009098 Bacteria 73764
107 Ga0105245_10000517 3300009098 Bacteria 35353
108 Ga0105245_10006331 3300009098 Bacteria 10415
109 Ga0105247_10001978 3300009101 Bacteria 14224
110 Ga0105247_10362980 3300009101 Bacteria 1022
111 Ga0105247_10553414 3300009101 Bacteria 846
112 Ga0105247_10704565 3300009101 Bacteria 760
113 Ga0114129_10068282 3300009147 Bacteria 4956
114 Ga0114129_11161178 3300009147 Bacteria 964
115 Ga0105243_10028685 3300009148 Bacteria 4274
116 Ga0105243_10043619 3300009148 Bacteria 3515
117 Ga0105241_10317193 3300009174 Bacteria 1343
118 Ga0105242_10347093 3300009176 Bacteria 1370
119 Ga0105242_10744973 3300009176 Bacteria 964
120 Ga0105248_10000020 3300009177 Bacteria 284637
121 Ga0105248_10893919 3300009177 Unclassified 1003
122 Ga0105249_10000178 3300009553 Bacteria 74768
123 Ga0105249_10345303 3300009553 Bacteria 1506
124 Ga0105239_10528827 3300010375 Bacteria 1342
125 Ga0157369_10000307 3300013105 Bacteria 65486
126 Ga0157378_10010221 3300013297 Bacteria 8191
127 Ga0163162_10122210 3300013306 Bacteria 2709
128 Ga0163162_10755197 3300013306 Bacteria 1092
129 Ga0157372_10000053 3300013307 Bacteria 128824
130 Ga0157375_10090838 3300013308 Bacteria 3114
131 Ga0157375_10188698 3300013308 Bacteria 2216
132 Ga0163163_10308401 3300014325 Bacteria 1635
133 Ga0157380_10000016 3300014326 Bacteria 126029
134 Ga0157380_10000236 3300014326 Bacteria 33220
135 Ga0157380_10120059 3300014326 Bacteria 2225
136 Ga0157380_10777583 3300014326 Bacteria 972
137 Ga0157377_10127253 3300014745 Bacteria 1551
138 Ga0157379_10002058 3300014968 Bacteria 16705
139 Ga0157379_10019326 3300014968 Bacteria 6017
140 Ga0157379_10059769 3300014968 Bacteria 3408
141 Ga0157376_10020564 3300014969 Bacteria 5109
142 Ga0157376_10056242 3300014969 Bacteria 3286
143 Ga0163161_10000022 3300017792 Bacteria 207890
144 Ga0163161_10047839 3300017792 Bacteria 3088
145 Ga0206353_11016966 3300020082 Bacteria 2209
146 Ga0207682_10000155 3300025893 Bacteria 31180
147 Ga0207642_10000002 3300025899 Bacteria 658166
148 Ga0207710_10000821 3300025900 Bacteria 16775
149 Ga0207710_10320245 3300025900 Bacteria 786
150 Ga0207680_10095594 3300025903 Bacteria 1899
151 Ga0207680_10109162 3300025903 Bacteria 1791
152 Ga0207685_10000031 3300025905 Bacteria 77451
153 Ga0207685_10025723 3300025905 Bacteria 2036
154 Ga0207695_10188274 3300025913 Bacteria 1982
155 Ga0207695_10309585 3300025913 Bacteria 1469
156 Ga0207693_10069081 3300025915 Bacteria 2765
157 Ga0207663_10033961 3300025916 Bacteria 3045
158 Ga0207660_10062694 3300025917 Bacteria 2679
159 Ga0207649_10000283 3300025920 Bacteria 39628
160 Ga0207652_10003850 3300025921 Bacteria 12292
161 Ga0207659_10000013 3300025926 Bacteria 172742
162 Ga0207687_10000017 3300025927 Bacteria 237310
163 Ga0207687_10000085 3300025927 Bacteria 68919
164 Ga0207700_10000033 3300025928 Bacteria 123113
165 Ga0207664_10092298 3300025929 Bacteria 2485
166 Ga0207690_10185115 3300025932 Unclassified 1571
167 Ga0207706_10000001 3300025933 Bacteria 423014
168 Ga0207686_10001016 3300025934 Bacteria 16619
169 Ga0207686_10104065 3300025934 Bacteria 1901
170 Ga0207686_10126611 3300025934 Bacteria 1747
171 Ga0207709_10019598 3300025935 Bacteria 3808
172 Ga0207670_10005811 3300025936 Bacteria 6811
173 Ga0207669_10000001 3300025937 Bacteria 377747
174 Ga0207669_10318107 3300025937 Bacteria 1190
175 Ga0207665_10041758 3300025939 Bacteria 3065
176 Ga0207691_10000017 3300025940 Bacteria 134441
177 Ga0207711_10000006 3300025941 Bacteria 792692
178 Ga0207661_10000198 3300025944 Bacteria 39018
179 Ga0207661_10010942 3300025944 Bacteria 6551
180 Ga0207661_10029396 3300025944 Bacteria 4220
181 Ga0207661_10051438 3300025944 Bacteria 3287
182 Ga0207679_10057120 3300025945 Bacteria 2885
183 Ga0207667_11234283 3300025949 Bacteria 726
184 Ga0207712_10007734 3300025961 Bacteria 6796
185 Ga0207712_10255543 3300025961 Bacteria 1418
186 Ga0207668_10005384 3300025972 Bacteria 7532
187 Ga0207668_10062039 3300025972 Bacteria 2631
188 Ga0207668_10248905 3300025972 Unclassified 1442
189 Ga0207658_10003877 3300025986 Bacteria 10532
190 Ga0207658_10201760 3300025986 Bacteria 1661
191 Ga0207677_10000397 3300026023 Bacteria 29959
192 Ga0207703_10000061 3300026035 Bacteria 132671
193 Ga0207703_10766853 3300026035 Bacteria 920
194 Ga0207639_10012718 3300026041 Bacteria 5870
195 Ga0207639_10015804 3300026041 Bacteria 5329
196 Ga0207702_10000637 3300026078 Bacteria 38379
197 Ga0207702_10009958 3300026078 Bacteria 7970
198 Ga0207702_10018008 3300026078 Bacteria 5847
199 Ga0207702_10120669 3300026078 Bacteria 2346
200 Ga0207641_10000016 3300026088 Bacteria 307363
201 Ga0207641_10910115 3300026088 Bacteria 874
202 Ga0207648_10003501 3300026089 Bacteria 16446
203 Ga0207648_10680491 3300026089 Unclassified 952
204 Ga0207676_10000018 3300026095 Bacteria 306375
205 Ga0207676_10713111 3300026095 Bacteria 973
206 Ga0207675_100251659 3300026118 Bacteria 1710
207 Ga0207683_10027545 3300026121 Bacteria 4910
208 Ga0207683_10068028 3300026121 Bacteria 3143
209 Ga0207698_10000004 3300026142 Bacteria 313614
210 Ga0207698_10230458 3300026142 Bacteria 1681
211 Ga0268266_10000056 3300028379 Bacteria 289176
212 Ga0268266_10000601 3300028379 Bacteria 49250
213 Ga0268266_10001254 3300028379 Bacteria 31003
214 Ga0268266_10030794 3300028379 Bacteria 4557
215 Ga0268266_10196858 3300028379 Bacteria 1843
216 Ga0268266_10229242 3300028379 Bacteria 1710
217 Ga0268266_10265674 3300028379 Bacteria 1591
218 Ga0268265_10004453 3300028380 Bacteria 9721
219 Ga0268265_10687215 3300028380 Bacteria 987
220 Ga0268264_10002435 3300028381 Bacteria 16359
221 Ga0268264_10127452 3300028381 Bacteria 2252
222 Ga0265337_1000066 3300028556 Bacteria 48673
223 Ga0265326_10000019 3300028558 Bacteria 137370
224 Ga0265319_1000469 3300028563 Bacteria 28589
225 Ga0265334_10231623 3300028573 Unclassified 638
226 Ga0265322_10000011 3300028654 Bacteria 167597
227 Ga0265336_10020373 3300028666 Bacteria 2129
228 Ga0265338_10000244 3300028800 Bacteria 100528
229 Ga0265338_10223812 3300028800 Bacteria 1404
230 Ga0265324_10000283 3300029957 Bacteria 37587
231 Ga0265332_10018240 3300031238 Bacteria 3096
232 Ga0265328_10011111 3300031239 Bacteria 3605
233 Ga0265320_10000011 3300031240 Bacteria 249534
234 Ga0265325_10064475 3300031241 Bacteria 1852
235 Ga0265331_10000858 3300031250 Bacteria 24739
236 Ga0265331_10011583 3300031250 Bacteria 4824
237 Ga0265327_10000015 3300031251 Bacteria 496677
238 Ga0265316_10022934 3300031344 Bacteria 5252
239 Ga0265314_10003522 3300031711 Bacteria 15112
240 Ga0265342_10273785 3300031712 Bacteria 895
241 Ga0307409_100099008 3300031995 Bacteria 2413
242 Ga0307409_101559992 3300031995 Bacteria 688
243 Ga0307415_100017498 3300032126 Bacteria 4301
244 Ga0307415_100341209 3300032126 Bacteria 1257
245 Ga0373955_0278069 3300035172 Bacteria 1007
246 Ga0316574_0008333 3300035398 Bacteria 5752
247 Ga0316574_0066284 3300035398 Bacteria 2275
248 Ga0316574_0233038 3300035398 Bacteria 1178
249 Ga0373937_0013210 3300036401 Bacteria 7271
250 Ga0373937_0686503 3300036401 Bacteria 970
251 Ga0395901_0720252 3300038443 Bacteria 993
252 Ga0451793_1852320 3300041452 Unclassified 728
253 Ga0451807_0093928 3300041486 Bacteria 1245
254 Ga0451849_0264818 3300041505 Bacteria 1604
255 Ga0466960_0119260 3300044901 Bacteria 1380
