F462948
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 554 | 285 | 554 | 165 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10236344|Ga0070666_102363441 |
| Length | 187 |
| Sequence | MQVVMGIDPGAANLGFGVVRVEGNRMVALDGGVVETGPEMPMERRLEKIHTALGELMAWHEPRALALEQVYFGRNVGSAMVVGQASGVAMLAAAQRGIPCTAYTPQAIKMAVCGSGAADKAQVQRMVGTLLGLPEPPTPDHAADALAVAICHGGGEGRRQAVAQSAGASTPSTAGPSKPRFAPRVAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 140 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 142 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 154 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 155 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 156 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 214 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 227 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 265 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 279 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 280 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 281 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 282 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.18 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.33 |
| Nodule | 0 |
| Rhizoplane | 10.65 |
| Rhizosphere | 83.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000066 | 3300001977 | Bacteria | 10886 |
| 2 | JGI24740J21852_10038891 | 3300001979 | Bacteria | 1456 |
| 3 | JGI24751J29686_10080653 | 3300002459 | Bacteria | 674 |
| 4 | JGI25407J50210_10104246 | 3300003373 | Bacteria | 700 |
| 5 | Ga0070683_100006889 | 3300005329 | Bacteria | 9547 |
| 6 | Ga0070683_100029530 | 3300005329 | Bacteria | 4965 |
| 7 | Ga0070683_100040821 | 3300005329 | Bacteria | 4266 |
| 8 | Ga0070683_100125663 | 3300005329 | Bacteria | 2425 |
| 9 | Ga0070666_10236344 | 3300005335 | Bacteria | 1291 |
| 10 | Ga0070682_100000011 | 3300005337 | Bacteria | 266253 |
| 11 | Ga0070682_100000052 | 3300005337 | Bacteria | 118879 |
| 12 | Ga0070682_100451150 | 3300005337 | Bacteria | 985 |
| 13 | Ga0068868_100193814 | 3300005338 | Bacteria | 1691 |
| 14 | Ga0070691_10000138 | 3300005341 | Bacteria | 22836 |
| 15 | Ga0070661_100000058 | 3300005344 | Bacteria | 87363 |
| 16 | Ga0070668_100011596 | 3300005347 | Bacteria | 6561 |
| 17 | Ga0070668_100053864 | 3300005347 | Bacteria | 3102 |
| 18 | Ga0070668_100296340 | 3300005347 | Unclassified | 1355 |
| 19 | Ga0070675_100000036 | 3300005354 | Bacteria | 85959 |
| 20 | Ga0070674_100012503 | 3300005356 | Bacteria | 5214 |
| 21 | Ga0070688_100000228 | 3300005365 | Bacteria | 29601 |
| 22 | Ga0070688_100000360 | 3300005365 | Bacteria | 23047 |
| 23 | Ga0070688_100129950 | 3300005365 | Bacteria | 1698 |
| 24 | Ga0070688_100215996 | 3300005365 | Bacteria | 1349 |
| 25 | Ga0070659_100019249 | 3300005366 | Bacteria | 5169 |
| 26 | Ga0070667_100001076 | 3300005367 | Bacteria | 24988 |
| 27 | Ga0070667_100830801 | 3300005367 | Unclassified | 858 |
| 28 | Ga0070709_10723285 | 3300005434 | Bacteria | 776 |
| 29 | Ga0070714_100010661 | 3300005435 | Bacteria | 7271 |
| 30 | Ga0070713_100000047 | 3300005436 | Bacteria | 76760 |
| 31 | Ga0070713_100743614 | 3300005436 | Bacteria | 938 |
| 32 | Ga0070701_10189878 | 3300005438 | Bacteria | 1208 |
| 33 | Ga0070711_100036522 | 3300005439 | Bacteria | 3291 |
| 34 | Ga0070711_100102386 | 3300005439 | Bacteria | 2086 |
| 35 | Ga0070678_100696433 | 3300005456 | Bacteria | 915 |
| 36 | Ga0070662_100000002 | 3300005457 | Bacteria | 253208 |
| 37 | Ga0070681_10045866 | 3300005458 | Bacteria | 4371 |
| 38 | Ga0068867_100002402 | 3300005459 | Bacteria | 13169 |
| 39 | Ga0070685_10000019 | 3300005466 | Bacteria | 105881 |
| 40 | Ga0070685_10000020 | 3300005466 | Bacteria | 104332 |
| 41 | Ga0070685_10047925 | 3300005466 | Bacteria | 2459 |
| 42 | Ga0070685_10076519 | 3300005466 | Bacteria | 1996 |
| 43 | Ga0070684_100081124 | 3300005535 | Bacteria | 2870 |
| 44 | Ga0070684_100119090 | 3300005535 | Bacteria | 2374 |
| 45 | Ga0070684_100219769 | 3300005535 | Bacteria | 1733 |
| 46 | Ga0070684_100228485 | 3300005535 | Bacteria | 1699 |
| 47 | Ga0070684_100520933 | 3300005535 | Bacteria | 1102 |
| 48 | Ga0070684_100920396 | 3300005535 | Bacteria | 819 |
| 49 | Ga0068853_100320462 | 3300005539 | Bacteria | 1437 |
| 50 | Ga0070672_100000001 | 3300005543 | Bacteria | 204624 |
| 51 | Ga0070686_100237400 | 3300005544 | Unclassified | 1325 |
| 52 | Ga0070693_100000470 | 3300005547 | Bacteria | 18108 |
| 53 | Ga0070665_100028178 | 3300005548 | Bacteria | 5656 |
| 54 | Ga0070665_100045460 | 3300005548 | Bacteria | 4409 |
| 55 | Ga0070665_100107489 | 3300005548 | Bacteria | 2792 |
| 56 | Ga0070665_100204160 | 3300005548 | Bacteria | 1977 |
| 57 | Ga0070665_100242923 | 3300005548 | Bacteria | 1801 |
| 58 | Ga0068855_100592659 | 3300005563 | Bacteria | 1196 |
| 59 | Ga0070664_100293109 | 3300005564 | Unclassified | 1469 |
| 60 | Ga0070664_100826209 | 3300005564 | Unclassified | 867 |
| 61 | Ga0068856_100002498 | 3300005614 | Bacteria | 18913 |
| 62 | Ga0068856_100013571 | 3300005614 | Bacteria | 7887 |
| 63 | Ga0068852_100000002 | 3300005616 | Bacteria | 268221 |
| 64 | Ga0068852_100579401 | 3300005616 | Bacteria | 1125 |
| 65 | Ga0068859_100403446 | 3300005617 | Bacteria | 1463 |
| 66 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 67 | Ga0068866_10000003 | 3300005718 | Bacteria | 281675 |
| 68 | Ga0068866_10849261 | 3300005718 | Bacteria | 638 |
| 69 | Ga0068861_100142746 | 3300005719 | Bacteria | 1956 |
| 70 | Ga0068851_10000730 | 3300005834 | Bacteria | 14041 |
| 71 | Ga0068863_100000022 | 3300005841 | Bacteria | 188278 |
| 72 | Ga0068858_100000118 | 3300005842 | Bacteria | 83359 |
| 73 | Ga0068860_100004743 | 3300005843 | Bacteria | 13853 |
| 74 | Ga0068860_100030106 | 3300005843 | Bacteria | 5221 |
| 75 | Ga0068862_100023531 | 3300005844 | Bacteria | 5163 |
| 76 | Ga0081455_10019712 | 3300005937 | Bacteria | 6370 |
| 77 | Ga0081455_10126628 | 3300005937 | Bacteria | 2003 |
| 78 | Ga0081455_10222993 | 3300005937 | Bacteria | 1396 |
| 79 | Ga0081538_10000812 | 3300005981 | Bacteria | 33866 |
| 80 | Ga0075365_10015429 | 3300006038 | Bacteria | 4623 |
| 81 | Ga0075365_10057875 | 3300006038 | Bacteria | 2579 |
| 82 | Ga0075365_10090699 | 3300006038 | Bacteria | 2082 |
| 83 | Ga0075363_100029719 | 3300006048 | Bacteria | 2823 |
| 84 | Ga0075363_100169532 | 3300006048 | Bacteria | 1239 |
| 85 | Ga0075363_100226182 | 3300006048 | Bacteria | 1073 |
| 86 | Ga0075364_10089117 | 3300006051 | Bacteria | 2046 |
| 87 | Ga0075364_10223369 | 3300006051 | Unclassified | 1279 |
| 88 | Ga0075364_10246715 | 3300006051 | Bacteria | 1213 |
| 89 | Ga0070715_10000029 | 3300006163 | Bacteria | 88994 |
| 90 | Ga0070715_10053407 | 3300006163 | Bacteria | 1746 |
| 91 | Ga0070712_100079139 | 3300006175 | Bacteria | 2375 |
| 92 | Ga0075367_10154694 | 3300006178 | Bacteria | 1424 |
| 93 | Ga0075367_10471481 | 3300006178 | Bacteria | 796 |
| 94 | Ga0068871_100146311 | 3300006358 | Bacteria | 2012 |
| 95 | Ga0075428_100122655 | 3300006844 | Bacteria | 2829 |
| 96 | Ga0075430_100128225 | 3300006846 | Bacteria | 2115 |
| 97 | Ga0075431_100004050 | 3300006847 | Bacteria | 14282 |
| 98 | Ga0075431_100288537 | 3300006847 | Bacteria | 1660 |
| 99 | Ga0075433_10003354 | 3300006852 | Bacteria | 12382 |
| 100 | Ga0075429_100848079 | 3300006880 | Bacteria | 800 |
| 101 | Ga0068865_100174445 | 3300006881 | Bacteria | 1651 |
| 102 | Ga0097620_100403477 | 3300006931 | Bacteria | 1463 |
| 103 | Ga0105240_10246468 | 3300009093 | Bacteria | 2069 |
| 104 | Ga0105240_11325785 | 3300009093 | Bacteria | 758 |
| 105 | Ga0111539_10623848 | 3300009094 | Bacteria | 1255 |
| 106 | Ga0105245_10000125 | 3300009098 | Bacteria | 73764 |
| 107 | Ga0105245_10000517 | 3300009098 | Bacteria | 35353 |
| 108 | Ga0105245_10006331 | 3300009098 | Bacteria | 10415 |
| 109 | Ga0105247_10001978 | 3300009101 | Bacteria | 14224 |
| 110 | Ga0105247_10362980 | 3300009101 | Bacteria | 1022 |
| 111 | Ga0105247_10553414 | 3300009101 | Bacteria | 846 |
| 112 | Ga0105247_10704565 | 3300009101 | Bacteria | 760 |
| 113 | Ga0114129_10068282 | 3300009147 | Bacteria | 4956 |
| 114 | Ga0114129_11161178 | 3300009147 | Bacteria | 964 |
| 115 | Ga0105243_10028685 | 3300009148 | Bacteria | 4274 |
| 116 | Ga0105243_10043619 | 3300009148 | Bacteria | 3515 |
| 117 | Ga0105241_10317193 | 3300009174 | Bacteria | 1343 |
| 118 | Ga0105242_10347093 | 3300009176 | Bacteria | 1370 |
| 119 | Ga0105242_10744973 | 3300009176 | Bacteria | 964 |
| 120 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 121 | Ga0105248_10893919 | 3300009177 | Unclassified | 1003 |
| 122 | Ga0105249_10000178 | 3300009553 | Bacteria | 74768 |
| 123 | Ga0105249_10345303 | 3300009553 | Bacteria | 1506 |
| 124 | Ga0105239_10528827 | 3300010375 | Bacteria | 1342 |
| 125 | Ga0157369_10000307 | 3300013105 | Bacteria | 65486 |
| 126 | Ga0157378_10010221 | 3300013297 | Bacteria | 8191 |
| 127 | Ga0163162_10122210 | 3300013306 | Bacteria | 2709 |
| 128 | Ga0163162_10755197 | 3300013306 | Bacteria | 1092 |
| 129 | Ga0157372_10000053 | 3300013307 | Bacteria | 128824 |
| 130 | Ga0157375_10090838 | 3300013308 | Bacteria | 3114 |
| 131 | Ga0157375_10188698 | 3300013308 | Bacteria | 2216 |
| 132 | Ga0163163_10308401 | 3300014325 | Bacteria | 1635 |
| 133 | Ga0157380_10000016 | 3300014326 | Bacteria | 126029 |
| 134 | Ga0157380_10000236 | 3300014326 | Bacteria | 33220 |
| 135 | Ga0157380_10120059 | 3300014326 | Bacteria | 2225 |
| 136 | Ga0157380_10777583 | 3300014326 | Bacteria | 972 |
| 137 | Ga0157377_10127253 | 3300014745 | Bacteria | 1551 |
| 138 | Ga0157379_10002058 | 3300014968 | Bacteria | 16705 |
| 139 | Ga0157379_10019326 | 3300014968 | Bacteria | 6017 |
| 140 | Ga0157379_10059769 | 3300014968 | Bacteria | 3408 |
| 141 | Ga0157376_10020564 | 3300014969 | Bacteria | 5109 |
| 142 | Ga0157376_10056242 | 3300014969 | Bacteria | 3286 |
| 143 | Ga0163161_10000022 | 3300017792 | Bacteria | 207890 |
| 144 | Ga0163161_10047839 | 3300017792 | Bacteria | 3088 |
| 145 | Ga0206353_11016966 | 3300020082 | Bacteria | 2209 |
| 146 | Ga0207682_10000155 | 3300025893 | Bacteria | 31180 |
| 147 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 148 | Ga0207710_10000821 | 3300025900 | Bacteria | 16775 |
| 149 | Ga0207710_10320245 | 3300025900 | Bacteria | 786 |
| 150 | Ga0207680_10095594 | 3300025903 | Bacteria | 1899 |
| 151 | Ga0207680_10109162 | 3300025903 | Bacteria | 1791 |
| 152 | Ga0207685_10000031 | 3300025905 | Bacteria | 77451 |
| 153 | Ga0207685_10025723 | 3300025905 | Bacteria | 2036 |
| 154 | Ga0207695_10188274 | 3300025913 | Bacteria | 1982 |
| 155 | Ga0207695_10309585 | 3300025913 | Bacteria | 1469 |
| 156 | Ga0207693_10069081 | 3300025915 | Bacteria | 2765 |
| 157 | Ga0207663_10033961 | 3300025916 | Bacteria | 3045 |
| 158 | Ga0207660_10062694 | 3300025917 | Bacteria | 2679 |
| 159 | Ga0207649_10000283 | 3300025920 | Bacteria | 39628 |
| 160 | Ga0207652_10003850 | 3300025921 | Bacteria | 12292 |
| 161 | Ga0207659_10000013 | 3300025926 | Bacteria | 172742 |
| 162 | Ga0207687_10000017 | 3300025927 | Bacteria | 237310 |
| 163 | Ga0207687_10000085 | 3300025927 | Bacteria | 68919 |
| 164 | Ga0207700_10000033 | 3300025928 | Bacteria | 123113 |
| 165 | Ga0207664_10092298 | 3300025929 | Bacteria | 2485 |
| 166 | Ga0207690_10185115 | 3300025932 | Unclassified | 1571 |
| 167 | Ga0207706_10000001 | 3300025933 | Bacteria | 423014 |
| 168 | Ga0207686_10001016 | 3300025934 | Bacteria | 16619 |
| 169 | Ga0207686_10104065 | 3300025934 | Bacteria | 1901 |
| 170 | Ga0207686_10126611 | 3300025934 | Bacteria | 1747 |
| 171 | Ga0207709_10019598 | 3300025935 | Bacteria | 3808 |
| 172 | Ga0207670_10005811 | 3300025936 | Bacteria | 6811 |
| 173 | Ga0207669_10000001 | 3300025937 | Bacteria | 377747 |
| 174 | Ga0207669_10318107 | 3300025937 | Bacteria | 1190 |
| 175 | Ga0207665_10041758 | 3300025939 | Bacteria | 3065 |
| 176 | Ga0207691_10000017 | 3300025940 | Bacteria | 134441 |
| 177 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 178 | Ga0207661_10000198 | 3300025944 | Bacteria | 39018 |
| 179 | Ga0207661_10010942 | 3300025944 | Bacteria | 6551 |
| 180 | Ga0207661_10029396 | 3300025944 | Bacteria | 4220 |
| 181 | Ga0207661_10051438 | 3300025944 | Bacteria | 3287 |
| 182 | Ga0207679_10057120 | 3300025945 | Bacteria | 2885 |
| 183 | Ga0207667_11234283 | 3300025949 | Bacteria | 726 |
| 184 | Ga0207712_10007734 | 3300025961 | Bacteria | 6796 |
| 185 | Ga0207712_10255543 | 3300025961 | Bacteria | 1418 |
| 186 | Ga0207668_10005384 | 3300025972 | Bacteria | 7532 |
| 187 | Ga0207668_10062039 | 3300025972 | Bacteria | 2631 |
| 188 | Ga0207668_10248905 | 3300025972 | Unclassified | 1442 |
| 189 | Ga0207658_10003877 | 3300025986 | Bacteria | 10532 |
| 190 | Ga0207658_10201760 | 3300025986 | Bacteria | 1661 |
| 191 | Ga0207677_10000397 | 3300026023 | Bacteria | 29959 |
| 192 | Ga0207703_10000061 | 3300026035 | Bacteria | 132671 |
| 193 | Ga0207703_10766853 | 3300026035 | Bacteria | 920 |
| 194 | Ga0207639_10012718 | 3300026041 | Bacteria | 5870 |
| 195 | Ga0207639_10015804 | 3300026041 | Bacteria | 5329 |
| 196 | Ga0207702_10000637 | 3300026078 | Bacteria | 38379 |
| 197 | Ga0207702_10009958 | 3300026078 | Bacteria | 7970 |
| 198 | Ga0207702_10018008 | 3300026078 | Bacteria | 5847 |
| 199 | Ga0207702_10120669 | 3300026078 | Bacteria | 2346 |
| 200 | Ga0207641_10000016 | 3300026088 | Bacteria | 307363 |
| 201 | Ga0207641_10910115 | 3300026088 | Bacteria | 874 |
| 202 | Ga0207648_10003501 | 3300026089 | Bacteria | 16446 |
| 203 | Ga0207648_10680491 | 3300026089 | Unclassified | 952 |
| 204 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 205 | Ga0207676_10713111 | 3300026095 | Bacteria | 973 |
| 206 | Ga0207675_100251659 | 3300026118 | Bacteria | 1710 |
| 207 | Ga0207683_10027545 | 3300026121 | Bacteria | 4910 |
| 208 | Ga0207683_10068028 | 3300026121 | Bacteria | 3143 |
| 209 | Ga0207698_10000004 | 3300026142 | Bacteria | 313614 |
| 210 | Ga0207698_10230458 | 3300026142 | Bacteria | 1681 |
| 211 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 212 | Ga0268266_10000601 | 3300028379 | Bacteria | 49250 |
| 213 | Ga0268266_10001254 | 3300028379 | Bacteria | 31003 |
| 214 | Ga0268266_10030794 | 3300028379 | Bacteria | 4557 |
| 215 | Ga0268266_10196858 | 3300028379 | Bacteria | 1843 |
| 216 | Ga0268266_10229242 | 3300028379 | Bacteria | 1710 |
| 217 | Ga0268266_10265674 | 3300028379 | Bacteria | 1591 |
| 218 | Ga0268265_10004453 | 3300028380 | Bacteria | 9721 |
| 219 | Ga0268265_10687215 | 3300028380 | Bacteria | 987 |
| 220 | Ga0268264_10002435 | 3300028381 | Bacteria | 16359 |
| 221 | Ga0268264_10127452 | 3300028381 | Bacteria | 2252 |
| 222 | Ga0265337_1000066 | 3300028556 | Bacteria | 48673 |
| 223 | Ga0265326_10000019 | 3300028558 | Bacteria | 137370 |
| 224 | Ga0265319_1000469 | 3300028563 | Bacteria | 28589 |
| 225 | Ga0265334_10231623 | 3300028573 | Unclassified | 638 |
| 226 | Ga0265322_10000011 | 3300028654 | Bacteria | 167597 |
| 227 | Ga0265336_10020373 | 3300028666 | Bacteria | 2129 |
| 228 | Ga0265338_10000244 | 3300028800 | Bacteria | 100528 |
| 229 | Ga0265338_10223812 | 3300028800 | Bacteria | 1404 |
| 230 | Ga0265324_10000283 | 3300029957 | Bacteria | 37587 |
| 231 | Ga0265332_10018240 | 3300031238 | Bacteria | 3096 |
| 232 | Ga0265328_10011111 | 3300031239 | Bacteria | 3605 |
| 233 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 234 | Ga0265325_10064475 | 3300031241 | Bacteria | 1852 |
| 235 | Ga0265331_10000858 | 3300031250 | Bacteria | 24739 |
| 236 | Ga0265331_10011583 | 3300031250 | Bacteria | 4824 |
| 237 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 238 | Ga0265316_10022934 | 3300031344 | Bacteria | 5252 |
| 239 | Ga0265314_10003522 | 3300031711 | Bacteria | 15112 |
| 240 | Ga0265342_10273785 | 3300031712 | Bacteria | 895 |
| 241 | Ga0307409_100099008 | 3300031995 | Bacteria | 2413 |
| 242 | Ga0307409_101559992 | 3300031995 | Bacteria | 688 |
| 243 | Ga0307415_100017498 | 3300032126 | Bacteria | 4301 |
| 244 | Ga0307415_100341209 | 3300032126 | Bacteria | 1257 |
| 245 | Ga0373955_0278069 | 3300035172 | Bacteria | 1007 |
| 246 | Ga0316574_0008333 | 3300035398 | Bacteria | 5752 |
| 247 | Ga0316574_0066284 | 3300035398 | Bacteria | 2275 |
| 248 | Ga0316574_0233038 | 3300035398 | Bacteria | 1178 |
| 249 | Ga0373937_0013210 | 3300036401 | Bacteria | 7271 |
| 250 | Ga0373937_0686503 | 3300036401 | Bacteria | 970 |
| 251 | Ga0395901_0720252 | 3300038443 | Bacteria | 993 |
| 252 | Ga0451793_1852320 | 3300041452 | Unclassified | 728 |
| 253 | Ga0451807_0093928 | 3300041486 | Bacteria | 1245 |
| 254 | Ga0451849_0264818 | 3300041505 | Bacteria | 1604 |
| 255 | Ga0466960_0119260 | 3300044901 | Bacteria | 1380 |
| 256 | Ga0466958_0023118 | 3300045836 | Bacteria | 3646 |
| 257 | Ga0466967_0164558 | 3300045976 | Bacteria | 2084 |
| 258 | Ga0466967_0731377 | 3300045976 | Unclassified | 981 |
| 259 | Ga0466967_1427255 | 3300045976 | Bacteria | 689 |
| 260 | Ga0495603_0004009 | 3300046455 | Bacteria | 8766 |
| 261 | Ga0495629_0000487 | 3300046459 | Bacteria | 33176 |
| 262 | Ga0495629_0013987 | 3300046459 | Bacteria | 5785 |
| 263 | Ga0495629_0561095 | 3300046459 | Bacteria | 766 |
| 264 | Ga0495638_0467004 | 3300046460 | Bacteria | 641 |
| 265 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 266 | Ga0495641_0010781 | 3300046461 | Bacteria | 5260 |
| 267 | Ga0495641_0042190 | 3300046461 | Bacteria | 2116 |
| 268 | Ga0495651_0520748 | 3300046462 | Bacteria | 759 |
| 269 | Ga0495653_0048901 | 3300046463 | Bacteria | 3261 |
| 270 | Ga0495653_0470652 | 3300046463 | Bacteria | 787 |
| 271 | Ga0495582_0000001 | 3300046473 | Bacteria | 252434 |
| 272 | Ga0495639_0265560 | 3300046475 | Bacteria | 851 |
| 273 | Ga0495662_0000001 | 3300046476 | Bacteria | 179185 |
| 274 | Ga0495662_0039759 | 3300046476 | Bacteria | 2272 |
| 275 | Ga0495594_0229451 | 3300046499 | Bacteria | 1058 |
| 276 | Ga0495606_0000040 | 3300046507 | Bacteria | 223500 |
| 277 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 278 | Ga0495608_0001804 | 3300046511 | Bacteria | 15293 |
| 279 | Ga0495608_0185622 | 3300046511 | Unclassified | 1314 |
| 280 | Ga0495608_0393053 | 3300046511 | Unclassified | 849 |
| 281 | Ga0495618_0000014 | 3300046514 | Bacteria | 163136 |
| 282 | Ga0495620_0001374 | 3300046515 | Bacteria | 14672 |
| 283 | Ga0495628_0000859 | 3300046516 | Bacteria | 28076 |
| 284 | Ga0495628_0011208 | 3300046516 | Bacteria | 7585 |
| 285 | Ga0495628_0040772 | 3300046516 | Bacteria | 3709 |
| 286 | Ga0495628_0164584 | 3300046516 | Bacteria | 1684 |
| 287 | Ga0495628_0288887 | 3300046516 | Bacteria | 1216 |
| 288 | Ga0495628_0293831 | 3300046516 | Bacteria | 1204 |
| 289 | Ga0495628_0358590 | 3300046516 | Bacteria | 1071 |
| 290 | Ga0495628_0504280 | 3300046516 | Bacteria | 873 |
| 291 | Ga0495630_0000014 | 3300046517 | Bacteria | 217229 |
| 292 | Ga0495630_0010638 | 3300046517 | Bacteria | 6642 |
| 293 | Ga0495630_0141133 | 3300046517 | Bacteria | 1832 |
| 294 | Ga0495630_0546115 | 3300046517 | Bacteria | 888 |
| 295 | Ga0495644_0001062 | 3300046523 | Bacteria | 11440 |
| 296 | Ga0495652_0000010 | 3300046529 | Bacteria | 261584 |
| 297 | Ga0495652_0031927 | 3300046529 | Bacteria | 4609 |
| 298 | Ga0495652_0328202 | 3300046529 | Bacteria | 1103 |
| 299 | Ga0495640_0082037 | 3300046533 | Bacteria | 2143 |
| 300 | Ga0495640_0260844 | 3300046533 | Bacteria | 1083 |
| 301 | Ga0495586_0000083 | 3300046535 | Bacteria | 57851 |