256 Ga0466958_0023118 3300045836 Bacteria 3646
257 Ga0466967_0164558 3300045976 Bacteria 2084
258 Ga0466967_0731377 3300045976 Unclassified 981
259 Ga0466967_1427255 3300045976 Bacteria 689
260 Ga0495603_0004009 3300046455 Bacteria 8766
261 Ga0495629_0000487 3300046459 Bacteria 33176
262 Ga0495629_0013987 3300046459 Bacteria 5785
263 Ga0495629_0561095 3300046459 Bacteria 766
264 Ga0495638_0467004 3300046460 Bacteria 641
265 Ga0495641_0000005 3300046461 Bacteria 206626
266 Ga0495641_0010781 3300046461 Bacteria 5260
267 Ga0495641_0042190 3300046461 Bacteria 2116
268 Ga0495651_0520748 3300046462 Bacteria 759
269 Ga0495653_0048901 3300046463 Bacteria 3261
270 Ga0495653_0470652 3300046463 Bacteria 787
271 Ga0495582_0000001 3300046473 Bacteria 252434
272 Ga0495639_0265560 3300046475 Bacteria 851
273 Ga0495662_0000001 3300046476 Bacteria 179185
274 Ga0495662_0039759 3300046476 Bacteria 2272
275 Ga0495594_0229451 3300046499 Bacteria 1058
276 Ga0495606_0000040 3300046507 Bacteria 223500
277 Ga0495608_0000007 3300046511 Bacteria 313495
278 Ga0495608_0001804 3300046511 Bacteria 15293
279 Ga0495608_0185622 3300046511 Unclassified 1314
280 Ga0495608_0393053 3300046511 Unclassified 849
281 Ga0495618_0000014 3300046514 Bacteria 163136
282 Ga0495620_0001374 3300046515 Bacteria 14672
283 Ga0495628_0000859 3300046516 Bacteria 28076
284 Ga0495628_0011208 3300046516 Bacteria 7585
285 Ga0495628_0040772 3300046516 Bacteria 3709
286 Ga0495628_0164584 3300046516 Bacteria 1684
287 Ga0495628_0288887 3300046516 Bacteria 1216
288 Ga0495628_0293831 3300046516 Bacteria 1204
289 Ga0495628_0358590 3300046516 Bacteria 1071
290 Ga0495628_0504280 3300046516 Bacteria 873
291 Ga0495630_0000014 3300046517 Bacteria 217229
292 Ga0495630_0010638 3300046517 Bacteria 6642
293 Ga0495630_0141133 3300046517 Bacteria 1832
294 Ga0495630_0546115 3300046517 Bacteria 888
295 Ga0495644_0001062 3300046523 Bacteria 11440
296 Ga0495652_0000010 3300046529 Bacteria 261584
297 Ga0495652_0031927 3300046529 Bacteria 4609
298 Ga0495652_0328202 3300046529 Bacteria 1103
299 Ga0495640_0082037 3300046533 Bacteria 2143
300 Ga0495640_0260844 3300046533 Bacteria 1083
301 Ga0495586_0000083 3300046535 Bacteria 57851
302 Ga0495586_0136247 3300046535 Bacteria 1376
303 Ga0495586_0295726 3300046535 Bacteria 927
304 Ga0495587_0028775 3300046536 Bacteria 3376
305 Ga0495621_0001691 3300046539 Bacteria 5781
306 Ga0495645_0006168 3300046543 Bacteria 8300
307 Ga0495645_0016131 3300046543 Bacteria 5325
308 Ga0495622_0000218 3300046557 Bacteria 45469
309 Ga0495656_0000753 3300046615 Bacteria 10458
310 Ga0495668_0031092 3300046616 Bacteria 3009
311 Ga0495634_0002567 3300046642 Bacteria 14991
312 Ga0495634_0004632 3300046642 Bacteria 10731
313 Ga0495635_0000031 3300046663 Bacteria 110244
314 Ga0495635_0010132 3300046663 Bacteria 6592
315 Ga0495635_0083646 3300046663 Bacteria 2184
316 Ga0495635_0431862 3300046663 Bacteria 872
317 Ga0495588_0003659 3300046674 Bacteria 6725
318 Ga0495657_0000001 3300046675 Bacteria 445641
319 Ga0495657_0065142 3300046675 Bacteria 2397
320 Ga0495599_0015716 3300046678 Bacteria 4698
321 Ga0495623_0377639 3300046679 Unclassified 767
322 Ga0495646_0367887 3300046680 Bacteria 751
323 Ga0495647_0000001 3300046681 Bacteria 222371
324 Ga0495647_0005224 3300046681 Bacteria 4254
325 Ga0495647_0006447 3300046681 Bacteria 3885
326 Ga0495658_0000002 3300046683 Bacteria 309651
327 Ga0495658_0003808 3300046683 Bacteria 7472
328 Ga0495669_0000076 3300046684 Bacteria 65203
329 Ga0495669_0058551 3300046684 Bacteria 1739
330 Ga0495613_0000005 3300046689 Bacteria 222558
331 Ga0495613_0000041 3300046689 Bacteria 130784
332 Ga0495624_0000019 3300046690 Bacteria 102237
333 Ga0495624_0000286 3300046690 Bacteria 39940
334 Ga0495624_0055357 3300046690 Bacteria 2499
335 Ga0495649_0013634 3300046694 Bacteria 4684
336 Ga0495600_0005957 3300046809 Bacteria 7378
337 Ga0495600_0295586 3300046809 Bacteria 1023
338 Ga0495604_0000067 3300047317 Bacteria 90345
339 Ga0495604_0000239 3300047317 Bacteria 49113
340 Ga0495604_0022899 3300047317 Bacteria 4985
341 Ga0495604_0068381 3300047317 Bacteria 2696
342 Ga0495674_0002248 3300047319 Bacteria 18976
343 Ga0495674_0888685 3300047319 Bacteria 688
344 Ga0495676_0000238 3300047321 Bacteria 44160
345 Ga0495676_0001364 3300047321 Bacteria 21008
346 Ga0495676_0054980 3300047321 Bacteria 3160
347 Ga0495676_0403087 3300047321 Unclassified 907
348 Ga0495680_0000488 3300047322 Bacteria 44631
349 Ga0495680_0067441 3300047322 Bacteria 2736
350 Ga0495680_0097250 3300047322 Bacteria 2198
351 Ga0495680_0202624 3300047322 Bacteria 1423
352 Ga0495680_0328578 3300047322 Bacteria 1069
353 Ga0495675_0000300 3300047444 Bacteria 35530
354 Ga0495679_010122 3300047446 Bacteria 3724
355 Ga0495684_0144274 3300047471 Bacteria 1784
356 Ga0495684_0284698 3300047471 Bacteria 1191
357 Ga0495686_0592963 3300047472 Bacteria 575
358 Ga0495602_0000007 3300048088 Bacteria 273212
359 Ga0495602_0123795 3300048088 Bacteria 2075
360 Ga0495602_0268344 3300048088 Bacteria 1262
361 Ga0495602_0633294 3300048088 Unclassified 732
362 Ga0496100_0000001 3300048903 Bacteria 530179
363 Ga0496100_0000059 3300048903 Bacteria 65518
364 Ga0496100_0060978 3300048903 Bacteria 2484
365 Ga0496101_0000004 3300048904 Bacteria 331599
366 Ga0496101_0000135 3300048904 Bacteria 65518
367 Ga0496101_0092777 3300048904 Bacteria 2248
368 Ga0496102_0007757 3300048905 Bacteria 9172
369 Ga0496102_0058427 3300048905 Bacteria 3524
370 Ga0496102_0237671 3300048905 Bacteria 1718
371 Ga0496102_1198837 3300048905 Bacteria 679
372 Ga0496103_0046543 3300048906 Bacteria 2679
373 Ga0496103_0173659 3300048906 Bacteria 1384
374 Ga0496104_0000015 3300048907 Bacteria 374530
375 Ga0496104_0000025 3300048907 Bacteria 228519
376 Ga0496104_0141520 3300048907 Bacteria 2311
377 Ga0496104_0294527 3300048907 Bacteria 1535
378 Ga0496105_0000004 3300048908 Bacteria 475798
379 Ga0496105_0000023 3300048908 Bacteria 156126
380 Ga0496105_0003407 3300048908 Bacteria 11762
381 Ga0496106_0000056 3300048909 Bacteria 90682
382 Ga0496106_0000252 3300048909 Bacteria 37666
383 Ga0496106_0329593 3300048909 Bacteria 1225
384 Ga0496107_0000005 3300048910 Bacteria 281747
385 Ga0496107_0000054 3300048910 Bacteria 60902
386 Ga0496107_0020295 3300048910 Bacteria 4692
387 Ga0496107_0575899 3300048910 Bacteria 833
388 Ga0496108_0000006 3300048911 Bacteria 469473
389 Ga0496108_0000063 3300048911 Bacteria 118950
390 Ga0496108_0050687 3300048911 Bacteria 3475
391 Ga0496108_0329990 3300048911 Bacteria 1330
392 Ga0496108_0479575 3300048911 Bacteria 1087
393 Ga0496109_0000009 3300048912 Bacteria 236561
394 Ga0496109_0000012 3300048912 Bacteria 229699
395 Ga0496109_0000173 3300048912 Bacteria 63867
396 Ga0496109_0245245 3300048912 Bacteria 1686
397 Ga0496109_0328389 3300048912 Bacteria 1444
398 Ga0496110_0169046 3300048913 Bacteria 1983
399 Ga0496110_0193959 3300048913 Bacteria 1844
400 Ga0496110_0254218 3300048913 Bacteria 1599
401 Ga0496110_0599167 3300048913 Bacteria 1000
402 Ga0496111_0011379 3300048914 Bacteria 5992
403 Ga0496111_0030798 3300048914 Bacteria 3817
404 Ga0496111_0043971 3300048914 Bacteria 3211
405 Ga0496111_0281833 3300048914 Bacteria 1233
406 Ga0496111_0403090 3300048914 Bacteria 1010
407 Ga0496111_0685744 3300048914 Bacteria 746