| 302 | Ga0495586_0136247 | 3300046535 | Bacteria | 1376 |
| 303 | Ga0495586_0295726 | 3300046535 | Bacteria | 927 |
| 304 | Ga0495587_0028775 | 3300046536 | Bacteria | 3376 |
| 305 | Ga0495621_0001691 | 3300046539 | Bacteria | 5781 |
| 306 | Ga0495645_0006168 | 3300046543 | Bacteria | 8300 |
| 307 | Ga0495645_0016131 | 3300046543 | Bacteria | 5325 |
| 308 | Ga0495622_0000218 | 3300046557 | Bacteria | 45469 |
| 309 | Ga0495656_0000753 | 3300046615 | Bacteria | 10458 |
| 310 | Ga0495668_0031092 | 3300046616 | Bacteria | 3009 |
| 311 | Ga0495634_0002567 | 3300046642 | Bacteria | 14991 |
| 312 | Ga0495634_0004632 | 3300046642 | Bacteria | 10731 |
| 313 | Ga0495635_0000031 | 3300046663 | Bacteria | 110244 |
| 314 | Ga0495635_0010132 | 3300046663 | Bacteria | 6592 |
| 315 | Ga0495635_0083646 | 3300046663 | Bacteria | 2184 |
| 316 | Ga0495635_0431862 | 3300046663 | Bacteria | 872 |
| 317 | Ga0495588_0003659 | 3300046674 | Bacteria | 6725 |
| 318 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 319 | Ga0495657_0065142 | 3300046675 | Bacteria | 2397 |
| 320 | Ga0495599_0015716 | 3300046678 | Bacteria | 4698 |
| 321 | Ga0495623_0377639 | 3300046679 | Unclassified | 767 |
| 322 | Ga0495646_0367887 | 3300046680 | Bacteria | 751 |
| 323 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 324 | Ga0495647_0005224 | 3300046681 | Bacteria | 4254 |
| 325 | Ga0495647_0006447 | 3300046681 | Bacteria | 3885 |
| 326 | Ga0495658_0000002 | 3300046683 | Bacteria | 309651 |
| 327 | Ga0495658_0003808 | 3300046683 | Bacteria | 7472 |
| 328 | Ga0495669_0000076 | 3300046684 | Bacteria | 65203 |
| 329 | Ga0495669_0058551 | 3300046684 | Bacteria | 1739 |
| 330 | Ga0495613_0000005 | 3300046689 | Bacteria | 222558 |
| 331 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 332 | Ga0495624_0000019 | 3300046690 | Bacteria | 102237 |
| 333 | Ga0495624_0000286 | 3300046690 | Bacteria | 39940 |
| 334 | Ga0495624_0055357 | 3300046690 | Bacteria | 2499 |
| 335 | Ga0495649_0013634 | 3300046694 | Bacteria | 4684 |
| 336 | Ga0495600_0005957 | 3300046809 | Bacteria | 7378 |
| 337 | Ga0495600_0295586 | 3300046809 | Bacteria | 1023 |
| 338 | Ga0495604_0000067 | 3300047317 | Bacteria | 90345 |
| 339 | Ga0495604_0000239 | 3300047317 | Bacteria | 49113 |
| 340 | Ga0495604_0022899 | 3300047317 | Bacteria | 4985 |
| 341 | Ga0495604_0068381 | 3300047317 | Bacteria | 2696 |
| 342 | Ga0495674_0002248 | 3300047319 | Bacteria | 18976 |
| 343 | Ga0495674_0888685 | 3300047319 | Bacteria | 688 |
| 344 | Ga0495676_0000238 | 3300047321 | Bacteria | 44160 |
| 345 | Ga0495676_0001364 | 3300047321 | Bacteria | 21008 |
| 346 | Ga0495676_0054980 | 3300047321 | Bacteria | 3160 |
| 347 | Ga0495676_0403087 | 3300047321 | Unclassified | 907 |
| 348 | Ga0495680_0000488 | 3300047322 | Bacteria | 44631 |
| 349 | Ga0495680_0067441 | 3300047322 | Bacteria | 2736 |
| 350 | Ga0495680_0097250 | 3300047322 | Bacteria | 2198 |
| 351 | Ga0495680_0202624 | 3300047322 | Bacteria | 1423 |
| 352 | Ga0495680_0328578 | 3300047322 | Bacteria | 1069 |
| 353 | Ga0495675_0000300 | 3300047444 | Bacteria | 35530 |
| 354 | Ga0495679_010122 | 3300047446 | Bacteria | 3724 |
| 355 | Ga0495684_0144274 | 3300047471 | Bacteria | 1784 |
| 356 | Ga0495684_0284698 | 3300047471 | Bacteria | 1191 |
| 357 | Ga0495686_0592963 | 3300047472 | Bacteria | 575 |
| 358 | Ga0495602_0000007 | 3300048088 | Bacteria | 273212 |
| 359 | Ga0495602_0123795 | 3300048088 | Bacteria | 2075 |
| 360 | Ga0495602_0268344 | 3300048088 | Bacteria | 1262 |
| 361 | Ga0495602_0633294 | 3300048088 | Unclassified | 732 |
| 362 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 363 | Ga0496100_0000059 | 3300048903 | Bacteria | 65518 |
| 364 | Ga0496100_0060978 | 3300048903 | Bacteria | 2484 |
| 365 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 366 | Ga0496101_0000135 | 3300048904 | Bacteria | 65518 |
| 367 | Ga0496101_0092777 | 3300048904 | Bacteria | 2248 |
| 368 | Ga0496102_0007757 | 3300048905 | Bacteria | 9172 |
| 369 | Ga0496102_0058427 | 3300048905 | Bacteria | 3524 |
| 370 | Ga0496102_0237671 | 3300048905 | Bacteria | 1718 |
| 371 | Ga0496102_1198837 | 3300048905 | Bacteria | 679 |
| 372 | Ga0496103_0046543 | 3300048906 | Bacteria | 2679 |
| 373 | Ga0496103_0173659 | 3300048906 | Bacteria | 1384 |
| 374 | Ga0496104_0000015 | 3300048907 | Bacteria | 374530 |
| 375 | Ga0496104_0000025 | 3300048907 | Bacteria | 228519 |
| 376 | Ga0496104_0141520 | 3300048907 | Bacteria | 2311 |
| 377 | Ga0496104_0294527 | 3300048907 | Bacteria | 1535 |
| 378 | Ga0496105_0000004 | 3300048908 | Bacteria | 475798 |
| 379 | Ga0496105_0000023 | 3300048908 | Bacteria | 156126 |
| 380 | Ga0496105_0003407 | 3300048908 | Bacteria | 11762 |
| 381 | Ga0496106_0000056 | 3300048909 | Bacteria | 90682 |
| 382 | Ga0496106_0000252 | 3300048909 | Bacteria | 37666 |
| 383 | Ga0496106_0329593 | 3300048909 | Bacteria | 1225 |
| 384 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 385 | Ga0496107_0000054 | 3300048910 | Bacteria | 60902 |
| 386 | Ga0496107_0020295 | 3300048910 | Bacteria | 4692 |
| 387 | Ga0496107_0575899 | 3300048910 | Bacteria | 833 |
| 388 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 389 | Ga0496108_0000063 | 3300048911 | Bacteria | 118950 |
| 390 | Ga0496108_0050687 | 3300048911 | Bacteria | 3475 |
| 391 | Ga0496108_0329990 | 3300048911 | Bacteria | 1330 |
| 392 | Ga0496108_0479575 | 3300048911 | Bacteria | 1087 |
| 393 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 394 | Ga0496109_0000012 | 3300048912 | Bacteria | 229699 |
| 395 | Ga0496109_0000173 | 3300048912 | Bacteria | 63867 |
| 396 | Ga0496109_0245245 | 3300048912 | Bacteria | 1686 |
| 397 | Ga0496109_0328389 | 3300048912 | Bacteria | 1444 |
| 398 | Ga0496110_0169046 | 3300048913 | Bacteria | 1983 |
| 399 | Ga0496110_0193959 | 3300048913 | Bacteria | 1844 |
| 400 | Ga0496110_0254218 | 3300048913 | Bacteria | 1599 |
| 401 | Ga0496110_0599167 | 3300048913 | Bacteria | 1000 |
| 402 | Ga0496111_0011379 | 3300048914 | Bacteria | 5992 |
| 403 | Ga0496111_0030798 | 3300048914 | Bacteria | 3817 |
| 404 | Ga0496111_0043971 | 3300048914 | Bacteria | 3211 |
| 405 | Ga0496111_0281833 | 3300048914 | Bacteria | 1233 |
| 406 | Ga0496111_0403090 | 3300048914 | Bacteria | 1010 |
| 407 | Ga0496111_0685744 | 3300048914 | Bacteria | 746 |
| 408 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 409 | Ga0496112_0134993 | 3300048915 | Bacteria | 2438 |
| 410 | Ga0496113_0058962 | 3300048916 | Bacteria | 2890 |
| 411 | Ga0496113_0075001 | 3300048916 | Bacteria | 2580 |
| 412 | Ga0496113_0226905 | 3300048916 | Bacteria | 1489 |
| 413 | Ga0496113_0321553 | 3300048916 | Bacteria | 1240 |
| 414 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 415 | Ga0496114_0006763 | 3300048917 | Bacteria | 9033 |
| 416 | Ga0496114_0167511 | 3300048917 | Bacteria | 1913 |
| 417 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 418 | Ga0496115_0000377 | 3300048918 | Bacteria | 36788 |
| 419 | Ga0496116_0000331 | 3300048919 | Bacteria | 76536 |
| 420 | Ga0496117_0005451 | 3300048920 | Bacteria | 13352 |
| 421 | Ga0496118_0002916 | 3300048921 | Bacteria | 22218 |
| 422 | Ga0496119_0002281 | 3300048922 | Bacteria | 21246 |
| 423 | Ga0496119_0030358 | 3300048922 | Bacteria | 3646 |
| 424 | Ga0496120_0001336 | 3300048923 | Bacteria | 30395 |
| 425 | Ga0496121_0114547 | 3300048924 | Bacteria | 2049 |
| 426 | Ga0496125_0023403 | 3300048928 | Bacteria | 5702 |
| 427 | Ga0501031_0086399 | 3300049568 | Bacteria | 2045 |
| 428 | Ga0501032_0118989 | 3300049569 | Bacteria | 1746 |
| 429 | Ga0501033_0000554 | 3300049570 | Bacteria | 34825 |
| 430 | Ga0501034_0021453 | 3300049571 | Bacteria | 6584 |
| 431 | Ga0501034_0156293 | 3300049571 | Bacteria | 2254 |
| 432 | Ga0501036_0000336 | 3300049572 | Bacteria | 32902 |
| 433 | Ga0501037_0000425 | 3300049573 | Bacteria | 34779 |
| 434 | Ga0501037_0274041 | 3300049573 | Bacteria | 1177 |
| 435 | Ga0501038_0004922 | 3300049574 | Bacteria | 12405 |
| 436 | Ga0501038_0343788 | 3300049574 | Unclassified | 1163 |
| 437 | Ga0501039_0032026 | 3300049575 | Bacteria | 4053 |
| 438 | Ga0501039_0348696 | 3300049575 | Unclassified | 1163 |
| 439 | Ga0501040_0133309 | 3300049576 | Bacteria | 1748 |
| 440 | Ga0501040_0164910 | 3300049576 | Bacteria | 1567 |
| 441 | Ga0501040_0196031 | 3300049576 | Bacteria | 1434 |
| 442 | Ga0501040_0273226 | 3300049576 | Bacteria | 1207 |
| 443 | Ga0501041_0022711 | 3300049577 | Bacteria | 3758 |
| 444 | Ga0501042_0024403 | 3300049578 | Bacteria | 4241 |
| 445 | Ga0501042_0035274 | 3300049578 | Bacteria | 3548 |
| 446 | Ga0501042_0053429 | 3300049578 | Bacteria | 2882 |
| 447 | Ga0501042_0085396 | 3300049578 | Bacteria | 2263 |
| 448 | Ga0501043_0000516 | 3300049579 | Bacteria | 34780 |
| 449 | Ga0501043_0140448 | 3300049579 | Unclassified | 1892 |
| 450 | Ga0501043_1293128 | 3300049579 | Bacteria | 509 |
| 451 | Ga0501046_0004627 | 3300049580 | Bacteria | 12430 |
| 452 | Ga0501046_0434054 | 3300049580 | Bacteria | 946 |
| 453 | Ga0501046_0450019 | 3300049580 | Bacteria | 926 |
| 454 | Ga0501047_0000706 | 3300049581 | Bacteria | 34791 |
| 455 | Ga0501047_0088155 | 3300049581 | Bacteria | 2980 |
| 456 | Ga0501047_0096965 | 3300049581 | Bacteria | 2827 |
| 457 | Ga0501047_0278292 | 3300049581 | Bacteria | 1518 |
| 458 | Ga0501047_0633501 | 3300049581 | Bacteria | 889 |
| 459 | Ga0501048_0000269 | 3300049582 | Bacteria | 34831 |
| 460 | Ga0501048_0126799 | 3300049582 | Bacteria | 1805 |
| 461 | Ga0501067_0026243 | 3300049583 | Bacteria | 3228 |
| 462 | Ga0501067_0112353 | 3300049583 | Bacteria | 1515 |
| 463 | Ga0501068_0099770 | 3300049584 | Bacteria | 1799 |
| 464 | Ga0501068_0104644 | 3300049584 | Bacteria | 1756 |
| 465 | Ga0501068_0167710 | 3300049584 | Bacteria | 1385 |
| 466 | Ga0501068_0172894 | 3300049584 | Bacteria | 1364 |
| 467 | Ga0501069_0016305 | 3300049585 | Bacteria | 3988 |
| 468 | Ga0501069_0086320 | 3300049585 | Bacteria | 1771 |
| 469 | Ga0501070_0000649 | 3300049586 | Bacteria | 31969 |
| 470 | Ga0501070_0005184 | 3300049586 | Bacteria | 11101 |
| 471 | Ga0501071_0173713 | 3300049587 | Unclassified | 1613 |
| 472 | Ga0501071_0391507 | 3300049587 | Bacteria | 1060 |
| 473 | Ga0501071_0552722 | 3300049587 | Bacteria | 884 |
| 474 | Ga0501072_0046569 | 3300049588 | Bacteria | 3413 |
| 475 | Ga0501072_0077017 | 3300049588 | Bacteria | 2640 |
| 476 | Ga0501072_0081105 | 3300049588 | Bacteria | 2571 |
| 477 | Ga0501073_0003135 | 3300049589 | Bacteria | 12393 |
| 478 | Ga0501074_0003386 | 3300049590 | Bacteria | 11290 |
| 479 | Ga0501075_0039702 | 3300049591 | Bacteria | 3522 |
| 480 | Ga0501075_0131077 | 3300049591 | Bacteria | 1910 |
| 481 | Ga0501075_0485463 | 3300049591 | Bacteria | 942 |
| 482 | Ga0501076_0771163 | 3300049592 | Unclassified | 793 |
| 483 | Ga0501079_0155838 | 3300049741 | Bacteria | 1780 |
| 484 | Ga0501079_0201236 | 3300049741 | Bacteria | 1555 |
| 485 | Ga0501079_0368212 | 3300049741 | Bacteria | 1126 |
| 486 | Ga0501079_0505434 | 3300049741 | Bacteria | 950 |
| 487 | Ga0501080_0218983 | 3300049742 | Bacteria | 1742 |
| 488 | Ga0501080_0365021 | 3300049742 | Bacteria | 1302 |
| 489 | Ga0501080_0446818 | 3300049742 | Bacteria | 1159 |
| 490 | Ga0501080_0769995 | 3300049742 | Bacteria | 845 |
| 491 | Ga0501081_0159784 | 3300049743 | Unclassified | 1623 |
| 492 | Ga0501081_0405033 | 3300049743 | Bacteria | 1010 |
| 493 | Ga0501083_0043407 | 3300049744 | Bacteria | 3046 |
| 494 | Ga0501083_0117920 | 3300049744 | Bacteria | 1741 |
| 495 | Ga0501083_0769851 | 3300049744 | Bacteria | 626 |
| 496 | Ga0501035_0000754 | 3300049822 | Bacteria | 34845 |
| 497 | Ga0501044_0000947 | 3300049823 | Bacteria | 34821 |
| 498 | Ga0501045_0030766 | 3300049824 | Bacteria | 3886 |
| 499 | Ga0501045_0135987 | 3300049824 | Bacteria | 1827 |
| 500 | Ga0501045_0161594 | 3300049824 | Bacteria | 1667 |
| 501 | Ga0501045_0379729 | 3300049824 | Bacteria | 1052 |
| 502 | nmdc:mga03n38_133936_c1 | 3300050490 | Bacteria | 1231 |
| 503 | nmdc:mga00v17_142051_c1 | 3300050491 | Bacteria | 1540 |
| 504 | nmdc:mga00v17_151737_c1 | 3300050491 | Unclassified | 1489 |
| 505 | nmdc:mga00v17_193691_c1 | 3300050491 | Unclassified | 1313 |
| 506 | nmdc:mga0yw44_256837_c1 | 3300050492 | Bacteria | 1164 |
| 507 | nmdc:mga0yw44_34692_c1 | 3300050492 | Bacteria | 2958 |
| 508 | nmdc:mga06z11_583193_c1 | 3300050494 | Bacteria | 680 |
| 509 | nmdc:mga04h51_368366_c1 | 3300050495 | Unclassified | 597 |
| 510 | nmdc:mga05p37_1341477_c1 | 3300050507 | Bacteria | 725 |
| 511 | nmdc:mga05p37_61160_c1 | 3300050507 | Bacteria | 4636 |
| 512 | nmdc:mga09592_128011_c1 | 3300050508 | Bacteria | 2183 |
| 513 | nmdc:mga0qj67_183762_c1 | 3300050509 | Bacteria | 1698 |
| 514 | nmdc:mga0qj67_204503_c1 | 3300050509 | Bacteria | 1604 |
| 515 | nmdc:mga06r32_193641_c1 | 3300050510 | Bacteria | 2020 |
| 516 | nmdc:mga06r32_42620_c1 | 3300050510 | Bacteria | 4317 |
| 517 | nmdc:mga06r32_630199_c1 | 3300050510 | Bacteria | 1041 |
| 518 | nmdc:mga08y16_592331_c1 | 3300050511 | Bacteria | 1118 |
| 519 | nmdc:mga0rr50_654304_c1 | 3300050513 | Unclassified | 897 |
| 520 | nmdc:mga0a205_53_c2 | 3300050515 | Bacteria | 54696 |
| 521 | Ga0495601_0001218 | 3300053077 | Bacteria | 14090 |
| 522 | Ga0495601_0049461 | 3300053077 | Bacteria | 2650 |
| 523 | Ga0495601_0093870 | 3300053077 | Bacteria | 1933 |
| 524 | Ga0495601_0223009 | 3300053077 | Bacteria | 1231 |
| 525 | Ga0495601_0349120 | 3300053077 | Bacteria | 962 |
| 526 | Ga0495612_0000067 | 3300053078 | Bacteria | 47307 |
| 527 | Ga0495612_0005583 | 3300053078 | Bacteria | 5199 |
| 528 | Ga0495612_0084758 | 3300053078 | Bacteria | 1335 |
| 529 | Ga0495612_0246307 | 3300053078 | Bacteria | 794 |
| 530 | Ga0495655_0057904 | 3300053083 | Bacteria | 1048 |
| 531 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 532 | Ga0495595_0000045 | 3300053084 | Bacteria | 63054 |
| 533 | Ga0495595_0017755 | 3300053084 | Bacteria | 3065 |
| 534 | Ga0495595_0070900 | 3300053084 | Bacteria | 1647 |
| 535 | Ga0495595_0074984 | 3300053084 | Bacteria | 1604 |
| 536 | Ga0495619_0000102 | 3300053085 | Bacteria | 64345 |
| 537 | Ga0495619_0000268 | 3300053085 | Bacteria | 37980 |
| 538 | Ga0495619_0003327 | 3300053085 | Bacteria | 10391 |
| 539 | Ga0495619_0005581 | 3300053085 | Bacteria | 7983 |
| 540 | Ga0495619_0009092 | 3300053085 | Bacteria | 6270 |
| 541 | Ga0495619_0009447 | 3300053085 | Bacteria | 6152 |
| 542 | Ga0500566_0015014 | 3300053094 | Bacteria | 4548 |
| 543 | Ga0500595_018620 | 3300053119 | Bacteria | 2536 |
| 544 | Ga0500614_001746 | 3300053123 | Bacteria | 5055 |
| 545 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
| 546 | Ga0500568_0260385 | 3300053139 | Bacteria | 631 |
| 547 | Ga0501084_0052269 | 3300054114 | Bacteria | 3419 |
| 548 | Ga0501082_0015619 | 3300060353 | Bacteria | 6535 |
| 549 | Ga0501082_0027491 | 3300060353 | Bacteria | 4897 |
| 550 | Ga0501082_0300956 | 3300060353 | Unclassified | 1397 |
| 551 | Ga0501082_1057396 | 3300060353 | Bacteria | 710 |
| 552 | Ga0530510_0251494 | 3300061734 | Bacteria | 1317 |
| 553 | Ga0530510_0635883 | 3300061734 | Bacteria | 812 |
| 554 | Ga0530510_0699995 | 3300061734 | Bacteria | 772 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050507 | nmdc:mga05p37_1341477_c1 | nmdc:mga05p37_1341477_c1_254_712 | 122 |
| 2 | 3300005365 | Ga0070688_100000228 | Ga0070688_10000022826 | 129 |
| 3 | 3300005466 | Ga0070685_10000019 | Ga0070685_1000001982 | 129 |
| 4 | 3300005436 | Ga0070713_100000047 | Ga0070713_10000004763 | 130 |
| 5 | 3300009101 | Ga0105247_10704565 | Ga0105247_107045651 | 130 |
| 6 | 3300041486 | Ga0451807_0093928 | Ga0451807_0093928_769_1233 | 130 |
| 7 | 3300041452 | Ga0451793_1852320 | Ga0451793_1852320_196_708 | 131 |
| 8 | 3300049579 | Ga0501043_1293128 | Ga0501043_1293128_23_499 | 131 |
| 9 | 3300045976 | Ga0466967_1427255 | Ga0466967_1427255_165_668 | 133 |
| 10 | 3300005535 | Ga0070684_100920396 | Ga0070684_1009203961 | 134 |
| 11 | 3300026088 | Ga0207641_10910115 | Ga0207641_109101151 | 134 |
| 12 | 3300048906 | Ga0496103_0046543 | Ga0496103_0046543_798_1304 | 134 |
| 13 | 3300048906 | Ga0496103_0173659 | Ga0496103_0173659_812_1363 | 134 |
| 14 | 3300048907 | Ga0496104_0294527 | Ga0496104_0294527_163_675 | 136 |
| 15 | 3300048908 | Ga0496105_0003407 | Ga0496105_0003407_2457_2969 | 136 |
| 16 | 3300048911 | Ga0496108_0479575 | Ga0496108_0479575_72_584 | 136 |
| 17 | 3300048922 | Ga0496119_0030358 | Ga0496119_0030358_2670_3182 | 136 |
| 18 | 3300049581 | Ga0501047_0088155 | Ga0501047_0088155_2277_2858 | 138 |
| 19 | 3300049742 | Ga0501080_0446818 | Ga0501080_0446818_433_1014 | 138 |
| 20 | 3300048905 | Ga0496102_0058427 | Ga0496102_0058427_1994_2566 | 139 |
| 21 | 3300048920 | Ga0496117_0005451 | Ga0496117_0005451_10884_11456 | 140 |
| 22 | 3300048921 | Ga0496118_0002916 | Ga0496118_0002916_5387_5959 | 140 |
| 23 | 3300048923 | Ga0496120_0001336 | Ga0496120_0001336_10576_11121 | 140 |
| 24 | 3300048924 | Ga0496121_0114547 | Ga0496121_0114547_1019_1567 | 140 |
| 25 | 3300048928 | Ga0496125_0023403 | Ga0496125_0023403_3338_3886 | 140 |
| 26 | 3300049568 | Ga0501031_0086399 | Ga0501031_0086399_934_1452 | 140 |
| 27 | 3300049574 | Ga0501038_0343788 | Ga0501038_0343788_379_897 | 140 |
| 28 | 3300049575 | Ga0501039_0348696 | Ga0501039_0348696_416_934 | 140 |
| 29 | 3300049577 | Ga0501041_0022711 | Ga0501041_0022711_2892_3410 | 140 |
| 30 | 3300049582 | Ga0501048_0126799 | Ga0501048_0126799_492_1010 | 140 |
| 31 | 3300049587 | Ga0501071_0173713 | Ga0501071_0173713_796_1314 | 140 |
| 32 | 3300049588 | Ga0501072_0046569 | Ga0501072_0046569_382_900 | 140 |
| 33 | 3300049591 | Ga0501075_0131077 | Ga0501075_0131077_906_1424 | 140 |
| 34 | 3300049592 | Ga0501076_0771163 | Ga0501076_0771163_206_724 | 140 |
| 35 | 3300049743 | Ga0501081_0159784 | Ga0501081_0159784_528_1046 | 140 |
| 36 | 3300049824 | Ga0501045_0030766 | Ga0501045_0030766_878_1396 | 140 |
| 37 | 3300053139 | Ga0500568_0260385 | Ga0500568_0260385_60_608 | 140 |
| 38 | 3300054114 | Ga0501084_0052269 | Ga0501084_0052269_404_922 | 140 |
| 39 | 3300060353 | Ga0501082_0015619 | Ga0501082_0015619_481_999 | 140 |
| 40 | 3300061734 | Ga0530510_0251494 | Ga0530510_0251494_116_634 | 140 |
| 41 | 3300044901 | Ga0466960_0119260 | Ga0466960_0119260_409_924 | 141 |
| 42 | 3300006038 | Ga0075365_10090699 | Ga0075365_100906993 | 143 |
| 43 | 3300046615 | Ga0495656_0000753 | Ga0495656_0000753_3994_4494 | 143 |
| 44 | 3300003373 | JGI25407J50210_10104246 | JGI25407J50210_101042461 | 144 |
| 45 | 3300005548 | Ga0070665_100204160 | Ga0070665_1002041602 | 144 |
| 46 | 3300005981 | Ga0081538_10000812 | Ga0081538_1000081221 | 144 |
| 47 | 3300028379 | Ga0268266_10229242 | Ga0268266_102292423 | 144 |
| 48 | 3300045976 | Ga0466967_0731377 | Ga0466967_0731377_228_737 | 144 |
| 49 | 3300005354 | Ga0070675_100000036 | Ga0070675_10000003656 | 145 |
| 50 | 3300005436 | Ga0070713_100743614 | Ga0070713_1007436141 | 145 |
| 51 | 3300025926 | Ga0207659_10000013 | Ga0207659_10000013104 | 145 |
| 52 | 3300047472 | Ga0495686_0592963 | Ga0495686_0592963_14_490 | 145 |
| 53 | 3300005337 | Ga0070682_100000011 | Ga0070682_10000001118 | 146 |
| 54 | 3300005834 | Ga0068851_10000730 | Ga0068851_1000073012 | 146 |
| 55 | 3300006163 | Ga0070715_10053407 | Ga0070715_100534073 | 146 |
| 56 | 3300009098 | Ga0105245_10006331 | Ga0105245_100063313 | 146 |
| 57 | 3300020082 | Ga0206353_11016966 | Ga0206353_110169663 | 146 |