408 Ga0496112_0000025 3300048915 Bacteria 146197
409 Ga0496112_0134993 3300048915 Bacteria 2438
410 Ga0496113_0058962 3300048916 Bacteria 2890
411 Ga0496113_0075001 3300048916 Bacteria 2580
412 Ga0496113_0226905 3300048916 Bacteria 1489
413 Ga0496113_0321553 3300048916 Bacteria 1240
414 Ga0496114_0000039 3300048917 Bacteria 138486
415 Ga0496114_0006763 3300048917 Bacteria 9033
416 Ga0496114_0167511 3300048917 Bacteria 1913
417 Ga0496115_0000011 3300048918 Bacteria 222529
418 Ga0496115_0000377 3300048918 Bacteria 36788
419 Ga0496116_0000331 3300048919 Bacteria 76536
420 Ga0496117_0005451 3300048920 Bacteria 13352
421 Ga0496118_0002916 3300048921 Bacteria 22218
422 Ga0496119_0002281 3300048922 Bacteria 21246
423 Ga0496119_0030358 3300048922 Bacteria 3646
424 Ga0496120_0001336 3300048923 Bacteria 30395
425 Ga0496121_0114547 3300048924 Bacteria 2049
426 Ga0496125_0023403 3300048928 Bacteria 5702
427 Ga0501031_0086399 3300049568 Bacteria 2045
428 Ga0501032_0118989 3300049569 Bacteria 1746
429 Ga0501033_0000554 3300049570 Bacteria 34825
430 Ga0501034_0021453 3300049571 Bacteria 6584
431 Ga0501034_0156293 3300049571 Bacteria 2254
432 Ga0501036_0000336 3300049572 Bacteria 32902
433 Ga0501037_0000425 3300049573 Bacteria 34779
434 Ga0501037_0274041 3300049573 Bacteria 1177
435 Ga0501038_0004922 3300049574 Bacteria 12405
436 Ga0501038_0343788 3300049574 Unclassified 1163
437 Ga0501039_0032026 3300049575 Bacteria 4053
438 Ga0501039_0348696 3300049575 Unclassified 1163
439 Ga0501040_0133309 3300049576 Bacteria 1748
440 Ga0501040_0164910 3300049576 Bacteria 1567
441 Ga0501040_0196031 3300049576 Bacteria 1434
442 Ga0501040_0273226 3300049576 Bacteria 1207
443 Ga0501041_0022711 3300049577 Bacteria 3758
444 Ga0501042_0024403 3300049578 Bacteria 4241
445 Ga0501042_0035274 3300049578 Bacteria 3548
446 Ga0501042_0053429 3300049578 Bacteria 2882
447 Ga0501042_0085396 3300049578 Bacteria 2263
448 Ga0501043_0000516 3300049579 Bacteria 34780
449 Ga0501043_0140448 3300049579 Unclassified 1892
450 Ga0501043_1293128 3300049579 Bacteria 509
451 Ga0501046_0004627 3300049580 Bacteria 12430
452 Ga0501046_0434054 3300049580 Bacteria 946
453 Ga0501046_0450019 3300049580 Bacteria 926
454 Ga0501047_0000706 3300049581 Bacteria 34791
455 Ga0501047_0088155 3300049581 Bacteria 2980
456 Ga0501047_0096965 3300049581 Bacteria 2827
457 Ga0501047_0278292 3300049581 Bacteria 1518
458 Ga0501047_0633501 3300049581 Bacteria 889
459 Ga0501048_0000269 3300049582 Bacteria 34831
460 Ga0501048_0126799 3300049582 Bacteria 1805
461 Ga0501067_0026243 3300049583 Bacteria 3228
462 Ga0501067_0112353 3300049583 Bacteria 1515
463 Ga0501068_0099770 3300049584 Bacteria 1799
464 Ga0501068_0104644 3300049584 Bacteria 1756
465 Ga0501068_0167710 3300049584 Bacteria 1385
466 Ga0501068_0172894 3300049584 Bacteria 1364
467 Ga0501069_0016305 3300049585 Bacteria 3988
468 Ga0501069_0086320 3300049585 Bacteria 1771
469 Ga0501070_0000649 3300049586 Bacteria 31969
470 Ga0501070_0005184 3300049586 Bacteria 11101
471 Ga0501071_0173713 3300049587 Unclassified 1613
472 Ga0501071_0391507 3300049587 Bacteria 1060
473 Ga0501071_0552722 3300049587 Bacteria 884
474 Ga0501072_0046569 3300049588 Bacteria 3413
475 Ga0501072_0077017 3300049588 Bacteria 2640
476 Ga0501072_0081105 3300049588 Bacteria 2571
477 Ga0501073_0003135 3300049589 Bacteria 12393
478 Ga0501074_0003386 3300049590 Bacteria 11290
479 Ga0501075_0039702 3300049591 Bacteria 3522
480 Ga0501075_0131077 3300049591 Bacteria 1910
481 Ga0501075_0485463 3300049591 Bacteria 942
482 Ga0501076_0771163 3300049592 Unclassified 793
483 Ga0501079_0155838 3300049741 Bacteria 1780
484 Ga0501079_0201236 3300049741 Bacteria 1555
485 Ga0501079_0368212 3300049741 Bacteria 1126
486 Ga0501079_0505434 3300049741 Bacteria 950
487 Ga0501080_0218983 3300049742 Bacteria 1742
488 Ga0501080_0365021 3300049742 Bacteria 1302
489 Ga0501080_0446818 3300049742 Bacteria 1159
490 Ga0501080_0769995 3300049742 Bacteria 845
491 Ga0501081_0159784 3300049743 Unclassified 1623
492 Ga0501081_0405033 3300049743 Bacteria 1010
493 Ga0501083_0043407 3300049744 Bacteria 3046
494 Ga0501083_0117920 3300049744 Bacteria 1741
495 Ga0501083_0769851 3300049744 Bacteria 626
496 Ga0501035_0000754 3300049822 Bacteria 34845
497 Ga0501044_0000947 3300049823 Bacteria 34821
498 Ga0501045_0030766 3300049824 Bacteria 3886
499 Ga0501045_0135987 3300049824 Bacteria 1827
500 Ga0501045_0161594 3300049824 Bacteria 1667
501 Ga0501045_0379729 3300049824 Bacteria 1052
502 nmdc:mga03n38_133936_c1 3300050490 Bacteria 1231
503 nmdc:mga00v17_142051_c1 3300050491 Bacteria 1540
504 nmdc:mga00v17_151737_c1 3300050491 Unclassified 1489
505 nmdc:mga00v17_193691_c1 3300050491 Unclassified 1313
506 nmdc:mga0yw44_256837_c1 3300050492 Bacteria 1164
507 nmdc:mga0yw44_34692_c1 3300050492 Bacteria 2958
508 nmdc:mga06z11_583193_c1 3300050494 Bacteria 680
509 nmdc:mga04h51_368366_c1 3300050495 Unclassified 597
510 nmdc:mga05p37_1341477_c1 3300050507 Bacteria 725
511 nmdc:mga05p37_61160_c1 3300050507 Bacteria 4636
512 nmdc:mga09592_128011_c1 3300050508 Bacteria 2183
513 nmdc:mga0qj67_183762_c1 3300050509 Bacteria 1698
514 nmdc:mga0qj67_204503_c1 3300050509 Bacteria 1604
515 nmdc:mga06r32_193641_c1 3300050510 Bacteria 2020
516 nmdc:mga06r32_42620_c1 3300050510 Bacteria 4317
517 nmdc:mga06r32_630199_c1 3300050510 Bacteria 1041
518 nmdc:mga08y16_592331_c1 3300050511 Bacteria 1118
519 nmdc:mga0rr50_654304_c1 3300050513 Unclassified 897
520 nmdc:mga0a205_53_c2 3300050515 Bacteria 54696
521 Ga0495601_0001218 3300053077 Bacteria 14090
522 Ga0495601_0049461 3300053077 Bacteria 2650
523 Ga0495601_0093870 3300053077 Bacteria 1933
524 Ga0495601_0223009 3300053077 Bacteria 1231
525 Ga0495601_0349120 3300053077 Bacteria 962
526 Ga0495612_0000067 3300053078 Bacteria 47307
527 Ga0495612_0005583 3300053078 Bacteria 5199
528 Ga0495612_0084758 3300053078 Bacteria 1335
529 Ga0495612_0246307 3300053078 Bacteria 794
530 Ga0495655_0057904 3300053083 Bacteria 1048
531 Ga0495595_0000002 3300053084 Bacteria 445641
532 Ga0495595_0000045 3300053084 Bacteria 63054
533 Ga0495595_0017755 3300053084 Bacteria 3065
534 Ga0495595_0070900 3300053084 Bacteria 1647
535 Ga0495595_0074984 3300053084 Bacteria 1604
536 Ga0495619_0000102 3300053085 Bacteria 64345
537 Ga0495619_0000268 3300053085 Bacteria 37980
538 Ga0495619_0003327 3300053085 Bacteria 10391
539 Ga0495619_0005581 3300053085 Bacteria 7983
540 Ga0495619_0009092 3300053085 Bacteria 6270
541 Ga0495619_0009447 3300053085 Bacteria 6152
542 Ga0500566_0015014 3300053094 Bacteria 4548
543 Ga0500595_018620 3300053119 Bacteria 2536
544 Ga0500614_001746 3300053123 Bacteria 5055
545 Ga0500628_000001 3300053129 Bacteria 564074
546 Ga0500568_0260385 3300053139 Bacteria 631
547 Ga0501084_0052269 3300054114 Bacteria 3419
548 Ga0501082_0015619 3300060353 Bacteria 6535
549 Ga0501082_0027491 3300060353 Bacteria 4897
550 Ga0501082_0300956 3300060353 Unclassified 1397
551 Ga0501082_1057396 3300060353 Bacteria 710
552 Ga0530510_0251494 3300061734 Bacteria 1317
553 Ga0530510_0635883 3300061734 Bacteria 812
554 Ga0530510_0699995 3300061734 Bacteria 772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_1341477_c1 nmdc:mga05p37_1341477_c1_254_712 122
2 3300005365 Ga0070688_100000228 Ga0070688_10000022826 129