| 58 | 3300025905 | Ga0207685_10025723 | Ga0207685_100257233 | 146 |
| 59 | 3300025913 | Ga0207695_10188274 | Ga0207695_101882743 | 146 |
| 60 | 3300026023 | Ga0207677_10000397 | Ga0207677_1000039738 | 146 |
| 61 | 3300046683 | Ga0495658_0003808 | Ga0495658_0003808_6810_7334 | 146 |
| 62 | 3300049578 | Ga0501042_0024403 | Ga0501042_0024403_3605_4117 | 146 |
| 63 | 3300049581 | Ga0501047_0633501 | Ga0501047_0633501_246_830 | 146 |
| 64 | 3300005347 | Ga0070668_100296340 | Ga0070668_1002963402 | 147 |
| 65 | 3300005356 | Ga0070674_100012503 | Ga0070674_1000125032 | 147 |
| 66 | 3300005365 | Ga0070688_100000360 | Ga0070688_1000003608 | 147 |
| 67 | 3300005466 | Ga0070685_10000020 | Ga0070685_1000002029 | 147 |
| 68 | 3300005543 | Ga0070672_100000001 | Ga0070672_100000001116 | 147 |
| 69 | 3300005614 | Ga0068856_100002498 | Ga0068856_1000024985 | 147 |
| 70 | 3300005718 | Ga0068866_10849261 | Ga0068866_108492611 | 147 |
| 71 | 3300009098 | Ga0105245_10000125 | Ga0105245_1000012530 | 147 |
| 72 | 3300009147 | Ga0114129_11161178 | Ga0114129_111611782 | 147 |
| 73 | 3300009148 | Ga0105243_10043619 | Ga0105243_100436192 | 147 |
| 74 | 3300025927 | Ga0207687_10000017 | Ga0207687_10000017210 | 147 |
| 75 | 3300025940 | Ga0207691_10000017 | Ga0207691_1000001743 | 147 |
| 76 | 3300025972 | Ga0207668_10248905 | Ga0207668_102489052 | 147 |
| 77 | 3300026078 | Ga0207702_10000637 | Ga0207702_1000063732 | 147 |
| 78 | 3300045976 | Ga0466967_0164558 | Ga0466967_0164558_770_1303 | 147 |
| 79 | 3300048911 | Ga0496108_0000063 | Ga0496108_0000063_70486_71010 | 147 |
| 80 | 3300048912 | Ga0496109_0000012 | Ga0496109_0000012_41737_42261 | 147 |
| 81 | 3300049569 | Ga0501032_0118989 | Ga0501032_0118989_142_732 | 147 |
| 82 | 3300049570 | Ga0501033_0000554 | Ga0501033_0000554_22570_23160 | 147 |
| 83 | 3300049571 | Ga0501034_0021453 | Ga0501034_0021453_3381_3971 | 147 |
| 84 | 3300049572 | Ga0501036_0000336 | Ga0501036_0000336_22570_23160 | 147 |
| 85 | 3300049573 | Ga0501037_0000425 | Ga0501037_0000425_11620_12210 | 147 |
| 86 | 3300049574 | Ga0501038_0004922 | Ga0501038_0004922_11635_12225 | 147 |
| 87 | 3300049575 | Ga0501039_0032026 | Ga0501039_0032026_3286_3876 | 147 |
| 88 | 3300049576 | Ga0501040_0164910 | Ga0501040_0164910_93_683 | 147 |
| 89 | 3300049578 | Ga0501042_0085396 | Ga0501042_0085396_66_656 | 147 |
| 90 | 3300049579 | Ga0501043_0000516 | Ga0501043_0000516_22570_23160 | 147 |
| 91 | 3300049580 | Ga0501046_0004627 | Ga0501046_0004627_11632_12222 | 147 |
| 92 | 3300049581 | Ga0501047_0000706 | Ga0501047_0000706_11632_12222 | 147 |
| 93 | 3300049582 | Ga0501048_0000269 | Ga0501048_0000269_11679_12269 | 147 |
| 94 | 3300049583 | Ga0501067_0112353 | Ga0501067_0112353_758_1348 | 147 |
| 95 | 3300049584 | Ga0501068_0104644 | Ga0501068_0104644_889_1479 | 147 |
| 96 | 3300049585 | Ga0501069_0086320 | Ga0501069_0086320_1011_1601 | 147 |
| 97 | 3300049586 | Ga0501070_0000649 | Ga0501070_0000649_22570_23160 | 147 |
| 98 | 3300049586 | Ga0501070_0005184 | Ga0501070_0005184_8419_8931 | 147 |
| 99 | 3300049587 | Ga0501071_0391507 | Ga0501071_0391507_81_671 | 147 |
| 100 | 3300049588 | Ga0501072_0077017 | Ga0501072_0077017_41_631 | 147 |
| 101 | 3300049589 | Ga0501073_0003135 | Ga0501073_0003135_11606_12196 | 147 |
| 102 | 3300049590 | Ga0501074_0003386 | Ga0501074_0003386_10518_11108 | 147 |
| 103 | 3300049741 | Ga0501079_0155838 | Ga0501079_0155838_985_1575 | 147 |
| 104 | 3300049742 | Ga0501080_0218983 | Ga0501080_0218983_166_756 | 147 |
| 105 | 3300049744 | Ga0501083_0117920 | Ga0501083_0117920_959_1549 | 147 |
| 106 | 3300049822 | Ga0501035_0000754 | Ga0501035_0000754_11686_12276 | 147 |
| 107 | 3300049823 | Ga0501044_0000947 | Ga0501044_0000947_11685_12275 | 147 |
| 108 | 3300049824 | Ga0501045_0135987 | Ga0501045_0135987_1064_1654 | 147 |
| 109 | 3300050492 | nmdc:mga0yw44_256837_c1 | nmdc:mga0yw44_256837_c1_324_863 | 147 |
| 110 | 3300050510 | nmdc:mga06r32_630199_c1 | nmdc:mga06r32_630199_c1_512_1027 | 147 |
| 111 | 3300060353 | Ga0501082_0027491 | Ga0501082_0027491_175_765 | 147 |
| 112 | 3300060353 | Ga0501082_1057396 | Ga0501082_1057396_192_683 | 147 |
| 113 | 3300005338 | Ga0068868_100193814 | Ga0068868_1001938142 | 148 |
| 114 | 3300005347 | Ga0070668_100053864 | Ga0070668_1000538644 | 148 |
| 115 | 3300005365 | Ga0070688_100215996 | Ga0070688_1002159962 | 148 |
| 116 | 3300005439 | Ga0070711_100036522 | Ga0070711_1000365222 | 148 |
| 117 | 3300005466 | Ga0070685_10076519 | Ga0070685_100765192 | 148 |
| 118 | 3300005544 | Ga0070686_100237400 | Ga0070686_1002374001 | 148 |
| 119 | 3300005937 | Ga0081455_10222993 | Ga0081455_102229932 | 148 |
| 120 | 3300006881 | Ga0068865_100174445 | Ga0068865_1001744453 | 148 |
| 121 | 3300009177 | Ga0105248_10893919 | Ga0105248_108939192 | 148 |
| 122 | 3300013306 | Ga0163162_10122210 | Ga0163162_101222102 | 148 |
| 123 | 3300025934 | Ga0207686_10104065 | Ga0207686_101040653 | 148 |
| 124 | 3300025937 | Ga0207669_10318107 | Ga0207669_103181072 | 148 |
| 125 | 3300025939 | Ga0207665_10041758 | Ga0207665_100417582 | 148 |
| 126 | 3300025972 | Ga0207668_10062039 | Ga0207668_100620392 | 148 |
| 127 | 3300026035 | Ga0207703_10766853 | Ga0207703_107668532 | 148 |
| 128 | 3300026089 | Ga0207648_10680491 | Ga0207648_106804912 | 148 |
| 129 | 3300026095 | Ga0207676_10713111 | Ga0207676_107131111 | 148 |
| 130 | 3300026121 | Ga0207683_10027545 | Ga0207683_100275455 | 148 |
| 131 | 3300028563 | Ga0265319_1000469 | Ga0265319_10004697 | 148 |
| 132 | 3300028800 | Ga0265338_10000244 | Ga0265338_1000024475 | 148 |
| 133 | 3300031241 | Ga0265325_10064475 | Ga0265325_100644751 | 148 |
| 134 | 3300031250 | Ga0265331_10011583 | Ga0265331_100115835 | 148 |
| 135 | 3300032126 | Ga0307415_100017498 | Ga0307415_1000174984 | 148 |
| 136 | 3300038443 | Ga0395901_0720252 | Ga0395901_0720252_370_876 | 148 |
| 137 | 3300046499 | Ga0495594_0229451 | Ga0495594_0229451_374_889 | 148 |
| 138 | 3300048903 | Ga0496100_0060978 | Ga0496100_0060978_1343_1858 | 148 |
| 139 | 3300048904 | Ga0496101_0092777 | Ga0496101_0092777_1040_1555 | 148 |
| 140 | 3300048905 | Ga0496102_0007757 | Ga0496102_0007757_925_1440 | 148 |
| 141 | 3300048909 | Ga0496106_0329593 | Ga0496106_0329593_315_830 | 148 |
| 142 | 3300048911 | Ga0496108_0050687 | Ga0496108_0050687_1125_1640 | 148 |
| 143 | 3300048912 | Ga0496109_0245245 | Ga0496109_0245245_397_912 | 148 |
| 144 | 3300048914 | Ga0496111_0403090 | Ga0496111_0403090_283_798 | 148 |
| 145 | 3300048916 | Ga0496113_0075001 | Ga0496113_0075001_779_1294 | 148 |
| 146 | 3300049576 | Ga0501040_0196031 | Ga0501040_0196031_513_1031 | 148 |
| 147 | 3300049584 | Ga0501068_0167710 | Ga0501068_0167710_864_1364 | 148 |
| 148 | 3300049588 | Ga0501072_0081105 | Ga0501072_0081105_870_1388 | 148 |
| 149 | 3300049591 | Ga0501075_0485463 | Ga0501075_0485463_67_585 | 148 |
| 150 | 3300049741 | Ga0501079_0368212 | Ga0501079_0368212_486_1004 | 148 |
| 151 | 3300049744 | Ga0501083_0769851 | Ga0501083_0769851_37_555 | 148 |
| 152 | 3300049824 | Ga0501045_0161594 | Ga0501045_0161594_656_1174 | 148 |
| 153 | 3300005329 | Ga0070683_100006889 | Ga0070683_1000068895 | 149 |
| 154 | 3300005457 | Ga0070662_100000002 | Ga0070662_100000002214 | 149 |
| 155 | 3300005547 | Ga0070693_100000470 | Ga0070693_1000004703 | 149 |
| 156 | 3300005548 | Ga0070665_100028178 | Ga0070665_1000281784 | 149 |
| 157 | 3300005548 | Ga0070665_100242923 | Ga0070665_1002429232 | 149 |
| 158 | 3300005616 | Ga0068852_100579401 | Ga0068852_1005794011 | 149 |
| 159 | 3300025944 | Ga0207661_10000198 | Ga0207661_1000019835 | 149 |
| 160 | 3300026142 | Ga0207698_10230458 | Ga0207698_102304583 | 149 |
| 161 | 3300028379 | Ga0268266_10000601 | Ga0268266_1000060115 | 149 |
| 162 | 3300028379 | Ga0268266_10265674 | Ga0268266_102656742 | 149 |
| 163 | 3300053078 | Ga0495612_0246307 | Ga0495612_0246307_226_753 | 149 |
| 164 | 3300002459 | JGI24751J29686_10080653 | JGI24751J29686_100806531 | 150 |
| 165 | 3300005337 | Ga0070682_100451150 | Ga0070682_1004511502 | 150 |
| 166 | 3300005434 | Ga0070709_10723285 | Ga0070709_107232852 | 150 |
| 167 | 3300005539 | Ga0068853_100320462 | Ga0068853_1003204622 | 150 |
| 168 | 3300005614 | Ga0068856_100013571 | Ga0068856_1000135714 | 150 |
| 169 | 3300005616 | Ga0068852_100000002 | Ga0068852_100000002200 | 150 |
| 170 | 3300005841 | Ga0068863_100000022 | Ga0068863_10000002222 | 150 |
| 171 | 3300005937 | Ga0081455_10126628 | Ga0081455_101266283 | 150 |
| 172 | 3300006844 | Ga0075428_100122655 | Ga0075428_1001226553 | 150 |
| 173 | 3300006846 | Ga0075430_100128225 | Ga0075430_1001282252 | 150 |
| 174 | 3300006847 | Ga0075431_100004050 | Ga0075431_10000405012 | 150 |
| 175 | 3300006880 | Ga0075429_100848079 | Ga0075429_1008480792 | 150 |
| 176 | 3300009093 | Ga0105240_10246468 | Ga0105240_102464683 | 150 |
| 177 | 3300009174 | Ga0105241_10317193 | Ga0105241_103171932 | 150 |
| 178 | 3300010375 | Ga0105239_10528827 | Ga0105239_105288272 | 150 |
| 179 | 3300013307 | Ga0157372_10000053 | Ga0157372_1000005379 | 150 |
| 180 | 3300013308 | Ga0157375_10188698 | Ga0157375_101886983 | 150 |
| 181 | 3300014969 | Ga0157376_10056242 | Ga0157376_100562425 | 150 |
| 182 | 3300025933 | Ga0207706_10000001 | Ga0207706_10000001395 | 150 |
| 183 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006237 | 150 |
| 184 | 3300025986 | Ga0207658_10201760 | Ga0207658_102017603 | 150 |
| 185 | 3300026041 | Ga0207639_10015804 | Ga0207639_100158047 | 150 |
| 186 | 3300026078 | Ga0207702_10018008 | Ga0207702_100180084 | 150 |
| 187 | 3300026088 | Ga0207641_10000016 | Ga0207641_10000016143 | 150 |
| 188 | 3300026142 | Ga0207698_10000004 | Ga0207698_1000000485 | 150 |
| 189 | 3300028379 | Ga0268266_10196858 | Ga0268266_101968582 | 150 |
| 190 | 3300035398 | Ga0316574_0233038 | Ga0316574_0233038_434_949 | 150 |
| 191 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_141123_141662 | 150 |
| 192 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_273269_273808 | 150 |
| 193 | 3300047444 | Ga0495675_0000300 | Ga0495675_0000300_6177_6716 | 150 |
| 194 | 3300048905 | Ga0496102_0237671 | Ga0496102_0237671_1072_1611 | 150 |
| 195 | 3300048916 | Ga0496113_0226905 | Ga0496113_0226905_28_564 | 150 |
| 196 | 3300049741 | Ga0501079_0505434 | Ga0501079_0505434_262_789 | 150 |
| 197 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_171834_172373 | 150 |
| 198 | 3300053085 | Ga0495619_0000102 | Ga0495619_0000102_28844_29383 | 150 |
| 199 | 3300053085 | Ga0495619_0000268 | Ga0495619_0000268_26988_27527 | 150 |
| 200 | 3300005329 | Ga0070683_100040821 | Ga0070683_1000408213 | 151 |
| 201 | 3300005347 | Ga0070668_100011596 | Ga0070668_1000115966 | 151 |
| 202 | 3300005366 | Ga0070659_100019249 | Ga0070659_1000192492 | 151 |
| 203 | 3300005367 | Ga0070667_100001076 | Ga0070667_10000107630 | 151 |
| 204 | 3300005438 | Ga0070701_10189878 | Ga0070701_101898781 | 151 |
| 205 | 3300005439 | Ga0070711_100102386 | Ga0070711_1001023862 | 151 |
| 206 | 3300005535 | Ga0070684_100228485 | Ga0070684_1002284852 | 151 |
| 207 | 3300005548 | Ga0070665_100045460 | Ga0070665_1000454603 | 151 |
| 208 | 3300005563 | Ga0068855_100592659 | Ga0068855_1005926592 | 151 |
| 209 | 3300005718 | Ga0068866_10000003 | Ga0068866_10000003283 | 151 |
| 210 | 3300005843 | Ga0068860_100004743 | Ga0068860_1000047436 | 151 |
| 211 | 3300005843 | Ga0068860_100030106 | Ga0068860_1000301065 | 151 |
| 212 | 3300005844 | Ga0068862_100023531 | Ga0068862_1000235313 | 151 |
| 213 | 3300005937 | Ga0081455_10019712 | Ga0081455_100197124 | 151 |
| 214 | 3300006038 | Ga0075365_10015429 | Ga0075365_100154296 | 151 |
| 215 | 3300006038 | Ga0075365_10057875 | Ga0075365_100578753 | 151 |
| 216 | 3300006048 | Ga0075363_100029719 | Ga0075363_1000297192 | 151 |
| 217 | 3300006051 | Ga0075364_10089117 | Ga0075364_100891173 | 151 |
| 218 | 3300006163 | Ga0070715_10000029 | Ga0070715_1000002911 | 151 |
| 219 | 3300006175 | Ga0070712_100079139 | Ga0070712_1000791393 | 151 |
| 220 | 3300009176 | Ga0105242_10744973 | Ga0105242_107449732 | 151 |
| 221 | 3300013105 | Ga0157369_10000307 | Ga0157369_1000030747 | 151 |
| 222 | 3300014745 | Ga0157377_10127253 | Ga0157377_101272532 | 151 |
| 223 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002533 | 151 |
| 224 | 3300025900 | Ga0207710_10000821 | Ga0207710_100008217 | 151 |
| 225 | 3300025903 | Ga0207680_10095594 | Ga0207680_100955943 | 151 |
| 226 | 3300025905 | Ga0207685_10000031 | Ga0207685_1000003178 | 151 |
| 227 | 3300025913 | Ga0207695_10309585 | Ga0207695_103095852 | 151 |
| 228 | 3300025915 | Ga0207693_10069081 | Ga0207693_100690813 | 151 |
| 229 | 3300025916 | Ga0207663_10033961 | Ga0207663_100339614 | 151 |
| 230 | 3300025917 | Ga0207660_10062694 | Ga0207660_100626944 | 151 |
| 231 | 3300025921 | Ga0207652_10003850 | Ga0207652_100038505 | 151 |
| 232 | 3300025928 | Ga0207700_10000033 | Ga0207700_1000003344 | 151 |
| 233 | 3300025934 | Ga0207686_10001016 | Ga0207686_1000101615 | 151 |
| 234 | 3300025936 | Ga0207670_10005811 | Ga0207670_100058114 | 151 |
| 235 | 3300025937 | Ga0207669_10000001 | Ga0207669_100000019 | 151 |
| 236 | 3300025944 | Ga0207661_10010942 | Ga0207661_100109423 | 151 |
| 237 | 3300025944 | Ga0207661_10029396 | Ga0207661_100293963 | 151 |
| 238 | 3300025949 | Ga0207667_11234283 | Ga0207667_112342831 | 151 |
| 239 | 3300025961 | Ga0207712_10007734 | Ga0207712_100077347 | 151 |
| 240 | 3300025972 | Ga0207668_10005384 | Ga0207668_100053846 | 151 |
| 241 | 3300025986 | Ga0207658_10003877 | Ga0207658_1000387715 | 151 |
| 242 | 3300026078 | Ga0207702_10120669 | Ga0207702_101206693 | 151 |
| 243 | 3300028379 | Ga0268266_10030794 | Ga0268266_100307945 | 151 |
| 244 | 3300028380 | Ga0268265_10004453 | Ga0268265_100044534 | 151 |
| 245 | 3300028381 | Ga0268264_10002435 | Ga0268264_1000243510 | 151 |
| 246 | 3300028381 | Ga0268264_10127452 | Ga0268264_101274524 | 151 |
| 247 | 3300028556 | Ga0265337_1000066 | Ga0265337_10000666 | 151 |
| 248 | 3300028558 | Ga0265326_10000019 | Ga0265326_10000019126 | 151 |
| 249 | 3300028573 | Ga0265334_10231623 | Ga0265334_102316231 | 151 |
| 250 | 3300028654 | Ga0265322_10000011 | Ga0265322_10000011126 | 151 |
| 251 | 3300028666 | Ga0265336_10020373 | Ga0265336_100203733 | 151 |
| 252 | 3300028800 | Ga0265338_10223812 | Ga0265338_102238122 | 151 |
| 253 | 3300029957 | Ga0265324_10000283 | Ga0265324_100002838 | 151 |
| 254 | 3300031238 | Ga0265332_10018240 | Ga0265332_100182403 | 151 |
| 255 | 3300031239 | Ga0265328_10011111 | Ga0265328_100111114 | 151 |
| 256 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011126 | 151 |
| 257 | 3300031250 | Ga0265331_10000858 | Ga0265331_100008584 | 151 |
| 258 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015234 | 151 |
| 259 | 3300031344 | Ga0265316_10022934 | Ga0265316_100229343 | 151 |
| 260 | 3300031711 | Ga0265314_10003522 | Ga0265314_100035228 | 151 |
| 261 | 3300031712 | Ga0265342_10273785 | Ga0265342_102737852 | 151 |
| 262 | 3300031995 | Ga0307409_101559992 | Ga0307409_1015599921 | 151 |
| 263 | 3300035398 | Ga0316574_0008333 | Ga0316574_0008333_1071_1589 | 151 |
| 264 | 3300035398 | Ga0316574_0066284 | Ga0316574_0066284_814_1326 | 151 |
| 265 | 3300045836 | Ga0466958_0023118 | Ga0466958_0023118_309_836 | 151 |
| 266 | 3300046460 | Ga0495638_0467004 | Ga0495638_0467004_45_557 | 151 |
| 267 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_125734_126252 | 151 |
| 268 | 3300046461 | Ga0495641_0042190 | Ga0495641_0042190_1523_2035 | 151 |
| 269 | 3300046516 | Ga0495628_0011208 | Ga0495628_0011208_7021_7533 | 151 |
| 270 | 3300046529 | Ga0495652_0031927 | Ga0495652_0031927_3172_3684 | 151 |
| 271 | 3300046543 | Ga0495645_0006168 | Ga0495645_0006168_2779_3291 | 151 |
| 272 | 3300046543 | Ga0495645_0016131 | Ga0495645_0016131_10_522 | 151 |
| 273 | 3300046694 | Ga0495649_0013634 | Ga0495649_0013634_2500_3018 | 151 |
| 274 | 3300047322 | Ga0495680_0328578 | Ga0495680_0328578_168_695 | 151 |
| 275 | 3300048913 | Ga0496110_0193959 | Ga0496110_0193959_83_601 | 151 |
| 276 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_122614_123141 | 151 |
| 277 | 3300050490 | nmdc:mga03n38_133936_c1 | nmdc:mga03n38_133936_c1_102_638 | 151 |
| 278 | 3300050491 | nmdc:mga00v17_151737_c1 | nmdc:mga00v17_151737_c1_423_959 | 151 |
| 279 | 3300050491 | nmdc:mga00v17_193691_c1 | nmdc:mga00v17_193691_c1_417_953 | 151 |
| 280 | 3300050492 | nmdc:mga0yw44_34692_c1 | nmdc:mga0yw44_34692_c1_2177_2713 | 151 |
| 281 | 3300050495 | nmdc:mga04h51_368366_c1 | nmdc:mga04h51_368366_c1_33_569 | 151 |
| 282 | 3300050515 | nmdc:mga0a205_53_c2 | nmdc:mga0a205_53_c2_27875_28402 | 151 |
| 283 | 3300053077 | Ga0495601_0349120 | Ga0495601_0349120_155_667 | 151 |
| 284 | 3300053123 | Ga0500614_001746 | Ga0500614_001746_4474_4992 | 151 |
| 285 | 3300005329 | Ga0070683_100029530 | Ga0070683_1000295304 | 152 |
| 286 | 3300005329 | Ga0070683_100125663 | Ga0070683_1001256632 | 152 |
| 287 | 3300005341 | Ga0070691_10000138 | Ga0070691_1000013823 | 152 |
| 288 | 3300005456 | Ga0070678_100696433 | Ga0070678_1006964332 | 152 |
| 289 | 3300005535 | Ga0070684_100119090 | Ga0070684_1001190903 | 152 |
| 290 | 3300005535 | Ga0070684_100219769 | Ga0070684_1002197693 | 152 |
| 291 | 3300005548 | Ga0070665_100107489 | Ga0070665_1001074891 | 152 |
| 292 | 3300005564 | Ga0070664_100826209 | Ga0070664_1008262092 | 152 |
| 293 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015180 | 152 |
| 294 | 3300005719 | Ga0068861_100142746 | Ga0068861_1001427463 | 152 |
| 295 | 3300006048 | Ga0075363_100169532 | Ga0075363_1001695321 | 152 |
| 296 | 3300006048 | Ga0075363_100226182 | Ga0075363_1002261822 | 152 |
| 297 | 3300006051 | Ga0075364_10246715 | Ga0075364_102467152 | 152 |
| 298 | 3300006178 | Ga0075367_10154694 | Ga0075367_101546942 | 152 |
| 299 | 3300006178 | Ga0075367_10471481 | Ga0075367_104714811 | 152 |
| 300 | 3300006847 | Ga0075431_100288537 | Ga0075431_1002885372 | 152 |
| 301 | 3300025903 | Ga0207680_10109162 | Ga0207680_101091623 | 152 |
| 302 | 3300025944 | Ga0207661_10051438 | Ga0207661_100514383 | 152 |
| 303 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018120 | 152 |
| 304 | 3300026118 | Ga0207675_100251659 | Ga0207675_1002516593 | 152 |
| 305 | 3300028379 | Ga0268266_10001254 | Ga0268266_1000125414 | 152 |
| 306 | 3300035172 | Ga0373955_0278069 | Ga0373955_0278069_477_992 | 152 |
| 307 | 3300036401 | Ga0373937_0013210 | Ga0373937_0013210_5730_6245 | 152 |
| 308 | 3300036401 | Ga0373937_0686503 | Ga0373937_0686503_181_702 | 152 |
| 309 | 3300046462 | Ga0495651_0520748 | Ga0495651_0520748_95_610 | 152 |
| 310 | 3300046511 | Ga0495608_0185622 | Ga0495608_0185622_184_699 | 152 |
| 311 | 3300046516 | Ga0495628_0040772 | Ga0495628_0040772_854_1378 | 152 |
| 312 | 3300046516 | Ga0495628_0288887 | Ga0495628_0288887_352_873 | 152 |
| 313 | 3300046516 | Ga0495628_0293831 | Ga0495628_0293831_133_648 | 152 |
| 314 | 3300046517 | Ga0495630_0010638 | Ga0495630_0010638_3727_4248 | 152 |
| 315 | 3300046517 | Ga0495630_0546115 | Ga0495630_0546115_351_872 | 152 |
| 316 | 3300046529 | Ga0495652_0328202 | Ga0495652_0328202_62_577 | 152 |
| 317 | 3300046533 | Ga0495640_0260844 | Ga0495640_0260844_87_602 | 152 |
| 318 | 3300046535 | Ga0495586_0295726 | Ga0495586_0295726_59_580 | 152 |
| 319 | 3300046663 | Ga0495635_0000031 | Ga0495635_0000031_99311_99835 | 152 |
| 320 | 3300046663 | Ga0495635_0010132 | Ga0495635_0010132_5125_5646 | 152 |
| 321 | 3300046663 | Ga0495635_0083646 | Ga0495635_0083646_961_1476 | 152 |