3 3300005466 Ga0070685_10000019 Ga0070685_1000001982 129
4 3300005436 Ga0070713_100000047 Ga0070713_10000004763 130
5 3300009101 Ga0105247_10704565 Ga0105247_107045651 130
6 3300041486 Ga0451807_0093928 Ga0451807_0093928_769_1233 130
7 3300041452 Ga0451793_1852320 Ga0451793_1852320_196_708 131
8 3300049579 Ga0501043_1293128 Ga0501043_1293128_23_499 131
9 3300045976 Ga0466967_1427255 Ga0466967_1427255_165_668 133
10 3300005535 Ga0070684_100920396 Ga0070684_1009203961 134
11 3300026088 Ga0207641_10910115 Ga0207641_109101151 134
12 3300048906 Ga0496103_0046543 Ga0496103_0046543_798_1304 134
13 3300048906 Ga0496103_0173659 Ga0496103_0173659_812_1363 134
14 3300048907 Ga0496104_0294527 Ga0496104_0294527_163_675 136
15 3300048908 Ga0496105_0003407 Ga0496105_0003407_2457_2969 136
16 3300048911 Ga0496108_0479575 Ga0496108_0479575_72_584 136
17 3300048922 Ga0496119_0030358 Ga0496119_0030358_2670_3182 136
18 3300049581 Ga0501047_0088155 Ga0501047_0088155_2277_2858 138
19 3300049742 Ga0501080_0446818 Ga0501080_0446818_433_1014 138
20 3300048905 Ga0496102_0058427 Ga0496102_0058427_1994_2566 139
21 3300048920 Ga0496117_0005451 Ga0496117_0005451_10884_11456 140
22 3300048921 Ga0496118_0002916 Ga0496118_0002916_5387_5959 140
23 3300048923 Ga0496120_0001336 Ga0496120_0001336_10576_11121 140
24 3300048924 Ga0496121_0114547 Ga0496121_0114547_1019_1567 140
25 3300048928 Ga0496125_0023403 Ga0496125_0023403_3338_3886 140
26 3300049568 Ga0501031_0086399 Ga0501031_0086399_934_1452 140
27 3300049574 Ga0501038_0343788 Ga0501038_0343788_379_897 140
28 3300049575 Ga0501039_0348696 Ga0501039_0348696_416_934 140
29 3300049577 Ga0501041_0022711 Ga0501041_0022711_2892_3410 140
30 3300049582 Ga0501048_0126799 Ga0501048_0126799_492_1010 140
31 3300049587 Ga0501071_0173713 Ga0501071_0173713_796_1314 140
32 3300049588 Ga0501072_0046569 Ga0501072_0046569_382_900 140
33 3300049591 Ga0501075_0131077 Ga0501075_0131077_906_1424 140
34 3300049592 Ga0501076_0771163 Ga0501076_0771163_206_724 140
35 3300049743 Ga0501081_0159784 Ga0501081_0159784_528_1046 140
36 3300049824 Ga0501045_0030766 Ga0501045_0030766_878_1396 140
37 3300053139 Ga0500568_0260385 Ga0500568_0260385_60_608 140
38 3300054114 Ga0501084_0052269 Ga0501084_0052269_404_922 140
39 3300060353 Ga0501082_0015619 Ga0501082_0015619_481_999 140
40 3300061734 Ga0530510_0251494 Ga0530510_0251494_116_634 140
41 3300044901 Ga0466960_0119260 Ga0466960_0119260_409_924 141
42 3300006038 Ga0075365_10090699 Ga0075365_100906993 143
43 3300046615 Ga0495656_0000753 Ga0495656_0000753_3994_4494 143
44 3300003373 JGI25407J50210_10104246 JGI25407J50210_101042461 144
45 3300005548 Ga0070665_100204160 Ga0070665_1002041602 144
46 3300005981 Ga0081538_10000812 Ga0081538_1000081221 144
47 3300028379 Ga0268266_10229242 Ga0268266_102292423 144
48 3300045976 Ga0466967_0731377 Ga0466967_0731377_228_737 144
49 3300005354 Ga0070675_100000036 Ga0070675_10000003656 145
50 3300005436 Ga0070713_100743614 Ga0070713_1007436141 145
51 3300025926 Ga0207659_10000013 Ga0207659_10000013104 145
52 3300047472 Ga0495686_0592963 Ga0495686_0592963_14_490 145
53 3300005337 Ga0070682_100000011 Ga0070682_10000001118 146
54 3300005834 Ga0068851_10000730 Ga0068851_1000073012 146
55 3300006163 Ga0070715_10053407 Ga0070715_100534073 146
56 3300009098 Ga0105245_10006331 Ga0105245_100063313 146
57 3300020082 Ga0206353_11016966 Ga0206353_110169663 146
58 3300025905 Ga0207685_10025723 Ga0207685_100257233 146
59 3300025913 Ga0207695_10188274 Ga0207695_101882743 146
60 3300026023 Ga0207677_10000397 Ga0207677_1000039738 146
61 3300046683 Ga0495658_0003808 Ga0495658_0003808_6810_7334 146
62 3300049578 Ga0501042_0024403 Ga0501042_0024403_3605_4117 146
63 3300049581 Ga0501047_0633501 Ga0501047_0633501_246_830 146
64 3300005347 Ga0070668_100296340 Ga0070668_1002963402 147
65 3300005356 Ga0070674_100012503 Ga0070674_1000125032 147
66 3300005365 Ga0070688_100000360 Ga0070688_1000003608 147
67 3300005466 Ga0070685_10000020 Ga0070685_1000002029 147
68 3300005543 Ga0070672_100000001 Ga0070672_100000001116 147
69 3300005614 Ga0068856_100002498 Ga0068856_1000024985 147
70 3300005718 Ga0068866_10849261 Ga0068866_108492611 147
71 3300009098 Ga0105245_10000125 Ga0105245_1000012530 147
72 3300009147 Ga0114129_11161178 Ga0114129_111611782 147
73 3300009148 Ga0105243_10043619 Ga0105243_100436192 147
74 3300025927 Ga0207687_10000017 Ga0207687_10000017210 147
75 3300025940 Ga0207691_10000017 Ga0207691_1000001743 147
76 3300025972 Ga0207668_10248905 Ga0207668_102489052 147
77 3300026078 Ga0207702_10000637 Ga0207702_1000063732 147
78 3300045976 Ga0466967_0164558 Ga0466967_0164558_770_1303 147
79 3300048911 Ga0496108_0000063 Ga0496108_0000063_70486_71010 147
80 3300048912 Ga0496109_0000012 Ga0496109_0000012_41737_42261 147
81 3300049569 Ga0501032_0118989 Ga0501032_0118989_142_732 147
82 3300049570 Ga0501033_0000554 Ga0501033_0000554_22570_23160 147
83 3300049571 Ga0501034_0021453 Ga0501034_0021453_3381_3971 147
84 3300049572 Ga0501036_0000336 Ga0501036_0000336_22570_23160 147
85 3300049573 Ga0501037_0000425 Ga0501037_0000425_11620_12210 147
86 3300049574 Ga0501038_0004922 Ga0501038_0004922_11635_12225 147
87 3300049575 Ga0501039_0032026 Ga0501039_0032026_3286_3876 147
88 3300049576 Ga0501040_0164910 Ga0501040_0164910_93_683 147
89 3300049578 Ga0501042_0085396 Ga0501042_0085396_66_656 147
90 3300049579 Ga0501043_0000516 Ga0501043_0000516_22570_23160 147
91 3300049580 Ga0501046_0004627 Ga0501046_0004627_11632_12222 147
92 3300049581 Ga0501047_0000706 Ga0501047_0000706_11632_12222 147
93 3300049582 Ga0501048_0000269 Ga0501048_0000269_11679_12269 147
94 3300049583 Ga0501067_0112353 Ga0501067_0112353_758_1348 147
95 3300049584 Ga0501068_0104644 Ga0501068_0104644_889_1479 147
96 3300049585 Ga0501069_0086320 Ga0501069_0086320_1011_1601 147
97 3300049586 Ga0501070_0000649 Ga0501070_0000649_22570_23160 147
98 3300049586 Ga0501070_0005184 Ga0501070_0005184_8419_8931 147
99 3300049587 Ga0501071_0391507 Ga0501071_0391507_81_671 147
100 3300049588 Ga0501072_0077017 Ga0501072_0077017_41_631 147
101 3300049589 Ga0501073_0003135 Ga0501073_0003135_11606_12196 147
102 3300049590 Ga0501074_0003386 Ga0501074_0003386_10518_11108 147
103 3300049741 Ga0501079_0155838 Ga0501079_0155838_985_1575 147
104 3300049742 Ga0501080_0218983 Ga0501080_0218983_166_756 147
105 3300049744 Ga0501083_0117920 Ga0501083_0117920_959_1549 147
106 3300049822 Ga0501035_0000754 Ga0501035_0000754_11686_12276 147
107 3300049823 Ga0501044_0000947 Ga0501044_0000947_11685_12275 147
108 3300049824 Ga0501045_0135987 Ga0501045_0135987_1064_1654 147
109 3300050492 nmdc:mga0yw44_256837_c1 nmdc:mga0yw44_256837_c1_324_863 147
110 3300050510 nmdc:mga06r32_630199_c1 nmdc:mga06r32_630199_c1_512_1027 147
111 3300060353 Ga0501082_0027491 Ga0501082_0027491_175_765 147
112 3300060353 Ga0501082_1057396 Ga0501082_1057396_192_683 147
113 3300005338 Ga0068868_100193814 Ga0068868_1001938142 148
114 3300005347 Ga0070668_100053864 Ga0070668_1000538644 148
115 3300005365 Ga0070688_100215996 Ga0070688_1002159962 148
116 3300005439 Ga0070711_100036522 Ga0070711_1000365222 148
117 3300005466 Ga0070685_10076519 Ga0070685_100765192 148
118 3300005544 Ga0070686_100237400 Ga0070686_1002374001 148
119 3300005937 Ga0081455_10222993 Ga0081455_102229932 148
120 3300006881 Ga0068865_100174445 Ga0068865_1001744453 148
121 3300009177 Ga0105248_10893919 Ga0105248_108939192 148
122 3300013306 Ga0163162_10122210 Ga0163162_101222102 148
123 3300025934 Ga0207686_10104065 Ga0207686_101040653 148
124 3300025937 Ga0207669_10318107 Ga0207669_103181072 148
125 3300025939 Ga0207665_10041758 Ga0207665_100417582 148
126 3300025972 Ga0207668_10062039 Ga0207668_100620392 148
127 3300026035 Ga0207703_10766853 Ga0207703_107668532 148
128 3300026089 Ga0207648_10680491 Ga0207648_106804912 148
129 3300026095 Ga0207676_10713111 Ga0207676_107131111 148
130 3300026121 Ga0207683_10027545 Ga0207683_100275455 148
131 3300028563 Ga0265319_1000469 Ga0265319_10004697 148
132 3300028800 Ga0265338_10000244 Ga0265338_1000024475 148
133 3300031241 Ga0265325_10064475 Ga0265325_100644751 148
134 3300031250 Ga0265331_10011583 Ga0265331_100115835 148
135 3300032126 Ga0307415_100017498 Ga0307415_1000174984 148
136 3300038443 Ga0395901_0720252 Ga0395901_0720252_370_876 148
137 3300046499 Ga0495594_0229451 Ga0495594_0229451_374_889 148
138 3300048903 Ga0496100_0060978 Ga0496100_0060978_1343_1858 148
139 3300048904 Ga0496101_0092777 Ga0496101_0092777_1040_1555 148
140 3300048905 Ga0496102_0007757 Ga0496102_0007757_925_1440 148
141 3300048909 Ga0496106_0329593 Ga0496106_0329593_315_830 148
142 3300048911 Ga0496108_0050687 Ga0496108_0050687_1125_1640 148
143 3300048912 Ga0496109_0245245 Ga0496109_0245245_397_912 148
144 3300048914 Ga0496111_0403090 Ga0496111_0403090_283_798 148
145 3300048916 Ga0496113_0075001 Ga0496113_0075001_779_1294 148
146 3300049576 Ga0501040_0196031 Ga0501040_0196031_513_1031 148
147 3300049584 Ga0501068_0167710 Ga0501068_0167710_864_1364 148
148 3300049588 Ga0501072_0081105 Ga0501072_0081105_870_1388 148
149 3300049591 Ga0501075_0485463 Ga0501075_0485463_67_585 148
150 3300049741 Ga0501079_0368212 Ga0501079_0368212_486_1004 148
151 3300049744 Ga0501083_0769851 Ga0501083_0769851_37_555 148
152 3300049824 Ga0501045_0161594 Ga0501045_0161594_656_1174 148
153 3300005329 Ga0070683_100006889 Ga0070683_1000068895 149
154 3300005457 Ga0070662_100000002 Ga0070662_100000002214 149
155 3300005547 Ga0070693_100000470 Ga0070693_1000004703 149
156 3300005548 Ga0070665_100028178 Ga0070665_1000281784 149
157 3300005548 Ga0070665_100242923 Ga0070665_1002429232 149
158 3300005616 Ga0068852_100579401 Ga0068852_1005794011 149
159 3300025944 Ga0207661_10000198 Ga0207661_1000019835 149
160 3300026142 Ga0207698_10230458 Ga0207698_102304583 149
161 3300028379 Ga0268266_10000601 Ga0268266_1000060115 149
162 3300028379 Ga0268266_10265674 Ga0268266_102656742 149
163 3300053078 Ga0495612_0246307 Ga0495612_0246307_226_753 149
164 3300002459 JGI24751J29686_10080653 JGI24751J29686_100806531 150
165 3300005337 Ga0070682_100451150 Ga0070682_1004511502 150
166 3300005434 Ga0070709_10723285 Ga0070709_107232852 150
167 3300005539 Ga0068853_100320462 Ga0068853_1003204622 150
168 3300005614 Ga0068856_100013571 Ga0068856_1000135714 150
169 3300005616 Ga0068852_100000002 Ga0068852_100000002200 150
170 3300005841 Ga0068863_100000022 Ga0068863_10000002222 150
171 3300005937 Ga0081455_10126628 Ga0081455_101266283 150
172 3300006844 Ga0075428_100122655 Ga0075428_1001226553 150
173 3300006846 Ga0075430_100128225 Ga0075430_1001282252 150
174 3300006847 Ga0075431_100004050 Ga0075431_10000405012 150
175 3300006880 Ga0075429_100848079 Ga0075429_1008480792 150
176 3300009093 Ga0105240_10246468 Ga0105240_102464683 150
177 3300009174 Ga0105241_10317193 Ga0105241_103171932 150
178 3300010375 Ga0105239_10528827 Ga0105239_105288272 150
179 3300013307 Ga0157372_10000053 Ga0157372_1000005379 150
180 3300013308 Ga0157375_10188698 Ga0157375_101886983 150
181 3300014969 Ga0157376_10056242 Ga0157376_100562425 150
182 3300025933 Ga0207706_10000001 Ga0207706_10000001395 150
183 3300025941 Ga0207711_10000006 Ga0207711_10000006237 150
184 3300025986 Ga0207658_10201760 Ga0207658_102017603 150
185 3300026041 Ga0207639_10015804 Ga0207639_100158047 150
186 3300026078 Ga0207702_10018008 Ga0207702_100180084 150
187 3300026088 Ga0207641_10000016 Ga0207641_10000016143 150
188 3300026142 Ga0207698_10000004 Ga0207698_1000000485 150
189 3300028379 Ga0268266_10196858 Ga0268266_101968582 150
190 3300035398 Ga0316574_0233038 Ga0316574_0233038_434_949 150
191 3300046511 Ga0495608_0000007 Ga0495608_0000007_141123_141662 150
192 3300046675 Ga0495657_0000001 Ga0495657_0000001_273269_273808 150
193 3300047444 Ga0495675_0000300 Ga0495675_0000300_6177_6716 150
194 3300048905 Ga0496102_0237671 Ga0496102_0237671_1072_1611 150
195 3300048916 Ga0496113_0226905 Ga0496113_0226905_28_564 150
196 3300049741 Ga0501079_0505434 Ga0501079_0505434_262_789 150
197 3300053084 Ga0495595_0000002 Ga0495595_0000002_171834_172373 150
198 3300053085 Ga0495619_0000102 Ga0495619_0000102_28844_29383 150
199 3300053085 Ga0495619_0000268 Ga0495619_0000268_26988_27527 150
200 3300005329 Ga0070683_100040821 Ga0070683_1000408213 151
201 3300005347 Ga0070668_100011596 Ga0070668_1000115966 151
202 3300005366 Ga0070659_100019249 Ga0070659_1000192492 151
203 3300005367 Ga0070667_100001076 Ga0070667_10000107630 151
204 3300005438 Ga0070701_10189878 Ga0070701_101898781 151
205 3300005439 Ga0070711_100102386 Ga0070711_1001023862 151
206 3300005535 Ga0070684_100228485 Ga0070684_1002284852 151
207 3300005548 Ga0070665_100045460 Ga0070665_1000454603 151
208 3300005563 Ga0068855_100592659 Ga0068855_1005926592 151
209 3300005718 Ga0068866_10000003 Ga0068866_10000003283 151
210 3300005843 Ga0068860_100004743 Ga0068860_1000047436 151
211 3300005843 Ga0068860_100030106 Ga0068860_1000301065 151
212 3300005844 Ga0068862_100023531 Ga0068862_1000235313 151
213 3300005937 Ga0081455_10019712 Ga0081455_100197124 151
214 3300006038 Ga0075365_10015429 Ga0075365_100154296 151
215 3300006038 Ga0075365_10057875 Ga0075365_100578753 151
216 3300006048 Ga0075363_100029719 Ga0075363_1000297192 151
217 3300006051 Ga0075364_10089117 Ga0075364_100891173 151
218 3300006163 Ga0070715_10000029 Ga0070715_1000002911 151
219 3300006175 Ga0070712_100079139 Ga0070712_1000791393 151
220 3300009176 Ga0105242_10744973 Ga0105242_107449732 151
221 3300013105 Ga0157369_10000307 Ga0157369_1000030747 151
222 3300014745 Ga0157377_10127253 Ga0157377_101272532 151
223 3300025899 Ga0207642_10000002 Ga0207642_10000002533 151
224 3300025900 Ga0207710_10000821 Ga0207710_100008217 151
225 3300025903 Ga0207680_10095594 Ga0207680_100955943 151
226 3300025905 Ga0207685_10000031 Ga0207685_1000003178 151
227 3300025913 Ga0207695_10309585 Ga0207695_103095852 151
228 3300025915 Ga0207693_10069081 Ga0207693_100690813 151
229 3300025916 Ga0207663_10033961 Ga0207663_100339614 151
230 3300025917 Ga0207660_10062694 Ga0207660_100626944 151
231 3300025921 Ga0207652_10003850 Ga0207652_100038505 151
232 3300025928 Ga0207700_10000033 Ga0207700_1000003344 151
233 3300025934 Ga0207686_10001016 Ga0207686_1000101615 151
234 3300025936 Ga0207670_10005811 Ga0207670_100058114 151
235 3300025937 Ga0207669_10000001 Ga0207669_100000019 151
236 3300025944 Ga0207661_10010942 Ga0207661_100109423 151
237 3300025944 Ga0207661_10029396 Ga0207661_100293963 151
238 3300025949 Ga0207667_11234283 Ga0207667_112342831 151
239 3300025961 Ga0207712_10007734 Ga0207712_100077347 151
240 3300025972 Ga0207668_10005384 Ga0207668_100053846 151
241 3300025986 Ga0207658_10003877 Ga0207658_1000387715 151
242 3300026078 Ga0207702_10120669 Ga0207702_101206693 151
243 3300028379 Ga0268266_10030794 Ga0268266_100307945 151
244 3300028380 Ga0268265_10004453 Ga0268265_100044534 151
245 3300028381 Ga0268264_10002435 Ga0268264_1000243510 151
246 3300028381 Ga0268264_10127452 Ga0268264_101274524 151
247 3300028556 Ga0265337_1000066 Ga0265337_10000666 151
248 3300028558 Ga0265326_10000019 Ga0265326_10000019126 151
249 3300028573 Ga0265334_10231623 Ga0265334_102316231 151
250 3300028654 Ga0265322_10000011 Ga0265322_10000011126 151
251 3300028666 Ga0265336_10020373 Ga0265336_100203733 151
252 3300028800 Ga0265338_10223812 Ga0265338_102238122 151
253 3300029957 Ga0265324_10000283 Ga0265324_100002838 151
254 3300031238 Ga0265332_10018240 Ga0265332_100182403 151
255 3300031239 Ga0265328_10011111 Ga0265328_100111114 151
256 3300031240 Ga0265320_10000011 Ga0265320_10000011126 151
257 3300031250 Ga0265331_10000858 Ga0265331_100008584 151
258 3300031251 Ga0265327_10000015 Ga0265327_10000015234 151
259 3300031344 Ga0265316_10022934 Ga0265316_100229343 151
260 3300031711 Ga0265314_10003522 Ga0265314_100035228 151
261 3300031712 Ga0265342_10273785 Ga0265342_102737852 151
262 3300031995 Ga0307409_101559992 Ga0307409_1015599921 151
263 3300035398 Ga0316574_0008333 Ga0316574_0008333_1071_1589 151
264 3300035398 Ga0316574_0066284 Ga0316574_0066284_814_1326 151
265 3300045836 Ga0466958_0023118 Ga0466958_0023118_309_836 151
266 3300046460 Ga0495638_0467004 Ga0495638_0467004_45_557 151
267 3300046461 Ga0495641_0000005 Ga0495641_0000005_125734_126252 151
268 3300046461 Ga0495641_0042190 Ga0495641_0042190_1523_2035 151
269 3300046516 Ga0495628_0011208 Ga0495628_0011208_7021_7533 151
270 3300046529 Ga0495652_0031927 Ga0495652_0031927_3172_3684 151
271 3300046543 Ga0495645_0006168 Ga0495645_0006168_2779_3291 151
272 3300046543 Ga0495645_0016131 Ga0495645_0016131_10_522 151
273 3300046694 Ga0495649_0013634 Ga0495649_0013634_2500_3018 151
274 3300047322 Ga0495680_0328578 Ga0495680_0328578_168_695 151
275 3300048913 Ga0496110_0193959 Ga0496110_0193959_83_601 151
276 3300048918 Ga0496115_0000011 Ga0496115_0000011_122614_123141 151
277 3300050490 nmdc:mga03n38_133936_c1 nmdc:mga03n38_133936_c1_102_638 151
278 3300050491 nmdc:mga00v17_151737_c1 nmdc:mga00v17_151737_c1_423_959 151
279 3300050491 nmdc:mga00v17_193691_c1 nmdc:mga00v17_193691_c1_417_953 151
280 3300050492 nmdc:mga0yw44_34692_c1 nmdc:mga0yw44_34692_c1_2177_2713 151
281 3300050495 nmdc:mga04h51_368366_c1 nmdc:mga04h51_368366_c1_33_569 151
282 3300050515 nmdc:mga0a205_53_c2 nmdc:mga0a205_53_c2_27875_28402 151
283 3300053077 Ga0495601_0349120 Ga0495601_0349120_155_667 151
284 3300053123 Ga0500614_001746 Ga0500614_001746_4474_4992 151
285 3300005329 Ga0070683_100029530 Ga0070683_1000295304 152
286 3300005329 Ga0070683_100125663 Ga0070683_1001256632 152
287 3300005341 Ga0070691_10000138 Ga0070691_1000013823 152
288 3300005456 Ga0070678_100696433 Ga0070678_1006964332 152
289 3300005535 Ga0070684_100119090 Ga0070684_1001190903 152
290 3300005535 Ga0070684_100219769 Ga0070684_1002197693 152
291 3300005548 Ga0070665_100107489 Ga0070665_1001074891 152
292 3300005564 Ga0070664_100826209 Ga0070664_1008262092 152
293 3300005618 Ga0068864_100000015 Ga0068864_100000015180 152
294 3300005719 Ga0068861_100142746 Ga0068861_1001427463 152
295 3300006048 Ga0075363_100169532 Ga0075363_1001695321 152
296 3300006048 Ga0075363_100226182 Ga0075363_1002261822 152
297 3300006051 Ga0075364_10246715 Ga0075364_102467152 152
298 3300006178 Ga0075367_10154694 Ga0075367_101546942 152
299 3300006178 Ga0075367_10471481 Ga0075367_104714811 152
300 3300006847 Ga0075431_100288537 Ga0075431_1002885372 152
301 3300025903 Ga0207680_10109162 Ga0207680_101091623 152
302 3300025944 Ga0207661_10051438 Ga0207661_100514383 152
303 3300026095 Ga0207676_10000018 Ga0207676_10000018120 152
304 3300026118 Ga0207675_100251659 Ga0207675_1002516593 152
305 3300028379 Ga0268266_10001254 Ga0268266_1000125414 152
306 3300035172 Ga0373955_0278069 Ga0373955_0278069_477_992 152
307 3300036401 Ga0373937_0013210 Ga0373937_0013210_5730_6245 152
308 3300036401 Ga0373937_0686503 Ga0373937_0686503_181_702 152
309 3300046462 Ga0495651_0520748 Ga0495651_0520748_95_610 152
310 3300046511 Ga0495608_0185622 Ga0495608_0185622_184_699 152
311 3300046516 Ga0495628_0040772 Ga0495628_0040772_854_1378 152
312 3300046516 Ga0495628_0288887 Ga0495628_0288887_352_873 152
313 3300046516 Ga0495628_0293831 Ga0495628_0293831_133_648 152
314 3300046517 Ga0495630_0010638 Ga0495630_0010638_3727_4248 152
315 3300046517 Ga0495630_0546115 Ga0495630_0546115_351_872 152
316 3300046529 Ga0495652_0328202 Ga0495652_0328202_62_577 152
317 3300046533 Ga0495640_0260844 Ga0495640_0260844_87_602 152
318 3300046535 Ga0495586_0295726 Ga0495586_0295726_59_580 152
319 3300046663 Ga0495635_0000031 Ga0495635_0000031_99311_99835 152
320 3300046663 Ga0495635_0010132 Ga0495635_0010132_5125_5646 152
321 3300046663 Ga0495635_0083646 Ga0495635_0083646_961_1476 152
322 3300046663 Ga0495635_0431862 Ga0495635_0431862_185_700 152
323 3300046675 Ga0495657_0065142 Ga0495657_0065142_629_1150 152
324 3300047317 Ga0495604_0068381 Ga0495604_0068381_806_1321 152
325 3300047319 Ga0495674_0888685 Ga0495674_0888685_110_625 152
326 3300047322 Ga0495680_0067441 Ga0495680_0067441_1241_1756 152
327 3300047322 Ga0495680_0202624 Ga0495680_0202624_207_728 152
328 3300047471 Ga0495684_0284698 Ga0495684_0284698_440_961 152
329 3300048912 Ga0496109_0328389 Ga0496109_0328389_69_584 152
330 3300048913 Ga0496110_0169046 Ga0496110_0169046_764_1279 152
331 3300048914 Ga0496111_0011379 Ga0496111_0011379_4110_4625 152
332 3300048915 Ga0496112_0134993 Ga0496112_0134993_554_1069 152
333 3300048916 Ga0496113_0321553 Ga0496113_0321553_418_933 152
334 3300049576 Ga0501040_0133309 Ga0501040_0133309_911_1426 152
335 3300049576 Ga0501040_0273226 Ga0501040_0273226_489_1004 152
336 3300049580 Ga0501046_0434054 Ga0501046_0434054_99_614 152
337 3300049584 Ga0501068_0172894 Ga0501068_0172894_671_1186 152
338 3300049824 Ga0501045_0379729 Ga0501045_0379729_438_953 152
339 3300050491 nmdc:mga00v17_142051_c1 nmdc:mga00v17_142051_c1_596_1120 152
340 3300053077 Ga0495601_0049461 Ga0495601_0049461_1734_2255 152
341 3300053078 Ga0495612_0000067 Ga0495612_0000067_29102_29617 152
342 3300053078 Ga0495612_0084758 Ga0495612_0084758_235_756 152
343 3300053084 Ga0495595_0070900 Ga0495595_0070900_1037_1552 152
344 3300053084 Ga0495595_0074984 Ga0495595_0074984_422_937 152
345 3300053085 Ga0495619_0003327 Ga0495619_0003327_3171_3686 152
346 3300053085 Ga0495619_0005581 Ga0495619_0005581_6647_7168 152
347 3300053085 Ga0495619_0009092 Ga0495619_0009092_4542_5057 152
348 3300053085 Ga0495619_0009447 Ga0495619_0009447_2359_2880 152
349 3300053129 Ga0500628_000001 Ga0500628_000001_225300_225827 152
350 3300060353 Ga0501082_0300956 Ga0501082_0300956_482_997 152
351 3300061734 Ga0530510_0635883 Ga0530510_0635883_282_797 152
352 3300005344 Ga0070661_100000058 Ga0070661_10000005842 153
353 3300009147 Ga0114129_10068282 Ga0114129_100682825 153
354 3300025920 Ga0207649_10000283 Ga0207649_100002838 153
355 3300046459 Ga0495629_0013987 Ga0495629_0013987_105_629 153
356 3300046516 Ga0495628_0000859 Ga0495628_0000859_6125_6661 153
357 3300046535 Ga0495586_0000083 Ga0495586_0000083_6111_6641 153
358 3300047321 Ga0495676_0403087 Ga0495676_0403087_137_661 153
359 3300048913 Ga0496110_0254218 Ga0496110_0254218_874_1413 153
360 3300048914 Ga0496111_0043971 Ga0496111_0043971_969_1508 153
361 3300049743 Ga0501081_0405033 Ga0501081_0405033_366_887 153
362 3300050507 nmdc:mga05p37_61160_c1 nmdc:mga05p37_61160_c1_3549_4070 153
363 3300050509 nmdc:mga0qj67_183762_c1 nmdc:mga0qj67_183762_c1_1132_1653 153
364 3300005535 Ga0070684_100081124 Ga0070684_1000811242 154
365 3300009148 Ga0105243_10028685 Ga0105243_100286857 154
366 3300009177 Ga0105248_10000020 Ga0105248_10000020139 154
367 3300014326 Ga0157380_10000016 Ga0157380_1000001685 154
368 3300014969 Ga0157376_10020564 Ga0157376_100205645 154
369 3300017792 Ga0163161_10047839 Ga0163161_100478395 154
370 3300025935 Ga0207709_10019598 Ga0207709_100195986 154
371 3300028380 Ga0268265_10687215 Ga0268265_106872151 154
372 3300031995 Ga0307409_100099008 Ga0307409_1000990083 154
373 3300032126 Ga0307415_100341209 Ga0307415_1003412092 154
374 3300046533 Ga0495640_0082037 Ga0495640_0082037_420_953 154
375 3300047319 Ga0495674_0002248 Ga0495674_0002248_5651_6184 154
376 3300047471 Ga0495684_0144274 Ga0495684_0144274_970_1494 154
377 3300048911 Ga0496108_0329990 Ga0496108_0329990_93_629 154
378 3300048912 Ga0496109_0000173 Ga0496109_0000173_715_1251 154
379 3300049573 Ga0501037_0274041 Ga0501037_0274041_110_637 154
380 3300049578 Ga0501042_0035274 Ga0501042_0035274_912_1439 154
381 3300049578 Ga0501042_0053429 Ga0501042_0053429_2203_2724 154
382 3300049583 Ga0501067_0026243 Ga0501067_0026243_1268_1831 154
383 3300050508 nmdc:mga09592_128011_c1 nmdc:mga09592_128011_c1_1532_2086 154
384 3300050509 nmdc:mga0qj67_204503_c1 nmdc:mga0qj67_204503_c1_870_1424 154
385 3300050510 nmdc:mga06r32_42620_c1 nmdc:mga06r32_42620_c1_185_739 154
386 3300061734 Ga0530510_0699995 Ga0530510_0699995_60_623 154
387 3300001979 JGI24740J21852_10038891 JGI24740J21852_100388911 155
388 3300005337 Ga0070682_100000052 Ga0070682_10000005273 155
389 3300005365 Ga0070688_100129950 Ga0070688_1001299502 155
390 3300005435 Ga0070714_100010661 Ga0070714_1000106613 155
391 3300005458 Ga0070681_10045866 Ga0070681_100458663 155
392 3300005466 Ga0070685_10047925 Ga0070685_100479255 155
393 3300005535 Ga0070684_100520933 Ga0070684_1005209332 155
394 3300005564 Ga0070664_100293109 Ga0070664_1002931092 155
395 3300005617 Ga0068859_100403446 Ga0068859_1004034461 155
396 3300005842 Ga0068858_100000118 Ga0068858_10000011868 155
397 3300006051 Ga0075364_10223369 Ga0075364_102233692 155
398 3300006358 Ga0068871_100146311 Ga0068871_1001463112 155
399 3300006852 Ga0075433_10003354 Ga0075433_100033547 155
400 3300006931 Ga0097620_100403477 Ga0097620_1004034771 155
401 3300009093 Ga0105240_11325785 Ga0105240_113257852 155
402 3300009101 Ga0105247_10001978 Ga0105247_1000197816 155
403 3300009101 Ga0105247_10362980 Ga0105247_103629802 155
404 3300009101 Ga0105247_10553414 Ga0105247_105534142 155
405 3300009176 Ga0105242_10347093 Ga0105242_103470932 155
406 3300009553 Ga0105249_10345303 Ga0105249_103453031 155
407 3300013297 Ga0157378_10010221 Ga0157378_100102212 155
408 3300013306 Ga0163162_10755197 Ga0163162_107551972 155
409 3300013308 Ga0157375_10090838 Ga0157375_100908382 155
410 3300014325 Ga0163163_10308401 Ga0163163_103084012 155
411 3300014326 Ga0157380_10000236 Ga0157380_1000023614 155
412 3300014326 Ga0157380_10120059 Ga0157380_101200591 155
413 3300014326 Ga0157380_10777583 Ga0157380_107775832 155
414 3300014968 Ga0157379_10059769 Ga0157379_100597694 155
415 3300025900 Ga0207710_10320245 Ga0207710_103202452 155
416 3300025929 Ga0207664_10092298 Ga0207664_100922983 155
417 3300025932 Ga0207690_10185115 Ga0207690_101851152 155
418 3300025934 Ga0207686_10126611 Ga0207686_101266112 155
419 3300025945 Ga0207679_10057120 Ga0207679_100571204 155
420 3300025961 Ga0207712_10255543 Ga0207712_102555432 155
421 3300026035 Ga0207703_10000061 Ga0207703_1000006185 155
422 3300026041 Ga0207639_10012718 Ga0207639_100127185 155
423 3300026078 Ga0207702_10009958 Ga0207702_100099588 155
424 3300026121 Ga0207683_10068028 Ga0207683_100680283 155
425 3300028379 Ga0268266_10000056 Ga0268266_10000056124 155
426 3300041505 Ga0451849_0264818 Ga0451849_0264818_289_828 155
427 3300046455 Ga0495603_0004009 Ga0495603_0004009_2001_2528 155
428 3300046459 Ga0495629_0000487 Ga0495629_0000487_22467_23003 155
429 3300046459 Ga0495629_0561095 Ga0495629_0561095_195_719 155
430 3300046461 Ga0495641_0010781 Ga0495641_0010781_2487_3026 155
431 3300046473 Ga0495582_0000001 Ga0495582_0000001_59216_59752 155
432 3300046475 Ga0495639_0265560 Ga0495639_0265560_136_663 155
433 3300046476 Ga0495662_0039759 Ga0495662_0039759_59_583 155
434 3300046507 Ga0495606_0000040 Ga0495606_0000040_104586_105125 155
435 3300046511 Ga0495608_0393053 Ga0495608_0393053_45_575 155
436 3300046515 Ga0495620_0001374 Ga0495620_0001374_9534_10061 155
437 3300046516 Ga0495628_0164584 Ga0495628_0164584_649_1179 155
438 3300046516 Ga0495628_0358590 Ga0495628_0358590_208_732 155
439 3300046517 Ga0495630_0000014 Ga0495630_0000014_126625_127164 155
440 3300046517 Ga0495630_0141133 Ga0495630_0141133_186_725 155
441 3300046529 Ga0495652_0000010 Ga0495652_0000010_254895_255431 155
442 3300046535 Ga0495586_0136247 Ga0495586_0136247_673_1197 155
443 3300046536 Ga0495587_0028775 Ga0495587_0028775_200_739 155
444 3300046539 Ga0495621_0001691 Ga0495621_0001691_3905_4435 155
445 3300046557 Ga0495622_0000218 Ga0495622_0000218_32038_32574 155
446 3300046642 Ga0495634_0004632 Ga0495634_0004632_6188_6712 155
447 3300046674 Ga0495588_0003659 Ga0495588_0003659_6113_6652 155
448 3300046678 Ga0495599_0015716 Ga0495599_0015716_168_698 155
449 3300046679 Ga0495623_0377639 Ga0495623_0377639_79_606 155
450 3300046680 Ga0495646_0367887 Ga0495646_0367887_186_716 155
451 3300046681 Ga0495647_0000001 Ga0495647_0000001_43844_44371 155
452 3300046681 Ga0495647_0006447 Ga0495647_0006447_489_1028 155
453 3300046683 Ga0495658_0000002 Ga0495658_0000002_182822_183358 155
454 3300046684 Ga0495669_0058551 Ga0495669_0058551_681_1205 155
455 3300046689 Ga0495613_0000041 Ga0495613_0000041_31859_32398 155
456 3300046690 Ga0495624_0000019 Ga0495624_0000019_33761_34291 155
457 3300046690 Ga0495624_0000286 Ga0495624_0000286_36490_37029 155
458 3300046809 Ga0495600_0295586 Ga0495600_0295586_474_1013 155
459 3300047317 Ga0495604_0000239 Ga0495604_0000239_25507_26046 155
460 3300047317 Ga0495604_0022899 Ga0495604_0022899_1807_2346 155
461 3300047321 Ga0495676_0000238 Ga0495676_0000238_6298_6825 155
462 3300047321 Ga0495676_0001364 Ga0495676_0001364_8418_8957 155
463 3300047321 Ga0495676_0054980 Ga0495676_0054980_772_1311 155
464 3300047322 Ga0495680_0000488 Ga0495680_0000488_30972_31502 155
465 3300047446 Ga0495679_010122 Ga0495679_010122_2274_2804 155
466 3300048088 Ga0495602_0000007 Ga0495602_0000007_129927_130466 155
467 3300048088 Ga0495602_0123795 Ga0495602_0123795_549_1076 155
468 3300048088 Ga0495602_0268344 Ga0495602_0268344_706_1230 155
469 3300048088 Ga0495602_0633294 Ga0495602_0633294_137_667 155
470 3300048903 Ga0496100_0000001 Ga0496100_0000001_359322_359861 155
471 3300048904 Ga0496101_0000004 Ga0496101_0000004_160674_161213 155
472 3300048905 Ga0496102_1198837 Ga0496102_1198837_90_614 155
473 3300048907 Ga0496104_0000015 Ga0496104_0000015_204537_205061 155
474 3300048907 Ga0496104_0141520 Ga0496104_0141520_1359_1898 155
475 3300048908 Ga0496105_0000004 Ga0496105_0000004_270738_271262 155
476 3300048909 Ga0496106_0000056 Ga0496106_0000056_81647_82186 155
477 3300048910 Ga0496107_0000005 Ga0496107_0000005_170387_170926 155
478 3300048910 Ga0496107_0020295 Ga0496107_0020295_4051_4575 155
479 3300048914 Ga0496111_0281833 Ga0496111_0281833_531_1055 155
480 3300048914 Ga0496111_0685744 Ga0496111_0685744_183_722 155
481 3300048916 Ga0496113_0058962 Ga0496113_0058962_848_1372 155
482 3300048917 Ga0496114_0000039 Ga0496114_0000039_11713_12249 155
483 3300048917 Ga0496114_0006763 Ga0496114_0006763_7247_7774 155
484 3300048917 Ga0496114_0167511 Ga0496114_0167511_1303_1845 155
485 3300048918 Ga0496115_0000377 Ga0496115_0000377_35864_36400 155
486 3300048919 Ga0496116_0000331 Ga0496116_0000331_69671_70222 155
487 3300048922 Ga0496119_0002281 Ga0496119_0002281_14368_14919 155
488 3300049591 Ga0501075_0039702 Ga0501075_0039702_2042_2572 155
489 3300050513 nmdc:mga0rr50_654304_c1 nmdc:mga0rr50_654304_c1_307_834 155
490 3300053077 Ga0495601_0001218 Ga0495601_0001218_5641_6180 155
491 3300053077 Ga0495601_0223009 Ga0495601_0223009_568_1104 155
492 3300053078 Ga0495612_0005583 Ga0495612_0005583_30_554 155
493 3300053084 Ga0495595_0017755 Ga0495595_0017755_75_614 155
494 3300053094 Ga0500566_0015014 Ga0500566_0015014_3930_4472 155
495 3300001977 JGI24746J21847_1000066 JGI24746J21847_10000668 156
496 3300005335 Ga0070666_10236344 Ga0070666_102363441 156
497 3300005367 Ga0070667_100830801 Ga0070667_1008308011 156
498 3300005459 Ga0068867_100002402 Ga0068867_1000024028 156
499 3300009094 Ga0111539_10623848 Ga0111539_106238482 156
500 3300009098 Ga0105245_10000517 Ga0105245_100005178 156
501 3300009553 Ga0105249_10000178 Ga0105249_1000017848 156
502 3300014968 Ga0157379_10002058 Ga0157379_1000205819 156
503 3300014968 Ga0157379_10019326 Ga0157379_100193263 156
504 3300017792 Ga0163161_10000022 Ga0163161_100000229 156
505 3300025893 Ga0207682_10000155 Ga0207682_100001557 156
506 3300025927 Ga0207687_10000085 Ga0207687_1000008561 156
507 3300026089 Ga0207648_10003501 Ga0207648_100035017 156
508 3300046463 Ga0495653_0048901 Ga0495653_0048901_955_1491 156
509 3300046463 Ga0495653_0470652 Ga0495653_0470652_66_602 156
510 3300046476 Ga0495662_0000001 Ga0495662_0000001_39247_39783 156
511 3300046511 Ga0495608_0001804 Ga0495608_0001804_8665_9201 156
512 3300046514 Ga0495618_0000014 Ga0495618_0000014_95899_96438 156
513 3300046516 Ga0495628_0504280 Ga0495628_0504280_122_658 156
514 3300046523 Ga0495644_0001062 Ga0495644_0001062_5504_6043 156
515 3300046616 Ga0495668_0031092 Ga0495668_0031092_1463_1999 156
516 3300046642 Ga0495634_0002567 Ga0495634_0002567_8951_9475 156
517 3300046681 Ga0495647_0005224 Ga0495647_0005224_526_1062 156
518 3300046684 Ga0495669_0000076 Ga0495669_0000076_27810_28340 156
519 3300046689 Ga0495613_0000005 Ga0495613_0000005_126430_126966 156
520 3300046690 Ga0495624_0055357 Ga0495624_0055357_1701_2237 156
521 3300046809 Ga0495600_0005957 Ga0495600_0005957_3298_3837 156
522 3300047317 Ga0495604_0000067 Ga0495604_0000067_83439_83975 156
523 3300047322 Ga0495680_0097250 Ga0495680_0097250_1262_1798 156
524 3300048903 Ga0496100_0000059 Ga0496100_0000059_12046_12576 156
525 3300048904 Ga0496101_0000135 Ga0496101_0000135_52943_53473 156
526 3300048907 Ga0496104_0000025 Ga0496104_0000025_28106_28636 156
527 3300048908 Ga0496105_0000023 Ga0496105_0000023_28106_28636 156
528 3300048909 Ga0496106_0000252 Ga0496106_0000252_7384_7914 156
529 3300048910 Ga0496107_0000054 Ga0496107_0000054_52943_53473 156
530 3300048910 Ga0496107_0575899 Ga0496107_0575899_190_732 156
531 3300048911 Ga0496108_0000006 Ga0496108_0000006_405699_406229 156
532 3300048912 Ga0496109_0000009 Ga0496109_0000009_172787_173317 156
533 3300048913 Ga0496110_0599167 Ga0496110_0599167_423_965 156
534 3300048914 Ga0496111_0030798 Ga0496111_0030798_3259_3801 156
535 3300048915 Ga0496112_0000025 Ga0496112_0000025_127486_128025 156
536 3300049571 Ga0501034_0156293 Ga0501034_0156293_540_1091 156
537 3300049579 Ga0501043_0140448 Ga0501043_0140448_447_1004 156
538 3300049580 Ga0501046_0450019 Ga0501046_0450019_199_759 156
539 3300049581 Ga0501047_0096965 Ga0501047_0096965_1857_2408 156
540 3300049581 Ga0501047_0278292 Ga0501047_0278292_824_1387 156
541 3300049584 Ga0501068_0099770 Ga0501068_0099770_1117_1680 156
542 3300049585 Ga0501069_0016305 Ga0501069_0016305_86_649 156
543 3300049587 Ga0501071_0552722 Ga0501071_0552722_145_705 156
544 3300049741 Ga0501079_0201236 Ga0501079_0201236_173_733 156
545 3300049742 Ga0501080_0365021 Ga0501080_0365021_159_719 156
546 3300049742 Ga0501080_0769995 Ga0501080_0769995_217_774 156
547 3300049744 Ga0501083_0043407 Ga0501083_0043407_72_632 156
548 3300050494 nmdc:mga06z11_583193_c1 nmdc:mga06z11_583193_c1_57_596 156
549 3300050510 nmdc:mga06r32_193641_c1 nmdc:mga06r32_193641_c1_624_1166 156
550 3300050511 nmdc:mga08y16_592331_c1 nmdc:mga08y16_592331_c1_393_935 156
551 3300053077 Ga0495601_0093870 Ga0495601_0093870_248_772 156
552 3300053083 Ga0495655_0057904 Ga0495655_0057904_491_1033 156
553 3300053084 Ga0495595_0000045 Ga0495595_0000045_40886_41422 156
554 3300053119 Ga0500595_018620 Ga0500595_018620_1843_2403 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02075

RuvC

Crossover junction endodeoxyribonuclease RuvC

4

152

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lw3-assembly1.cif.gz_B crystal structure of ruvc from pseudomonas aeruginosa 0.9173 1 138
7w8d-assembly1.cif.gz_B the structure of deinococcus radiodurans ruvc 0.9066 1 135
6s16-assembly1.cif.gz_A t. thermophilus ruvc in complex with holliday junction substrate 0.9051 1 141
7xhj-assembly1.cif.gz_A crystal structure of ruvc from deinococcus radiodurans 0.8952 2 145
6s16-assembly1.cif.gz_B t. thermophilus ruvc in complex with holliday junction substrate 0.8907 1 145
ID Description Score Start End Superfamily
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9095 2 145 3.30.420.10
4ld0B00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8898 1 145 3.30.420.10
1hjrC00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8811 3 146 3.30.420.10
af_P9WGV9_1_161_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8374 2 145 3.30.420.10
af_F1R2R7_20_151_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8351 50 104 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7C2VSK3-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.9711 2 104 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9MQ23-F1-model_v4 Crossover junction endodeoxyribonuclease RuvC 0.9705 2 70 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A2E7R3F4-F1-model_v4 Uncharacterized protein 0.9698 2 101 GO:0003677
GO:0004520
GO:0006281
GO:0006310
GO:0046872
AF-A0A1X3CGD3-F1-model_v4 deleted 0.9661 2 95
AF-A0A6G3V5B7-F1-model_v4 deleted 0.9645 2 101

Feature Viewer

pLDDT pTM Quality
80.89 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map