| 322 | 3300046663 | Ga0495635_0431862 | Ga0495635_0431862_185_700 | 152 |
| 323 | 3300046675 | Ga0495657_0065142 | Ga0495657_0065142_629_1150 | 152 |
| 324 | 3300047317 | Ga0495604_0068381 | Ga0495604_0068381_806_1321 | 152 |
| 325 | 3300047319 | Ga0495674_0888685 | Ga0495674_0888685_110_625 | 152 |
| 326 | 3300047322 | Ga0495680_0067441 | Ga0495680_0067441_1241_1756 | 152 |
| 327 | 3300047322 | Ga0495680_0202624 | Ga0495680_0202624_207_728 | 152 |
| 328 | 3300047471 | Ga0495684_0284698 | Ga0495684_0284698_440_961 | 152 |
| 329 | 3300048912 | Ga0496109_0328389 | Ga0496109_0328389_69_584 | 152 |
| 330 | 3300048913 | Ga0496110_0169046 | Ga0496110_0169046_764_1279 | 152 |
| 331 | 3300048914 | Ga0496111_0011379 | Ga0496111_0011379_4110_4625 | 152 |
| 332 | 3300048915 | Ga0496112_0134993 | Ga0496112_0134993_554_1069 | 152 |
| 333 | 3300048916 | Ga0496113_0321553 | Ga0496113_0321553_418_933 | 152 |
| 334 | 3300049576 | Ga0501040_0133309 | Ga0501040_0133309_911_1426 | 152 |
| 335 | 3300049576 | Ga0501040_0273226 | Ga0501040_0273226_489_1004 | 152 |
| 336 | 3300049580 | Ga0501046_0434054 | Ga0501046_0434054_99_614 | 152 |
| 337 | 3300049584 | Ga0501068_0172894 | Ga0501068_0172894_671_1186 | 152 |
| 338 | 3300049824 | Ga0501045_0379729 | Ga0501045_0379729_438_953 | 152 |
| 339 | 3300050491 | nmdc:mga00v17_142051_c1 | nmdc:mga00v17_142051_c1_596_1120 | 152 |
| 340 | 3300053077 | Ga0495601_0049461 | Ga0495601_0049461_1734_2255 | 152 |
| 341 | 3300053078 | Ga0495612_0000067 | Ga0495612_0000067_29102_29617 | 152 |
| 342 | 3300053078 | Ga0495612_0084758 | Ga0495612_0084758_235_756 | 152 |
| 343 | 3300053084 | Ga0495595_0070900 | Ga0495595_0070900_1037_1552 | 152 |
| 344 | 3300053084 | Ga0495595_0074984 | Ga0495595_0074984_422_937 | 152 |
| 345 | 3300053085 | Ga0495619_0003327 | Ga0495619_0003327_3171_3686 | 152 |
| 346 | 3300053085 | Ga0495619_0005581 | Ga0495619_0005581_6647_7168 | 152 |
| 347 | 3300053085 | Ga0495619_0009092 | Ga0495619_0009092_4542_5057 | 152 |
| 348 | 3300053085 | Ga0495619_0009447 | Ga0495619_0009447_2359_2880 | 152 |
| 349 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_225300_225827 | 152 |
| 350 | 3300060353 | Ga0501082_0300956 | Ga0501082_0300956_482_997 | 152 |
| 351 | 3300061734 | Ga0530510_0635883 | Ga0530510_0635883_282_797 | 152 |
| 352 | 3300005344 | Ga0070661_100000058 | Ga0070661_10000005842 | 153 |
| 353 | 3300009147 | Ga0114129_10068282 | Ga0114129_100682825 | 153 |
| 354 | 3300025920 | Ga0207649_10000283 | Ga0207649_100002838 | 153 |
| 355 | 3300046459 | Ga0495629_0013987 | Ga0495629_0013987_105_629 | 153 |
| 356 | 3300046516 | Ga0495628_0000859 | Ga0495628_0000859_6125_6661 | 153 |
| 357 | 3300046535 | Ga0495586_0000083 | Ga0495586_0000083_6111_6641 | 153 |
| 358 | 3300047321 | Ga0495676_0403087 | Ga0495676_0403087_137_661 | 153 |
| 359 | 3300048913 | Ga0496110_0254218 | Ga0496110_0254218_874_1413 | 153 |
| 360 | 3300048914 | Ga0496111_0043971 | Ga0496111_0043971_969_1508 | 153 |
| 361 | 3300049743 | Ga0501081_0405033 | Ga0501081_0405033_366_887 | 153 |
| 362 | 3300050507 | nmdc:mga05p37_61160_c1 | nmdc:mga05p37_61160_c1_3549_4070 | 153 |
| 363 | 3300050509 | nmdc:mga0qj67_183762_c1 | nmdc:mga0qj67_183762_c1_1132_1653 | 153 |
| 364 | 3300005535 | Ga0070684_100081124 | Ga0070684_1000811242 | 154 |
| 365 | 3300009148 | Ga0105243_10028685 | Ga0105243_100286857 | 154 |
| 366 | 3300009177 | Ga0105248_10000020 | Ga0105248_10000020139 | 154 |
| 367 | 3300014326 | Ga0157380_10000016 | Ga0157380_1000001685 | 154 |
| 368 | 3300014969 | Ga0157376_10020564 | Ga0157376_100205645 | 154 |
| 369 | 3300017792 | Ga0163161_10047839 | Ga0163161_100478395 | 154 |
| 370 | 3300025935 | Ga0207709_10019598 | Ga0207709_100195986 | 154 |
| 371 | 3300028380 | Ga0268265_10687215 | Ga0268265_106872151 | 154 |
| 372 | 3300031995 | Ga0307409_100099008 | Ga0307409_1000990083 | 154 |
| 373 | 3300032126 | Ga0307415_100341209 | Ga0307415_1003412092 | 154 |
| 374 | 3300046533 | Ga0495640_0082037 | Ga0495640_0082037_420_953 | 154 |
| 375 | 3300047319 | Ga0495674_0002248 | Ga0495674_0002248_5651_6184 | 154 |
| 376 | 3300047471 | Ga0495684_0144274 | Ga0495684_0144274_970_1494 | 154 |
| 377 | 3300048911 | Ga0496108_0329990 | Ga0496108_0329990_93_629 | 154 |
| 378 | 3300048912 | Ga0496109_0000173 | Ga0496109_0000173_715_1251 | 154 |
| 379 | 3300049573 | Ga0501037_0274041 | Ga0501037_0274041_110_637 | 154 |
| 380 | 3300049578 | Ga0501042_0035274 | Ga0501042_0035274_912_1439 | 154 |
| 381 | 3300049578 | Ga0501042_0053429 | Ga0501042_0053429_2203_2724 | 154 |
| 382 | 3300049583 | Ga0501067_0026243 | Ga0501067_0026243_1268_1831 | 154 |
| 383 | 3300050508 | nmdc:mga09592_128011_c1 | nmdc:mga09592_128011_c1_1532_2086 | 154 |
| 384 | 3300050509 | nmdc:mga0qj67_204503_c1 | nmdc:mga0qj67_204503_c1_870_1424 | 154 |
| 385 | 3300050510 | nmdc:mga06r32_42620_c1 | nmdc:mga06r32_42620_c1_185_739 | 154 |
| 386 | 3300061734 | Ga0530510_0699995 | Ga0530510_0699995_60_623 | 154 |
| 387 | 3300001979 | JGI24740J21852_10038891 | JGI24740J21852_100388911 | 155 |
| 388 | 3300005337 | Ga0070682_100000052 | Ga0070682_10000005273 | 155 |
| 389 | 3300005365 | Ga0070688_100129950 | Ga0070688_1001299502 | 155 |
| 390 | 3300005435 | Ga0070714_100010661 | Ga0070714_1000106613 | 155 |
| 391 | 3300005458 | Ga0070681_10045866 | Ga0070681_100458663 | 155 |
| 392 | 3300005466 | Ga0070685_10047925 | Ga0070685_100479255 | 155 |
| 393 | 3300005535 | Ga0070684_100520933 | Ga0070684_1005209332 | 155 |
| 394 | 3300005564 | Ga0070664_100293109 | Ga0070664_1002931092 | 155 |
| 395 | 3300005617 | Ga0068859_100403446 | Ga0068859_1004034461 | 155 |
| 396 | 3300005842 | Ga0068858_100000118 | Ga0068858_10000011868 | 155 |
| 397 | 3300006051 | Ga0075364_10223369 | Ga0075364_102233692 | 155 |
| 398 | 3300006358 | Ga0068871_100146311 | Ga0068871_1001463112 | 155 |
| 399 | 3300006852 | Ga0075433_10003354 | Ga0075433_100033547 | 155 |
| 400 | 3300006931 | Ga0097620_100403477 | Ga0097620_1004034771 | 155 |
| 401 | 3300009093 | Ga0105240_11325785 | Ga0105240_113257852 | 155 |
| 402 | 3300009101 | Ga0105247_10001978 | Ga0105247_1000197816 | 155 |
| 403 | 3300009101 | Ga0105247_10362980 | Ga0105247_103629802 | 155 |
| 404 | 3300009101 | Ga0105247_10553414 | Ga0105247_105534142 | 155 |
| 405 | 3300009176 | Ga0105242_10347093 | Ga0105242_103470932 | 155 |
| 406 | 3300009553 | Ga0105249_10345303 | Ga0105249_103453031 | 155 |
| 407 | 3300013297 | Ga0157378_10010221 | Ga0157378_100102212 | 155 |
| 408 | 3300013306 | Ga0163162_10755197 | Ga0163162_107551972 | 155 |
| 409 | 3300013308 | Ga0157375_10090838 | Ga0157375_100908382 | 155 |
| 410 | 3300014325 | Ga0163163_10308401 | Ga0163163_103084012 | 155 |
| 411 | 3300014326 | Ga0157380_10000236 | Ga0157380_1000023614 | 155 |
| 412 | 3300014326 | Ga0157380_10120059 | Ga0157380_101200591 | 155 |
| 413 | 3300014326 | Ga0157380_10777583 | Ga0157380_107775832 | 155 |
| 414 | 3300014968 | Ga0157379_10059769 | Ga0157379_100597694 | 155 |
| 415 | 3300025900 | Ga0207710_10320245 | Ga0207710_103202452 | 155 |
| 416 | 3300025929 | Ga0207664_10092298 | Ga0207664_100922983 | 155 |
| 417 | 3300025932 | Ga0207690_10185115 | Ga0207690_101851152 | 155 |
| 418 | 3300025934 | Ga0207686_10126611 | Ga0207686_101266112 | 155 |
| 419 | 3300025945 | Ga0207679_10057120 | Ga0207679_100571204 | 155 |
| 420 | 3300025961 | Ga0207712_10255543 | Ga0207712_102555432 | 155 |
| 421 | 3300026035 | Ga0207703_10000061 | Ga0207703_1000006185 | 155 |
| 422 | 3300026041 | Ga0207639_10012718 | Ga0207639_100127185 | 155 |
| 423 | 3300026078 | Ga0207702_10009958 | Ga0207702_100099588 | 155 |
| 424 | 3300026121 | Ga0207683_10068028 | Ga0207683_100680283 | 155 |
| 425 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056124 | 155 |
| 426 | 3300041505 | Ga0451849_0264818 | Ga0451849_0264818_289_828 | 155 |
| 427 | 3300046455 | Ga0495603_0004009 | Ga0495603_0004009_2001_2528 | 155 |
| 428 | 3300046459 | Ga0495629_0000487 | Ga0495629_0000487_22467_23003 | 155 |
| 429 | 3300046459 | Ga0495629_0561095 | Ga0495629_0561095_195_719 | 155 |
| 430 | 3300046461 | Ga0495641_0010781 | Ga0495641_0010781_2487_3026 | 155 |
| 431 | 3300046473 | Ga0495582_0000001 | Ga0495582_0000001_59216_59752 | 155 |
| 432 | 3300046475 | Ga0495639_0265560 | Ga0495639_0265560_136_663 | 155 |
| 433 | 3300046476 | Ga0495662_0039759 | Ga0495662_0039759_59_583 | 155 |
| 434 | 3300046507 | Ga0495606_0000040 | Ga0495606_0000040_104586_105125 | 155 |
| 435 | 3300046511 | Ga0495608_0393053 | Ga0495608_0393053_45_575 | 155 |
| 436 | 3300046515 | Ga0495620_0001374 | Ga0495620_0001374_9534_10061 | 155 |
| 437 | 3300046516 | Ga0495628_0164584 | Ga0495628_0164584_649_1179 | 155 |
| 438 | 3300046516 | Ga0495628_0358590 | Ga0495628_0358590_208_732 | 155 |
| 439 | 3300046517 | Ga0495630_0000014 | Ga0495630_0000014_126625_127164 | 155 |
| 440 | 3300046517 | Ga0495630_0141133 | Ga0495630_0141133_186_725 | 155 |
| 441 | 3300046529 | Ga0495652_0000010 | Ga0495652_0000010_254895_255431 | 155 |
| 442 | 3300046535 | Ga0495586_0136247 | Ga0495586_0136247_673_1197 | 155 |
| 443 | 3300046536 | Ga0495587_0028775 | Ga0495587_0028775_200_739 | 155 |
| 444 | 3300046539 | Ga0495621_0001691 | Ga0495621_0001691_3905_4435 | 155 |
| 445 | 3300046557 | Ga0495622_0000218 | Ga0495622_0000218_32038_32574 | 155 |
| 446 | 3300046642 | Ga0495634_0004632 | Ga0495634_0004632_6188_6712 | 155 |
| 447 | 3300046674 | Ga0495588_0003659 | Ga0495588_0003659_6113_6652 | 155 |
| 448 | 3300046678 | Ga0495599_0015716 | Ga0495599_0015716_168_698 | 155 |
| 449 | 3300046679 | Ga0495623_0377639 | Ga0495623_0377639_79_606 | 155 |
| 450 | 3300046680 | Ga0495646_0367887 | Ga0495646_0367887_186_716 | 155 |
| 451 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_43844_44371 | 155 |
| 452 | 3300046681 | Ga0495647_0006447 | Ga0495647_0006447_489_1028 | 155 |
| 453 | 3300046683 | Ga0495658_0000002 | Ga0495658_0000002_182822_183358 | 155 |
| 454 | 3300046684 | Ga0495669_0058551 | Ga0495669_0058551_681_1205 | 155 |
| 455 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_31859_32398 | 155 |
| 456 | 3300046690 | Ga0495624_0000019 | Ga0495624_0000019_33761_34291 | 155 |
| 457 | 3300046690 | Ga0495624_0000286 | Ga0495624_0000286_36490_37029 | 155 |
| 458 | 3300046809 | Ga0495600_0295586 | Ga0495600_0295586_474_1013 | 155 |
| 459 | 3300047317 | Ga0495604_0000239 | Ga0495604_0000239_25507_26046 | 155 |
| 460 | 3300047317 | Ga0495604_0022899 | Ga0495604_0022899_1807_2346 | 155 |
| 461 | 3300047321 | Ga0495676_0000238 | Ga0495676_0000238_6298_6825 | 155 |
| 462 | 3300047321 | Ga0495676_0001364 | Ga0495676_0001364_8418_8957 | 155 |
| 463 | 3300047321 | Ga0495676_0054980 | Ga0495676_0054980_772_1311 | 155 |
| 464 | 3300047322 | Ga0495680_0000488 | Ga0495680_0000488_30972_31502 | 155 |
| 465 | 3300047446 | Ga0495679_010122 | Ga0495679_010122_2274_2804 | 155 |
| 466 | 3300048088 | Ga0495602_0000007 | Ga0495602_0000007_129927_130466 | 155 |
| 467 | 3300048088 | Ga0495602_0123795 | Ga0495602_0123795_549_1076 | 155 |
| 468 | 3300048088 | Ga0495602_0268344 | Ga0495602_0268344_706_1230 | 155 |
| 469 | 3300048088 | Ga0495602_0633294 | Ga0495602_0633294_137_667 | 155 |
| 470 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_359322_359861 | 155 |
| 471 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_160674_161213 | 155 |
| 472 | 3300048905 | Ga0496102_1198837 | Ga0496102_1198837_90_614 | 155 |
| 473 | 3300048907 | Ga0496104_0000015 | Ga0496104_0000015_204537_205061 | 155 |
| 474 | 3300048907 | Ga0496104_0141520 | Ga0496104_0141520_1359_1898 | 155 |
| 475 | 3300048908 | Ga0496105_0000004 | Ga0496105_0000004_270738_271262 | 155 |
| 476 | 3300048909 | Ga0496106_0000056 | Ga0496106_0000056_81647_82186 | 155 |
| 477 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_170387_170926 | 155 |
| 478 | 3300048910 | Ga0496107_0020295 | Ga0496107_0020295_4051_4575 | 155 |
| 479 | 3300048914 | Ga0496111_0281833 | Ga0496111_0281833_531_1055 | 155 |
| 480 | 3300048914 | Ga0496111_0685744 | Ga0496111_0685744_183_722 | 155 |
| 481 | 3300048916 | Ga0496113_0058962 | Ga0496113_0058962_848_1372 | 155 |
| 482 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_11713_12249 | 155 |
| 483 | 3300048917 | Ga0496114_0006763 | Ga0496114_0006763_7247_7774 | 155 |
| 484 | 3300048917 | Ga0496114_0167511 | Ga0496114_0167511_1303_1845 | 155 |
| 485 | 3300048918 | Ga0496115_0000377 | Ga0496115_0000377_35864_36400 | 155 |
| 486 | 3300048919 | Ga0496116_0000331 | Ga0496116_0000331_69671_70222 | 155 |
| 487 | 3300048922 | Ga0496119_0002281 | Ga0496119_0002281_14368_14919 | 155 |
| 488 | 3300049591 | Ga0501075_0039702 | Ga0501075_0039702_2042_2572 | 155 |
| 489 | 3300050513 | nmdc:mga0rr50_654304_c1 | nmdc:mga0rr50_654304_c1_307_834 | 155 |
| 490 | 3300053077 | Ga0495601_0001218 | Ga0495601_0001218_5641_6180 | 155 |
| 491 | 3300053077 | Ga0495601_0223009 | Ga0495601_0223009_568_1104 | 155 |
| 492 | 3300053078 | Ga0495612_0005583 | Ga0495612_0005583_30_554 | 155 |
| 493 | 3300053084 | Ga0495595_0017755 | Ga0495595_0017755_75_614 | 155 |
| 494 | 3300053094 | Ga0500566_0015014 | Ga0500566_0015014_3930_4472 | 155 |
| 495 | 3300001977 | JGI24746J21847_1000066 | JGI24746J21847_10000668 | 156 |
| 496 | 3300005335 | Ga0070666_10236344 | Ga0070666_102363441 | 156 |
| 497 | 3300005367 | Ga0070667_100830801 | Ga0070667_1008308011 | 156 |
| 498 | 3300005459 | Ga0068867_100002402 | Ga0068867_1000024028 | 156 |
| 499 | 3300009094 | Ga0111539_10623848 | Ga0111539_106238482 | 156 |
| 500 | 3300009098 | Ga0105245_10000517 | Ga0105245_100005178 | 156 |
| 501 | 3300009553 | Ga0105249_10000178 | Ga0105249_1000017848 | 156 |
| 502 | 3300014968 | Ga0157379_10002058 | Ga0157379_1000205819 | 156 |
| 503 | 3300014968 | Ga0157379_10019326 | Ga0157379_100193263 | 156 |
| 504 | 3300017792 | Ga0163161_10000022 | Ga0163161_100000229 | 156 |
| 505 | 3300025893 | Ga0207682_10000155 | Ga0207682_100001557 | 156 |
| 506 | 3300025927 | Ga0207687_10000085 | Ga0207687_1000008561 | 156 |
| 507 | 3300026089 | Ga0207648_10003501 | Ga0207648_100035017 | 156 |
| 508 | 3300046463 | Ga0495653_0048901 | Ga0495653_0048901_955_1491 | 156 |
| 509 | 3300046463 | Ga0495653_0470652 | Ga0495653_0470652_66_602 | 156 |
| 510 | 3300046476 | Ga0495662_0000001 | Ga0495662_0000001_39247_39783 | 156 |
| 511 | 3300046511 | Ga0495608_0001804 | Ga0495608_0001804_8665_9201 | 156 |
| 512 | 3300046514 | Ga0495618_0000014 | Ga0495618_0000014_95899_96438 | 156 |
| 513 | 3300046516 | Ga0495628_0504280 | Ga0495628_0504280_122_658 | 156 |
| 514 | 3300046523 | Ga0495644_0001062 | Ga0495644_0001062_5504_6043 | 156 |
| 515 | 3300046616 | Ga0495668_0031092 | Ga0495668_0031092_1463_1999 | 156 |
| 516 | 3300046642 | Ga0495634_0002567 | Ga0495634_0002567_8951_9475 | 156 |
| 517 | 3300046681 | Ga0495647_0005224 | Ga0495647_0005224_526_1062 | 156 |
| 518 | 3300046684 | Ga0495669_0000076 | Ga0495669_0000076_27810_28340 | 156 |
| 519 | 3300046689 | Ga0495613_0000005 | Ga0495613_0000005_126430_126966 | 156 |
| 520 | 3300046690 | Ga0495624_0055357 | Ga0495624_0055357_1701_2237 | 156 |
| 521 | 3300046809 | Ga0495600_0005957 | Ga0495600_0005957_3298_3837 | 156 |
| 522 | 3300047317 | Ga0495604_0000067 | Ga0495604_0000067_83439_83975 | 156 |
| 523 | 3300047322 | Ga0495680_0097250 | Ga0495680_0097250_1262_1798 | 156 |
| 524 | 3300048903 | Ga0496100_0000059 | Ga0496100_0000059_12046_12576 | 156 |
| 525 | 3300048904 | Ga0496101_0000135 | Ga0496101_0000135_52943_53473 | 156 |
| 526 | 3300048907 | Ga0496104_0000025 | Ga0496104_0000025_28106_28636 | 156 |
| 527 | 3300048908 | Ga0496105_0000023 | Ga0496105_0000023_28106_28636 | 156 |
| 528 | 3300048909 | Ga0496106_0000252 | Ga0496106_0000252_7384_7914 | 156 |
| 529 | 3300048910 | Ga0496107_0000054 | Ga0496107_0000054_52943_53473 | 156 |
| 530 | 3300048910 | Ga0496107_0575899 | Ga0496107_0575899_190_732 | 156 |
| 531 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_405699_406229 | 156 |
| 532 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_172787_173317 | 156 |
| 533 | 3300048913 | Ga0496110_0599167 | Ga0496110_0599167_423_965 | 156 |
| 534 | 3300048914 | Ga0496111_0030798 | Ga0496111_0030798_3259_3801 | 156 |
| 535 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_127486_128025 | 156 |
| 536 | 3300049571 | Ga0501034_0156293 | Ga0501034_0156293_540_1091 | 156 |
| 537 | 3300049579 | Ga0501043_0140448 | Ga0501043_0140448_447_1004 | 156 |
| 538 | 3300049580 | Ga0501046_0450019 | Ga0501046_0450019_199_759 | 156 |
| 539 | 3300049581 | Ga0501047_0096965 | Ga0501047_0096965_1857_2408 | 156 |
| 540 | 3300049581 | Ga0501047_0278292 | Ga0501047_0278292_824_1387 | 156 |
| 541 | 3300049584 | Ga0501068_0099770 | Ga0501068_0099770_1117_1680 | 156 |
| 542 | 3300049585 | Ga0501069_0016305 | Ga0501069_0016305_86_649 | 156 |
| 543 | 3300049587 | Ga0501071_0552722 | Ga0501071_0552722_145_705 | 156 |
| 544 | 3300049741 | Ga0501079_0201236 | Ga0501079_0201236_173_733 | 156 |
| 545 | 3300049742 | Ga0501080_0365021 | Ga0501080_0365021_159_719 | 156 |
| 546 | 3300049742 | Ga0501080_0769995 | Ga0501080_0769995_217_774 | 156 |
| 547 | 3300049744 | Ga0501083_0043407 | Ga0501083_0043407_72_632 | 156 |
| 548 | 3300050494 | nmdc:mga06z11_583193_c1 | nmdc:mga06z11_583193_c1_57_596 | 156 |
| 549 | 3300050510 | nmdc:mga06r32_193641_c1 | nmdc:mga06r32_193641_c1_624_1166 | 156 |
| 550 | 3300050511 | nmdc:mga08y16_592331_c1 | nmdc:mga08y16_592331_c1_393_935 | 156 |
| 551 | 3300053077 | Ga0495601_0093870 | Ga0495601_0093870_248_772 | 156 |
| 552 | 3300053083 | Ga0495655_0057904 | Ga0495655_0057904_491_1033 | 156 |
| 553 | 3300053084 | Ga0495595_0000045 | Ga0495595_0000045_40886_41422 | 156 |
| 554 | 3300053119 | Ga0500595_018620 | Ga0500595_018620_1843_2403 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lw3-assembly1.cif.gz_B | crystal structure of ruvc from pseudomonas aeruginosa | 0.9173 | 1 | 138 |
| 7w8d-assembly1.cif.gz_B | the structure of deinococcus radiodurans ruvc | 0.9066 | 1 | 135 |
| 6s16-assembly1.cif.gz_A | t. thermophilus ruvc in complex with holliday junction substrate | 0.9051 | 1 | 141 |
| 7xhj-assembly1.cif.gz_A | crystal structure of ruvc from deinococcus radiodurans | 0.8952 | 2 | 145 |
| 6s16-assembly1.cif.gz_B | t. thermophilus ruvc in complex with holliday junction substrate | 0.8907 | 1 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGV9_1_161_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9095 | 2 | 145 | 3.30.420.10 |
| 4ld0B00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8898 | 1 | 145 | 3.30.420.10 |
| 1hjrC00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8811 | 3 | 146 | 3.30.420.10 |
| af_P9WGV9_1_161_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.8374 | 2 | 145 | 3.30.420.10 |
| af_F1R2R7_20_151_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8351 | 50 | 104 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2VSK3-F1-model_v4 | Crossover junction endodeoxyribonuclease RuvC | 0.9711 | 2 | 104 |
GO:0003677
GO:0004520 GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A3B9MQ23-F1-model_v4 | Crossover junction endodeoxyribonuclease RuvC | 0.9705 | 2 | 70 |
GO:0003677
GO:0004520 GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A2E7R3F4-F1-model_v4 | Uncharacterized protein | 0.9698 | 2 | 101 |
GO:0003677
GO:0004520 GO:0006281 GO:0006310 GO:0046872 |
| AF-A0A1X3CGD3-F1-model_v4 | deleted | 0.9661 | 2 | 95 |
|
| AF-A0A6G3V5B7-F1-model_v4 | deleted | 0.9645 | 2 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar