F462919

General Info

Members Datasets Scaffolds Average Seq Length
553 335 546 84

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0396019|Ga0501039_0396019_769_1059
Length 96
Sequence VPLGLQENATAMPVKLLYFAWVREKIGRAEEVVDLPANLTTVADLVDWLRQRGPEYEAALSRPGVVRAAVDKRHVQSDTMIAGAREIALFPPVTGG

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
5 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
6 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
7 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
116 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
196 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
265 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
288 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
289 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
290 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
291 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
297 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
298 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
313 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
316 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
317 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
320 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
323 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
329 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 0
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.64
Nodule 0
Rhizoplane 3.44
Rhizosphere 76.13
Stem 0
Stem Tuber 0
Unclassified 3.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10128976 3300001989 Bacteria 753
2 JGI24749J21850_1000076 3300002076 Bacteria 17900
3 JGI24751J29686_10000195 3300002459 Bacteria 26688
4 JGI25152J39213_1053442 3300002773 Bacteria 518
5 JGI25150J39212_1000498 3300002774 Bacteria 16317
6 JGI25151J46595_10145939 3300003187 Bacteria 571
7 JGI25153J46596_10000002 3300003215 Bacteria 653569
8 JGI25153J46596_10000361 3300003215 Bacteria 31415
9 Ga0055525_1000104 3300003759 Bacteria 134560
10 Ga0055526_1001039 3300003771 Bacteria 20291
11 Ga0055537_1007000 3300003773 Bacteria 2780
12 Ga0055536_1008019 3300003781 Bacteria 4618
13 Ga0055536_1012711 3300003781 Bacteria 3098
14 Ga0055536_1013025 3300003781 Bacteria 3033
15 Ga0055536_1016996 3300003781 Bacteria 2402
16 Ga0055530_10000013 3300003791 Bacteria 153390
17 Ga0055530_10012977 3300003791 Bacteria 2872
18 Ga0055530_10028706 3300003791 Bacteria 1498
19 Ga0055530_10059230 3300003791 Bacteria 859
20 Ga0055540_1001214 3300003792 Bacteria 15851
21 Ga0055531_10000627 3300003794 Bacteria 30500
22 Ga0055531_10006022 3300003794 Bacteria 6957
23 Ga0055531_10018483 3300003794 Bacteria 2873
24 Ga0055531_10018492 3300003794 Bacteria 2872
25 Ga0065165_1009533 3300005262 Bacteria 4340
26 Ga0065165_1057455 3300005262 Bacteria 1078
27 Ga0065707_10087462 3300005295 Bacteria 5014
28 Ga0070690_100345633 3300005330 Bacteria 1078
29 Ga0070670_100000033 3300005331 Bacteria 158509
30 Ga0068869_100535616 3300005334 Bacteria 982
31 Ga0070666_10034718 3300005335 Bacteria 3342
32 Ga0070680_100001191 3300005336 Bacteria 18734
33 Ga0070660_100826399 3300005339 Bacteria 780
34 Ga0070689_100485531 3300005340 Bacteria 1056
35 Ga0070691_10001146 3300005341 Bacteria 11033
36 Ga0070687_100273271 3300005343 Bacteria 1060
37 Ga0070661_100146165 3300005344 Bacteria 1785
38 Ga0070668_100072912 3300005347 Bacteria 2676
39 Ga0070668_100633807 3300005347 Bacteria 938
40 Ga0070668_102088262 3300005347 Bacteria 523
41 Ga0070669_100000005 3300005353 Bacteria 309134
42 Ga0070669_101251793 3300005353 Bacteria 642
43 Ga0070675_100378139 3300005354 Bacteria 1260
44 Ga0070671_100212684 3300005355 Bacteria 1640
45 Ga0070674_100179362 3300005356 Bacteria 1621
46 Ga0070667_100005221 3300005367 Bacteria 10854
47 Ga0070667_100632902 3300005367 Bacteria 987
48 Ga0070703_10010769 3300005406 Bacteria 2579
49 Ga0070709_11087665 3300005434 Bacteria 639
50 Ga0070714_100220252 3300005435 Bacteria 1744
51 Ga0070714_100924806 3300005435 Unclassified 847
52 Ga0070713_100000137 3300005436 Bacteria 48167
53 Ga0070710_10509418 3300005437 Bacteria 825
54 Ga0070701_10052747 3300005438 Bacteria 2114
55 Ga0070711_100184496 3300005439 Bacteria 1599
56 Ga0070705_100000042 3300005440 Bacteria 64569
57 Ga0070705_100202078 3300005440 Bacteria 1363
58 Ga0070700_100009319 3300005441 Bacteria 5381
59 Ga0070694_100000934 3300005444 Bacteria 16504
60 Ga0070708_100438445 3300005445 Bacteria 1232
61 Ga0070663_100005131 3300005455 Bacteria 7754
62 Ga0070663_100990798 3300005455 Bacteria 730
63 Ga0070678_100742932 3300005456 Bacteria 887
64 Ga0070678_101532712 3300005456 Bacteria 625
65 Ga0070662_101723602 3300005457 Bacteria 541
66 Ga0070681_10527303 3300005458 Bacteria 1094
67 Ga0070707_100233325 3300005468 Bacteria 1791
68 Ga0070707_101922456 3300005468 Bacteria 559
69 Ga0070699_100000770 3300005518 Bacteria 29605
70 Ga0070699_100490323 3300005518 Bacteria 1116
71 Ga0070679_100378582 3300005530 Bacteria 1362
72 Ga0070697_100083394 3300005536 Bacteria 2636
73 Ga0068853_100039901 3300005539 Bacteria 4005
74 Ga0068853_100256703 3300005539 Bacteria 1606
75 Ga0070672_101757862 3300005543 Bacteria 557
76 Ga0070686_100063163 3300005544 Bacteria 2398
77 Ga0070695_100003671 3300005545 Bacteria 8937
78 Ga0070695_100083387 3300005545 Bacteria 2118
79 Ga0070696_100000734 3300005546 Bacteria 20936
80 Ga0070693_100074514 3300005547 Bacteria 2008
81 Ga0070693_100325884 3300005547 Bacteria 1044
82 Ga0070704_100000273 3300005549 Bacteria 22734
83 Ga0068855_100090917 3300005563 Bacteria 3521
84 Ga0070664_100176887 3300005564 Bacteria 1895
85 Ga0068857_100004447 3300005577 Bacteria 11848
86 Ga0068857_100004666 3300005577 Bacteria 11606
87 Ga0068857_100184472 3300005577 Bacteria 1899
88 Ga0068854_100176289 3300005578 Bacteria 1667
89 Ga0068856_100064923 3300005614 Bacteria 3607
90 Ga0070702_100346244 3300005615 Bacteria 1045
91 Ga0068852_100070398 3300005616 Bacteria 3069
92 Ga0068852_100873100 3300005616 Bacteria 916
93 Ga0068852_101902397 3300005616 Bacteria 617
94 Ga0068859_100002190 3300005617 Bacteria 19848
95 Ga0068859_100007105 3300005617 Bacteria 11364
96 Ga0068864_100000042 3300005618 Bacteria 162930
97 Ga0068864_100250892 3300005618 Bacteria 1643
98 Ga0068864_101063769 3300005618 Bacteria 804
99 Ga0068861_100000085 3300005719 Bacteria 44952
100 Ga0068861_100002413 3300005719 Bacteria 12172
101 Ga0068861_101092410 3300005719 Bacteria 766
102 Ga0068863_100001219 3300005841 Bacteria 25689
103 Ga0068863_100068601 3300005841 Bacteria 3354
104 Ga0068863_100393185 3300005841 Bacteria 1355
105 Ga0068863_100400638 3300005841 Bacteria 1342
106 Ga0068858_101606114 3300005842 Bacteria 642
107 Ga0068860_100053584 3300005843 Bacteria 3836
108 Ga0068860_100332267 3300005843 Bacteria 1493
109 Ga0068862_100000005 3300005844 Bacteria 350713
110 Ga0068862_100000149 3300005844 Bacteria 79784
111 Ga0068862_100008887 3300005844 Bacteria 8319
112 Ga0068862_100323134 3300005844 Bacteria 1425
113 Ga0081455_10190567 3300005937 Bacteria 1544
114 Ga0081455_10498668 3300005937 Bacteria 818
115 Ga0075364_10572033 3300006051 Bacteria 772
116 Ga0070716_100008484 3300006173 Bacteria 5098
117 Ga0070712_100000239 3300006175 Bacteria 30829
118 Ga0075367_10464646 3300006178 Bacteria 802
119 Ga0075366_10046739 3300006195 Bacteria 2565
120 Ga0075370_10216592 3300006353 Bacteria 1131
121 Ga0068871_100168211 3300006358 Bacteria 1878
122 Ga0068871_102311581 3300006358 Bacteria 513
123 Ga0075430_100059184 3300006846 Bacteria 3221
124 Ga0075431_100025956 3300006847 Bacteria 6005
125 Ga0075431_100347112 3300006847 Bacteria 1493
126 Ga0075434_100026909 3300006871 Bacteria 5642
127 Ga0075429_101470379 3300006880 Bacteria 593
128 Ga0075436_100001310 3300006914 Bacteria 16921
129 Ga0075436_100116938 3300006914 Bacteria 1864
130 Ga0075436_100371023 3300006914 Bacteria 1034
131 Ga0097620_100002190 3300006931 Bacteria 19848
132 Ga0097620_100007105 3300006931 Bacteria 11364
133 Ga0097620_100011274 3300006931 Bacteria 8995
134 Ga0075435_100071476 3300007076 Bacteria 2834
135 Ga0075435_100983209 3300007076 Bacteria 737
136 Ga0105240_10003562 3300009093 Bacteria 24155
137 Ga0105240_11844911 3300009093 Bacteria 630
138 Ga0105245_11295182 3300009098 Bacteria 778
139 Ga0105245_12849658 3300009098 Bacteria 536
140 Ga0105247_10004166 3300009101 Bacteria 9275
141 Ga0114129_10232685 3300009147 Bacteria 2481
142 Ga0105241_10036953 3300009174 Bacteria 3677
143 Ga0105241_11027853 3300009174 Bacteria 772
144 Ga0105241_12547078 3300009174 Bacteria 513
145 Ga0105248_10000171 3300009177 Bacteria 75565
146 Ga0105248_10013399 3300009177 Bacteria 9025
147 Ga0105248_10102363 3300009177 Bacteria 3228
148 Ga0105237_10002989 3300009545 Bacteria 20424
149 Ga0105237_10009554 3300009545 Bacteria 10384
150 Ga0105238_10001025 3300009551 Bacteria 28423
151 Ga0105249_10000056 3300009553 Bacteria 160443
152 Ga0105249_10017548 3300009553 Bacteria 6355
153 Ga0105239_10000061 3300010375 Bacteria 154661
154 Ga0105239_10131618 3300010375 Bacteria 2783
155 Ga0105239_11365865 3300010375 Bacteria 818
156 Ga0105239_12687839 3300010375 Bacteria 581
157 Ga0105246_10036426 3300011119 Bacteria 3296
158 Ga0157373_10002530 3300013100 Bacteria 13920
159 Ga0157373_10191518 3300013100 Bacteria 1441
160 Ga0157370_10016043 3300013104 Bacteria 7595
161 Ga0157369_10044165 3300013105 Bacteria 4852
162 Ga0157369_10094953 3300013105 Bacteria 3183
163 Ga0157369_12437252 3300013105 Bacteria 530
164 Ga0157374_10930230 3300013296 Bacteria 887
165 Ga0163162_12458742 3300013306 Bacteria 599
166 Ga0157372_10109483 3300013307 Bacteria 3163
167 Ga0163163_10013144 3300014325 Bacteria 7565
168 Ga0163163_10248525 3300014325 Bacteria 1829
169 Ga0163163_10324036 3300014325 Bacteria 1594
170 Ga0157380_10006098 3300014326 Bacteria 8448
171 Ga0157379_10046909 3300014968 Bacteria 3855
172 Ga0157379_10165907 3300014968 Bacteria 1993
173 Ga0183363_1008 3300015690 Bacteria 194027
174 Ga0183361_15479 3300016635 Bacteria 688
175 Ga0163161_10328917 3300017792 Bacteria 1210
176 Ga0163161_10390500 3300017792 Bacteria 1114
177 Ga0209147_100453 3300025229 Bacteria 25782
178 Ga0209563_100116 3300025230 Bacteria 134661
179 Ga0207425_1000041 3300025245 Bacteria 210441
180 Ga0209129_1001877 3300025258 Bacteria 11093
181 Ga0209565_1000753 3300025263 Bacteria 19035
182 Ga0209676_1000049 3300025292 Bacteria 403210
183 Ga0209676_1000221 3300025292 Bacteria 124715
184 Ga0209676_1000349 3300025292 Bacteria 87517
185 Ga0209676_1000453 3300025292 Bacteria 69137
186 Ga0209676_1002202 3300025292 Bacteria 14549
187 Ga0209676_1061043 3300025292 Bacteria 938
188 Ga0209025_1000068 3300025294 Bacteria 294129
189 Ga0209564_1005033 3300025295 Bacteria 7738
190 Ga0209564_1007114 3300025295 Bacteria 5842
191 Ga0209758_1000001 3300025297 Bacteria 1981790
192 Ga0209758_1000004 3300025297 Bacteria 1375322
193 Ga0209758_1038476 3300025297 Bacteria 1834
194 Ga0209050_1000001 3300025298 Bacteria 3563507
195 Ga0209050_1000042 3300025298 Bacteria 402842
196 Ga0209050_1000822 3300025298 Bacteria 43254
197 Ga0209050_1006139 3300025298 Bacteria 7239
198 Ga0209050_1007307 3300025298 Bacteria 6235
199 Ga0209050_1009678 3300025298 Bacteria 4889
200 Ga0209050_1019380 3300025298 Bacteria 2585
201 Ga0209050_1031520 3300025298 Bacteria 1651
202 Ga0207426_1017332 3300025302 Bacteria 2563
203 Ga0209051_1000232 3300025303 Bacteria 93680
204 Ga0209051_1067540 3300025303 Bacteria 1093
205 Ga0209257_1000135 3300025304 Bacteria 205668
206 Ga0209257_1000487 3300025304 Bacteria 71315
207 Ga0209257_1002216 3300025304 Bacteria 20005
208 Ga0209257_1002243 3300025304 Bacteria 19820
209 Ga0209257_1002730 3300025304 Bacteria 16776
210 Ga0207653_10004593 3300025885 Bacteria 4331
211 Ga0207692_10071073 3300025898 Bacteria 1834
212 Ga0207710_10075737 3300025900 Bacteria 1551
213 Ga0207710_10330329 3300025900 Bacteria 774
214 Ga0207688_10216775 3300025901 Bacteria 1152
215 Ga0207688_10716662 3300025901 Bacteria 633
216 Ga0207680_10743809 3300025903 Bacteria 703
217 Ga0207647_10587679 3300025904 Bacteria 615
218 Ga0207699_10000510 3300025906 Bacteria 19285
219 Ga0207654_10930931 3300025911 Bacteria 631
220 Ga0207695_10013684 3300025913 Bacteria 9657
221 Ga0207671_10005232 3300025914 Bacteria 12051
222 Ga0207671_10105574 3300025914 Bacteria 2138
223 Ga0207693_10000668 3300025915 Bacteria 30811
224 Ga0207663_10011019 3300025916 Bacteria 4836
225 Ga0207663_10181128 3300025916 Bacteria 1505
226 Ga0207660_10002046 3300025917 Bacteria 13403
227 Ga0207660_11011263 3300025917 Bacteria 678
228 Ga0207662_10533774 3300025918 Bacteria 811
229 Ga0207657_10527226 3300025919 Bacteria 924
230 Ga0207649_10037880 3300025920 Bacteria 2916
231 Ga0207649_11448668 3300025920 Bacteria 544
232 Ga0207652_10245347 3300025921 Bacteria 1615
233 Ga0207646_10241257 3300025922 Bacteria 1633
234 Ga0207646_10437367 3300025922 Bacteria 1180
235 Ga0207681_10000003 3300025923 Bacteria 713245
236 Ga0207694_10195536 3300025924 Bacteria 1644
237 Ga0207694_11406428 3300025924 Bacteria 589
238 Ga0207650_10000012 3300025925 Bacteria 437889
239 Ga0207659_10199817 3300025926 Bacteria 1596
240 Ga0207659_10317806 3300025926 Bacteria 1284
241 Ga0207700_10000005 3300025928 Bacteria 394836
242 Ga0207664_10080204 3300025929 Bacteria 2652
243 Ga0207644_10293912 3300025931 Bacteria 1307
244 Ga0207706_10043912 3300025933 Bacteria 3961
245 Ga0207706_10468972 3300025933 Bacteria 1088
246 Ga0207709_10871201 3300025935 Bacteria 730
247 Ga0207670_10603416 3300025936 Bacteria 901
248 Ga0207669_10411154 3300025937 Bacteria 1062
249 Ga0207665_10138331 3300025939 Bacteria 1734
250 Ga0207711_10001461 3300025941 Bacteria 22080
251 Ga0207711_10011132 3300025941 Bacteria 7475
252 Ga0207711_10370348 3300025941 Bacteria 1328
253 Ga0207689_10306454 3300025942 Bacteria 1317
254 Ga0207679_10661544 3300025945 Bacteria 945
255 Ga0207667_10053892 3300025949 Bacteria 4231
256 Ga0207667_11420978 3300025949 Bacteria 667
257 Ga0207712_10000015 3300025961 Bacteria 346689
258 Ga0207712_10016802 3300025961 Bacteria 4744
259 Ga0207668_10026421 3300025972 Bacteria 3769
260 Ga0207668_10333954 3300025972 Bacteria 1262
261 Ga0207668_11289646 3300025972 Bacteria 657
262 Ga0207640_10017027 3300025981 Bacteria 4244
263 Ga0207640_10137462 3300025981 Bacteria 1776
264 Ga0207640_10491500 3300025981 Bacteria 1020
265 Ga0207658_10009247 3300025986 Bacteria 6683
266 Ga0207703_10959614 3300026035 Bacteria 820
267 Ga0207639_10018727 3300026041 Bacteria 4924
268 Ga0207639_10190824 3300026041 Bacteria 1750
269 Ga0207639_11199156 3300026041 Bacteria 712
270 Ga0207678_10023825 3300026067 Bacteria 5353
271 Ga0207678_10707324 3300026067 Bacteria 887
272 Ga0207708_10011810 3300026075 Bacteria 6504
273 Ga0207702_10000055 3300026078 Bacteria 136325
274 Ga0207702_10000102 3300026078 Bacteria 99313
275 Ga0207702_10002975 3300026078 Bacteria 15769
276 Ga0207641_10004476 3300026088 Bacteria 12094
277 Ga0207641_10107442 3300026088 Bacteria 2468
278 Ga0207641_10160768 3300026088 Bacteria 2042
279 Ga0207641_10345245 3300026088 Bacteria 1417
280 Ga0207676_10000009 3300026095 Bacteria 545256
281 Ga0207674_10000378 3300026116 Bacteria 57957
282 Ga0207674_10015609 3300026116 Bacteria 8337
283 Ga0207674_10159794 3300026116 Bacteria 2208
284 Ga0207675_100000012 3300026118 Bacteria 140594
285 Ga0207675_100001338 3300026118 Bacteria 24709
286 Ga0207675_100434749 3300026118 Bacteria 1298
287 Ga0207675_102637589 3300026118 Bacteria 512
288 Ga0207683_11601963 3300026121 Bacteria 600
289 Ga0207698_10145093 3300026142 Bacteria 2051
290 Ga0209974_10359962 3300027876 Bacteria 566
291 Ga0268266_11262592 3300028379 Bacteria 714
292 Ga0268265_10000001 3300028380 Bacteria 1230727
293 Ga0268265_10000021 3300028380 Bacteria 272292
294 Ga0268265_10009112 3300028380 Bacteria 6710
295 Ga0268265_10399614 3300028380 Bacteria 1270
296 Ga0268264_10000820 3300028381 Bacteria 33465
297 Ga0268264_10011692 3300028381 Bacteria 7239
298 Ga0265340_10021945 3300031247 Bacteria 3269
299 Ga0307513_10089017 3300031456 Bacteria 3153
300 Ga0307513_10379964 3300031456 Bacteria 1152
301 Ga0307408_100003396 3300031548 Bacteria 10921
302 Ga0307408_100103881 3300031548 Bacteria 2170
303 Ga0307408_100288246 3300031548 Bacteria 1370
304 Ga0307408_100944126 3300031548 Bacteria 792
305 Ga0307408_102460041 3300031548 Bacteria 506
306 Ga0307405_10014422 3300031731 Bacteria 4250
307 Ga0307405_10873216 3300031731 Bacteria 759
308 Ga0307405_11297191 3300031731 Bacteria 633
309 Ga0307405_11440506 3300031731 Bacteria 603
310 Ga0307413_10727132 3300031824 Bacteria 827
311 Ga0307406_10031543 3300031901 Bacteria 3228
312 Ga0307406_10372115 3300031901 Bacteria 1124
313 Ga0307412_10000933 3300031911 Bacteria 16724
314 Ga0307412_10005222 3300031911 Bacteria 7281
315 Ga0307412_10013627 3300031911 Bacteria 4774
316 Ga0307412_10081832 3300031911 Bacteria 2234
317 Ga0307412_10323819 3300031911 Bacteria 1227
318 Ga0307412_10352527 3300031911 Bacteria 1182
319 Ga0307412_10418028 3300031911 Bacteria 1096
320 Ga0307412_11634182 3300031911 Bacteria 589
321 Ga0307416_100090872 3300032002 Bacteria 2620
322 Ga0307416_100967713 3300032002 Bacteria 953
323 Ga0307414_10008109 3300032004 Bacteria 5934
324 Ga0307414_10083132 3300032004 Bacteria 2350
325 Ga0307414_10187265 3300032004 Bacteria 1671
326 Ga0307414_10643565 3300032004 Bacteria 955
327 Ga0307411_11813690 3300032005 Bacteria 566
328 Ga0307510_10217272 3300033180 Bacteria 1427
329 Ga0373930_0075199 3300034816 Bacteria 774
330 Ga0373948_0151930 3300034817 Bacteria 579
331 Ga0373923_0650819 3300035111 Bacteria 521
332 Ga0373932_0035597 3300035112 Bacteria 1409
333 Ga0373945_0247382 3300035116 Bacteria 752
334 Ga0373962_0209787 3300035242 Bacteria 662
335 Ga0373931_0055059 3300035691 Bacteria 2127
336 Ga0373927_0218525 3300035695 Bacteria 1252
337 Ga0373947_0595454 3300035725 Unclassified 753
338 Ga0373925_0048688 3300037068 Bacteria 3159
339 Ga0373925_0077363 3300037068 Bacteria 2525
340 Ga0373925_0086519 3300037068 Bacteria 2391
341 Ga0395900_0000121 3300037418 Bacteria 135026
342 Ga0395898_0000247 3300037466 Bacteria 135026
343 Ga0395905_0000112 3300037471 Bacteria 135010
344 Ga0395901_0000078 3300038443 Bacteria 135026
345 Ga0436365_0932987 3300039437 Bacteria 652
346 Ga0439448_0006881 3300042005 Bacteria 3280
347 Ga0439455_0028761 3300042012 Bacteria 1370
348 Ga0466973_0107406 3300044659 Bacteria 2345
349 Ga0466968_0144925 3300044735 Bacteria 1088
350 Ga0495629_0085102 3300046459 Bacteria 2206
351 Ga0495653_0614015 3300046463 Bacteria 667
352 Ga0495580_0002971 3300046472 Bacteria 14554
353 Ga0495580_0551921 3300046472 Bacteria 765
354 Ga0495582_0330399 3300046473 Bacteria 877
355 Ga0495639_0611732 3300046475 Bacteria 560
356 Ga0495584_0258990 3300046491 Bacteria 884
357 Ga0495606_0136231 3300046507 Bacteria 1454
358 Ga0495606_0144270 3300046507 Bacteria 1403
359 Ga0495610_0024981 3300046512 Bacteria 3217
360 Ga0495632_0056089 3300046519 Bacteria 1927
361 Ga0495637_0064823 3300046520 Bacteria 1489
362 Ga0495637_0075120 3300046520 Bacteria 1356
363 Ga0495643_0020968 3300046522 Bacteria 3758
364 Ga0495643_0026149 3300046522 Bacteria 3296
365 Ga0495643_0074926 3300046522 Bacteria 1771
366 Ga0495648_0088305 3300046524 Bacteria 1743
367 Ga0495654_0072550 3300046530 Bacteria 1629
368 Ga0495586_0463582 3300046535 Bacteria 730
369 Ga0495609_0031379 3300046538 Bacteria 2416
370 Ga0495597_0017289 3300046542 Bacteria 3397
371 Ga0495633_0300528 3300046558 Bacteria 729
372 Ga0495668_0000001 3300046616 Bacteria 1013420
373 Ga0495668_0029995 3300046616 Bacteria 3072
374 Ga0495668_0077976 3300046616 Bacteria 1819
375 Ga0495668_0079931 3300046616 Bacteria 1794
376 Ga0495625_0000652 3300046660 Bacteria 49796
377 Ga0495625_0001386 3300046660 Bacteria 29753
378 Ga0495625_0048543 3300046660 Bacteria 3056
379 Ga0495658_0003511 3300046683 Bacteria 7758
380 Ga0495669_0001039 3300046684 Bacteria 11573
381 Ga0495669_0003417 3300046684 Bacteria 6539
382 Ga0495613_0194098 3300046689 Bacteria 1434
383 Ga0495660_0304027 3300046810 Bacteria 722
384 Ga0495581_0193625 3300047315 Bacteria 1189
385 Ga0495636_0081643 3300047318 Bacteria 1393
386 Ga0495674_0159523 3300047319 Bacteria 1887
387 Ga0495687_080891 3300047443 Bacteria 1273
388 Ga0495677_0000990 3300047445 Bacteria 11436
389 Ga0495677_0033336 3300047445 Bacteria 1877
390 Ga0495673_0035658 3300047469 Bacteria 2289
391 Ga0495684_0980359 3300047471 Bacteria 538
392 Ga0495686_0000197 3300047472 Bacteria 112818
393 Ga0495686_0001481 3300047472 Bacteria 25533
394 Ga0495686_0005357 3300047472 Bacteria 10149
395 Ga0495686_0116844 3300047472 Bacteria 1594
396 Ga0496100_1413926 3300048903 Bacteria 549
397 Ga0496101_0433807 3300048904 Bacteria 1036
398 Ga0496101_1542495 3300048904 Bacteria 517
399 Ga0496102_0007370 3300048905 Bacteria 9400
400 Ga0496102_0152255 3300048905 Bacteria 2174
401 Ga0496103_0023766 3300048906 Bacteria 3695
402 Ga0496103_0316949 3300048906 Bacteria 1003
403 Ga0496105_0456236 3300048908 Bacteria 1008
404 Ga0496106_0020285 3300048909 Bacteria 4931
405 Ga0496106_0688392 3300048909 Bacteria 815
406 Ga0496107_0248481 3300048910 Bacteria 1323
407 Ga0496107_0708557 3300048910 Bacteria 740
408 Ga0496108_1022799 3300048911 Bacteria 705
409 Ga0496109_0146611 3300048912 Bacteria 2208
410 Ga0496109_1020220 3300048912 Bacteria 765
411 Ga0496109_1370700 3300048912 Bacteria 643
412 Ga0496114_1240890 3300048917 Bacteria 632
413 Ga0496115_0003662 3300048918 Bacteria 11055
414 Ga0496115_0009879 3300048918 Bacteria 7105
415 Ga0496117_0164243 3300048920 Bacteria 1297
416 Ga0496118_0339920 3300048921 Bacteria 805
417 Ga0496119_0072336 3300048922 Bacteria 2015
418 Ga0496121_0000584 3300048924 Bacteria 68507
419 Ga0496122_0115288 3300048925 Bacteria 1751
420 Ga0496124_0552451 3300048927 Bacteria 760
421 Ga0496125_0011116 3300048928 Bacteria 9030
422 Ga0496125_0380688 3300048928 Bacteria 832
423 Ga0496126_0170820 3300048929 Bacteria 1852
424 Ga0496126_0236607 3300048929 Bacteria 1528
425 Ga0496126_0244351 3300048929 Bacteria 1498
426 Ga0496126_0248848 3300048929 Bacteria 1482
427 Ga0501290_000181 3300049513 Bacteria 10137
428 Ga0501292_000065 3300049515 Bacteria 21691
429 Ga0501031_0332692 3300049568 Bacteria 983
430 Ga0501032_0059401 3300049569 Bacteria 2566
431 Ga0501032_0294076 3300049569 Bacteria 1050
432 Ga0501033_0020758 3300049570 Bacteria 4962
433 Ga0501033_0667423 3300049570 Bacteria 709
434 Ga0501034_0224338 3300049571 Bacteria 1830
435 Ga0501034_1363133 3300049571 Bacteria 585
436 Ga0501036_0151015 3300049572 Bacteria 1959
437 Ga0501037_0190420 3300049573 Bacteria 1452
438 Ga0501037_0332876 3300049573 Bacteria 1050
439 Ga0501037_0687675 3300049573 Bacteria 681
440 Ga0501038_0007690 3300049574 Bacteria 9937
441 Ga0501038_1221893 3300049574 Bacteria 545
442 Ga0501039_0071371 3300049575 Bacteria 2698
443 Ga0501039_0396019 3300049575 Bacteria 1085
444 Ga0501040_0205215 3300049576 Bacteria 1400
445 Ga0501041_0572605 3300049577 Bacteria 720
446 Ga0501041_0989273 3300049577 Bacteria 541
447 Ga0501042_0178616 3300049578 Bacteria 1531
448 Ga0501042_0226406 3300049578 Bacteria 1349
449 Ga0501043_0125756 3300049579 Bacteria 2010
450 Ga0501043_0479669 3300049579 Bacteria 931
451 Ga0501046_0031392 3300049580 Bacteria 4306
452 Ga0501046_0084567 3300049580 Bacteria 2447
453 Ga0501046_0107625 3300049580 Bacteria 2133
454 Ga0501047_0001735 3300049581 Bacteria 21178
455 Ga0501047_0174128 3300049581 Bacteria 2020
456 Ga0501047_0825806 3300049581 Bacteria 741
457 Ga0501067_0565429 3300049583 Bacteria 637
458 Ga0501068_1121980 3300049584 Bacteria 520
459 Ga0501072_1531089 3300049588 Bacteria 514
460 Ga0501074_0081648 3300049590 Bacteria 2319
461 Ga0501074_0598019 3300049590 Bacteria 780
462 Ga0501074_0842326 3300049590 Bacteria 646
463 Ga0501075_0028748 3300049591 Bacteria 4106
464 Ga0501075_0081653 3300049591 Bacteria 2448
465 Ga0501075_0391324 3300049591 Bacteria 1060
466 Ga0501076_0160981 3300049592 Bacteria 1828
467 Ga0501076_0904124 3300049592 Bacteria 728
468 Ga0501077_0017980 3300049593 Bacteria 4468
469 Ga0501077_0218965 3300049593 Bacteria 1210
470 Ga0501206_000553 3300049653 Bacteria 4545
471 Ga0501222_002643 3300049662 Bacteria 2475
472 Ga0501235_053637 3300049669 Bacteria 937
473 Ga0501259_000873 3300049688 Bacteria 4962
474 Ga0501261_000083 3300049690 Bacteria 15292
475 Ga0501225_0002881 3300049705 Bacteria 5282
476 Ga0501245_000315 3300049708 Bacteria 5713
477 Ga0501079_0013080 3300049741 Bacteria 6330
478 Ga0501079_0085233 3300049741 Bacteria 2445
479 Ga0501079_0605917 3300049741 Bacteria 862
480 Ga0501079_1003844 3300049741 Bacteria 657
481 Ga0501081_0033306 3300049743 Bacteria 3500
482 Ga0501081_0294688 3300049743 Bacteria 1190
483 Ga0501081_0402694 3300049743 Bacteria 1013
484 Ga0501081_0824323 3300049743 Bacteria 699
485 Ga0501279_000010 3300049775 Bacteria 103375
486 Ga0501280_000132 3300049776 Bacteria 19443
487 Ga0501282_000304 3300049778 Bacteria 5945
488 Ga0501035_0010025 3300049822 Bacteria 8791
489 Ga0501035_0202184 3300049822 Bacteria 1703
490 Ga0501044_0005940 3300049823 Bacteria 13522
491 Ga0501044_0470846 3300049823 Bacteria 1160
492 Ga0501044_0684985 3300049823 Bacteria 912
493 Ga0501045_0213741 3300049824 Bacteria 1436
494 Ga0501045_0264245 3300049824 Bacteria 1281
495 nmdc:mga03683_466927_c1 3300050489 Unclassified 608
496 nmdc:mga0k408_751319_c1 3300050493 Bacteria 570
497 nmdc:mga05p37_195268_c1 3300050507 Bacteria 2454
498 nmdc:mga0qj67_3755_c1 3300050509 Bacteria 10967
499 nmdc:mga06r32_26245_c1 3300050510 Bacteria 5429
500 nmdc:mga06r32_53443_c1 3300050510 Bacteria 3869
501 nmdc:mga0n895_18222_c1 3300050512 Bacteria 6492
502 nmdc:mga0n895_192213_c1 3300050512 Bacteria 2072
503 nmdc:mga0rr50_365312_c1 3300050513 Bacteria 1215
504 nmdc:mga0rr50_6201_c1 3300050513 Bacteria 7245
505 nmdc:mga08x19_160_c1 3300050514 Bacteria 55694
506 nmdc:mga08x19_415510_c1 3300050514 Bacteria 945
507 nmdc:mga08x19_79557_c1 3300050514 Bacteria 2150
508 Ga0500635_0326306 3300053080 Bacteria 607
509 Ga0500643_018789 3300053087 Bacteria 2287
510 Ga0500647_0210559 3300053091 Bacteria 876
511 Ga0500651_0042012 3300053093 Bacteria 2881
512 Ga0500651_0197459 3300053093 Bacteria 1188
513 Ga0500555_030865 3300053103 Bacteria 1520
514 Ga0500592_000112 3300053116 Bacteria 17479
515 Ga0500592_003159 3300053116 Bacteria 2633
516 Ga0500592_005212 3300053116 Bacteria 2065
517 Ga0500614_049042 3300053123 Bacteria 1102
518 Ga0500618_075755 3300053125 Bacteria 754
519 Ga0500642_0000929 3300053130 Bacteria 8497
520 Ga0500655_002261 3300053133 Bacteria 3536
521 Ga0500658_0020189 3300053134 Bacteria 2513
522 Ga0500658_0068383 3300053134 Bacteria 1493
523 Ga0500559_0162951 3300053136 Bacteria 1048
524 Ga0500559_0402736 3300053136 Unclassified 636
525 Ga0500577_0097501 3300053142 Bacteria 1197
526 Ga0500590_025754 3300053148 Bacteria 3054
527 Ga0500604_0087141 3300053151 Bacteria 1016
528 Ga0500616_0083242 3300053153 Bacteria 1603
529 Ga0500622_0025432 3300053156 Bacteria 3127
530 Ga0500627_0006860 3300053158 Bacteria 3915
531 Ga0500627_0093338 3300053158 Bacteria 1347
532 Ga0500627_0482623 3300053158 Bacteria 518
533 Ga0500639_015232 3300053163 Bacteria 4047
534 Ga0500570_000250 3300053724 Bacteria 18136
535 Ga0500645_012570 3300053730 Bacteria 2734
536 Ga0500596_001810 3300053735 Bacteria 4296
537 Ga0501084_0249586 3300054114 Bacteria 1498
538 Ga0501084_1360827 3300054114 Bacteria 595
539 Ga0500661_010604 3300055283 Bacteria 1677
540 Ga0501082_0058228 3300060353 Bacteria 3329
541 Ga0501082_0199023 3300060353 Bacteria 1743
542 Ga0501082_0283385 3300060353 Bacteria 1442
543 Ga0501082_1151464 3300060353 Bacteria 678
544 Ga0501082_1364792 3300060353 Bacteria 619
545 Ga0530510_0046429 3300061734 Bacteria 3138
546 Ga0530510_0123370 3300061734 Bacteria 1903

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025292 Ga0209676_1061043 Ga0209676_10610433 70
2 3300025304 Ga0209257_1002730 Ga0209257_100273014 70
3 3300005456 Ga0070678_101532712 Ga0070678_1015327122 81
4 3300026121 Ga0207683_11601963 Ga0207683_116019632 81
5 3300031456 Ga0307513_10089017 Ga0307513_100890174 81
6 3300033180 Ga0307510_10217272 Ga0307510_102172722 81
7 3300046524 Ga0495648_0088305 Ga0495648_0088305_227_472 81
8 3300046660 Ga0495625_0001386 Ga0495625_0001386_13713_13958 81
9 3300047445 Ga0495677_0000990 Ga0495677_0000990_3115_3360 81
10 iso_pu_bacteria 2643221541 2643727850 81
11 iso_pu_bacteria 2643221606 2644043200 81
12 iso_pu_bacteria 2643221671 2644395369 81
13 iso_pu_bacteria 2852653556 2852655012 81
14 iso_pu_bacteria 2852680915 2852681833 81
15 3300002773 JGI25152J39213_1053442 JGI25152J39213_10534422 83
16 3300002774 JGI25150J39212_1000498 JGI25150J39212_10004984 83
17 3300003215 JGI25153J46596_10000361 JGI25153J46596_100003618 83
18 3300003771 Ga0055526_1001039 Ga0055526_100103914 83
19 3300003773 Ga0055537_1007000 Ga0055537_10070005 83
20 3300003781 Ga0055536_1013025 Ga0055536_10130252 83
21 3300003781 Ga0055536_1016996 Ga0055536_10169963 83
22 3300003791 Ga0055530_10012977 Ga0055530_100129775 83
23 3300003791 Ga0055530_10059230 Ga0055530_100592301 83
24 3300003792 Ga0055540_1001214 Ga0055540_10012146 83
25 3300003794 Ga0055531_10018483 Ga0055531_100184835 83
26 3300003794 Ga0055531_10018492 Ga0055531_100184925 83
27 3300005262 Ga0065165_1057455 Ga0065165_10574553 83
28 3300005335 Ga0070666_10034718 Ga0070666_100347182 83
29 3300005347 Ga0070668_100633807 Ga0070668_1006338072 83
30 3300005353 Ga0070669_101251793 Ga0070669_1012517931 83
31 3300005354 Ga0070675_100378139 Ga0070675_1003781392 83
32 3300005355 Ga0070671_100212684 Ga0070671_1002126843 83
33 3300005356 Ga0070674_100179362 Ga0070674_1001793622 83
34 3300005434 Ga0070709_11087665 Ga0070709_110876652 83
35 3300005435 Ga0070714_100220252 Ga0070714_1002202523 83
36 3300005435 Ga0070714_100924806 Ga0070714_1009248062 83
37 3300005436 Ga0070713_100000137 Ga0070713_10000013750 83
38 3300005437 Ga0070710_10509418 Ga0070710_105094182 83
39 3300005439 Ga0070711_100184496 Ga0070711_1001844962 83
40 3300005440 Ga0070705_100202078 Ga0070705_1002020783 83
41 3300005455 Ga0070663_100990798 Ga0070663_1009907982 83
42 3300005458 Ga0070681_10527303 Ga0070681_105273032 83
43 3300005468 Ga0070707_101922456 Ga0070707_1019224562 83
44 3300005518 Ga0070699_100490323 Ga0070699_1004903232 83
45 3300005539 Ga0068853_100039901 Ga0068853_1000399013 83
46 3300005543 Ga0070672_101757862 Ga0070672_1017578622 83
47 3300005545 Ga0070695_100083387 Ga0070695_1000833872 83
48 3300005547 Ga0070693_100325884 Ga0070693_1003258843 83
49 3300005563 Ga0068855_100090917 Ga0068855_1000909174 83
50 3300005564 Ga0070664_100176887 Ga0070664_1001768873 83
51 3300005577 Ga0068857_100004447 Ga0068857_1000044479 83
52 3300005614 Ga0068856_100064923 Ga0068856_1000649234 83
53 3300005616 Ga0068852_100070398 Ga0068852_1000703982 83
54 3300005841 Ga0068863_100400638 Ga0068863_1004006382 83
55 3300005842 Ga0068858_101606114 Ga0068858_1016061142 83
56 3300006173 Ga0070716_100008484 Ga0070716_1000084846 83
57 3300006175 Ga0070712_100000239 Ga0070712_10000023934 83
58 3300006358 Ga0068871_100168211 Ga0068871_1001682113 83
59 3300006358 Ga0068871_102311581 Ga0068871_1023115811 83
60 3300006871 Ga0075434_100026909 Ga0075434_1000269092 83
61 3300006914 Ga0075436_100001310 Ga0075436_10000131017 83
62 3300006914 Ga0075436_100116938 Ga0075436_1001169382 83
63 3300006914 Ga0075436_100371023 Ga0075436_1003710232 83
64 3300007076 Ga0075435_100071476 Ga0075435_1000714763 83
65 3300007076 Ga0075435_100983209 Ga0075435_1009832092 83
66 3300009093 Ga0105240_10003562 Ga0105240_1000356224 83
67 3300009098 Ga0105245_11295182 Ga0105245_112951822 83
68 3300009098 Ga0105245_12849658 Ga0105245_128496582 83
69 3300009174 Ga0105241_10036953 Ga0105241_100369533 83
70 3300009174 Ga0105241_11027853 Ga0105241_110278532 83
71 3300009545 Ga0105237_10009554 Ga0105237_100095543 83
72 3300009551 Ga0105238_10001025 Ga0105238_1000102515 83
73 3300010375 Ga0105239_10131618 Ga0105239_101316183 83
74 3300013100 Ga0157373_10002530 Ga0157373_1000253016 83
75 3300013100 Ga0157373_10191518 Ga0157373_101915182 83
76 3300013104 Ga0157370_10016043 Ga0157370_100160432 83
77 3300013105 Ga0157369_10044165 Ga0157369_100441653 83
78 3300013105 Ga0157369_12437252 Ga0157369_124372522 83
79 3300013296 Ga0157374_10930230 Ga0157374_109302302 83
80 3300013307 Ga0157372_10109483 Ga0157372_101094833 83
81 3300014325 Ga0163163_10248525 Ga0163163_102485252 83
82 3300014325 Ga0163163_10324036 Ga0163163_103240363 83
83 3300014968 Ga0157379_10165907 Ga0157379_101659074 83
84 3300017792 Ga0163161_10390500 Ga0163161_103905001 83
85 3300025245 Ga0207425_1000041 Ga0207425_1000041101 83
86 3300025258 Ga0209129_1001877 Ga0209129_100187711 83
87 3300025263 Ga0209565_1000753 Ga0209565_10007538 83
88 3300025292 Ga0209676_1000049 Ga0209676_1000049328 83
89 3300025292 Ga0209676_1002202 Ga0209676_100220215 83
90 3300025294 Ga0209025_1000068 Ga0209025_1000068270 83
91 3300025295 Ga0209564_1005033 Ga0209564_10050336 83
92 3300025295 Ga0209564_1007114 Ga0209564_10071143 83
93 3300025297 Ga0209758_1000004 Ga0209758_1000004169 83
94 3300025297 Ga0209758_1038476 Ga0209758_10384764 83
95 3300025298 Ga0209050_1000001 Ga0209050_10000012120 83
96 3300025298 Ga0209050_1006139 Ga0209050_10061395 83
97 3300025298 Ga0209050_1007307 Ga0209050_10073074 83
98 3300025298 Ga0209050_1009678 Ga0209050_10096785 83
99 3300025302 Ga0207426_1017332 Ga0207426_10173323 83
100 3300025303 Ga0209051_1000232 Ga0209051_100023253 83
101 3300025304 Ga0209257_1002216 Ga0209257_10022166 83
102 3300025304 Ga0209257_1002243 Ga0209257_10022436 83
103 3300025898 Ga0207692_10071073 Ga0207692_100710732 83
104 3300025901 Ga0207688_10716662 Ga0207688_107166622 83
105 3300025903 Ga0207680_10743809 Ga0207680_107438092 83
106 3300025906 Ga0207699_10000510 Ga0207699_1000051022 83
107 3300025911 Ga0207654_10930931 Ga0207654_109309312 83
108 3300025914 Ga0207671_10105574 Ga0207671_101055743 83
109 3300025915 Ga0207693_10000668 Ga0207693_1000066834 83
110 3300025916 Ga0207663_10011019 Ga0207663_100110192 83
111 3300025916 Ga0207663_10181128 Ga0207663_101811282 83
112 3300025917 Ga0207660_11011263 Ga0207660_110112631 83
113 3300025920 Ga0207649_11448668 Ga0207649_114486682 83
114 3300025922 Ga0207646_10437367 Ga0207646_104373672 83
115 3300025924 Ga0207694_10195536 Ga0207694_101955362 83
116 3300025926 Ga0207659_10317806 Ga0207659_103178062 83
117 3300025928 Ga0207700_10000005 Ga0207700_10000005284 83
118 3300025929 Ga0207664_10080204 Ga0207664_100802043 83
119 3300025931 Ga0207644_10293912 Ga0207644_102939122 83
120 3300025933 Ga0207706_10043912 Ga0207706_100439123 83
121 3300025937 Ga0207669_10411154 Ga0207669_104111542 83
122 3300025939 Ga0207665_10138331 Ga0207665_101383312 83
123 3300025945 Ga0207679_10661544 Ga0207679_106615442 83
124 3300025949 Ga0207667_10053892 Ga0207667_100538923 83
125 3300025972 Ga0207668_10333954 Ga0207668_103339542 83
126 3300025981 Ga0207640_10491500 Ga0207640_104915002 83
127 3300026035 Ga0207703_10959614 Ga0207703_109596142 83
128 3300026041 Ga0207639_10018727 Ga0207639_100187274 83
129 3300026041 Ga0207639_11199156 Ga0207639_111991562 83
130 3300026067 Ga0207678_10707324 Ga0207678_107073242 83
131 3300026078 Ga0207702_10000055 Ga0207702_10000055149 83
132 3300026078 Ga0207702_10000102 Ga0207702_1000010243 83
133 3300026078 Ga0207702_10002975 Ga0207702_100029753 83
134 3300026088 Ga0207641_10160768 Ga0207641_101607683 83
135 3300026116 Ga0207674_10000378 Ga0207674_1000037846 83
136 3300026118 Ga0207675_102637589 Ga0207675_1026375892 83
137 3300026142 Ga0207698_10145093 Ga0207698_101450932 83
138 3300031247 Ga0265340_10021945 Ga0265340_100219452 83
139 3300031731 Ga0307405_10873216 Ga0307405_108732162 83
140 3300031731 Ga0307405_11440506 Ga0307405_114405061 83
141 3300031911 Ga0307412_10005222 Ga0307412_100052228 83
142 3300034816 Ga0373930_0075199 Ga0373930_0075199_202_453 83
143 3300034817 Ga0373948_0151930 Ga0373948_0151930_94_345 83
144 3300035111 Ga0373923_0650819 Ga0373923_0650819_73_324 83
145 3300035112 Ga0373932_0035597 Ga0373932_0035597_1085_1336 83
146 3300035116 Ga0373945_0247382 Ga0373945_0247382_386_637 83
147 3300035691 Ga0373931_0055059 Ga0373931_0055059_325_576 83
148 3300037068 Ga0373925_0048688 Ga0373925_0048688_2547_2798 83
149 3300037068 Ga0373925_0077363 Ga0373925_0077363_111_362 83
150 3300037418 Ga0395900_0000121 Ga0395900_0000121_87310_87561 83
151 3300037466 Ga0395898_0000247 Ga0395898_0000247_47466_47717 83
152 3300037471 Ga0395905_0000112 Ga0395905_0000112_47450_47701 83
153 3300038443 Ga0395901_0000078 Ga0395901_0000078_87310_87561 83
154 3300042005 Ga0439448_0006881 Ga0439448_0006881_1965_2216 83
155 3300042012 Ga0439455_0028761 Ga0439455_0028761_1055_1306 83
156 3300046459 Ga0495629_0085102 Ga0495629_0085102_1179_1430 83
157 3300046463 Ga0495653_0614015 Ga0495653_0614015_70_321 83
158 3300046472 Ga0495580_0002971 Ga0495580_0002971_6484_6735 83
159 3300046472 Ga0495580_0551921 Ga0495580_0551921_66_317 83
160 3300046473 Ga0495582_0330399 Ga0495582_0330399_331_582 83
161 3300046475 Ga0495639_0611732 Ga0495639_0611732_233_484 83
162 3300046535 Ga0495586_0463582 Ga0495586_0463582_34_285 83
163 3300046683 Ga0495658_0003511 Ga0495658_0003511_5682_5933 83
164 3300046689 Ga0495613_0194098 Ga0495613_0194098_866_1117 83
165 3300046810 Ga0495660_0304027 Ga0495660_0304027_158_409 83
166 3300047315 Ga0495581_0193625 Ga0495581_0193625_328_579 83
167 3300047319 Ga0495674_0159523 Ga0495674_0159523_1148_1399 83
168 3300047443 Ga0495687_080891 Ga0495687_080891_278_529 83
169 3300047471 Ga0495684_0980359 Ga0495684_0980359_60_311 83
170 3300048903 Ga0496100_1413926 Ga0496100_1413926_205_456 83
171 3300048905 Ga0496102_0152255 Ga0496102_0152255_715_966 83
172 3300048906 Ga0496103_0316949 Ga0496103_0316949_662_913 83
173 3300048909 Ga0496106_0688392 Ga0496106_0688392_384_635 83
174 3300048910 Ga0496107_0708557 Ga0496107_0708557_395_646 83
175 3300048911 Ga0496108_1022799 Ga0496108_1022799_295_546 83
176 3300048912 Ga0496109_1020220 Ga0496109_1020220_452_703 83
177 3300048917 Ga0496114_1240890 Ga0496114_1240890_273_524 83
178 3300048918 Ga0496115_0003662 Ga0496115_0003662_4098_4349 83
179 3300048920 Ga0496117_0164243 Ga0496117_0164243_155_406 83
180 3300048921 Ga0496118_0339920 Ga0496118_0339920_273_524 83
181 3300049568 Ga0501031_0332692 Ga0501031_0332692_535_786 83
182 3300049569 Ga0501032_0059401 Ga0501032_0059401_1611_1862 83
183 3300049569 Ga0501032_0294076 Ga0501032_0294076_161_412 83
184 3300049570 Ga0501033_0020758 Ga0501033_0020758_3945_4196 83
185 3300049571 Ga0501034_0224338 Ga0501034_0224338_416_667 83
186 3300049572 Ga0501036_0151015 Ga0501036_0151015_804_1055 83
187 3300049573 Ga0501037_0190420 Ga0501037_0190420_579_830 83
188 3300049573 Ga0501037_0687675 Ga0501037_0687675_347_598 83
189 3300049574 Ga0501038_0007690 Ga0501038_0007690_417_668 83
190 3300049575 Ga0501039_0071371 Ga0501039_0071371_901_1152 83
191 3300049578 Ga0501042_0226406 Ga0501042_0226406_139_390 83
192 3300049579 Ga0501043_0125756 Ga0501043_0125756_1102_1353 83
193 3300049580 Ga0501046_0084567 Ga0501046_0084567_592_843 83
194 3300049581 Ga0501047_0174128 Ga0501047_0174128_1199_1450 83
195 3300049822 Ga0501035_0010025 Ga0501035_0010025_972_1223 83
196 3300049822 Ga0501035_0202184 Ga0501035_0202184_850_1101 83
197 3300049823 Ga0501044_0005940 Ga0501044_0005940_3930_4181 83
198 3300049823 Ga0501044_0684985 Ga0501044_0684985_118_369 83
199 3300050489 nmdc:mga03683_466927_c1 nmdc:mga03683_466927_c1_337_588 83
200 3300050512 nmdc:mga0n895_18222_c1 nmdc:mga0n895_18222_c1_4942_5193 83
201 3300050512 nmdc:mga0n895_192213_c1 nmdc:mga0n895_192213_c1_292_543 83
202 3300050513 nmdc:mga0rr50_365312_c1 nmdc:mga0rr50_365312_c1_876_1127 83
203 3300050513 nmdc:mga0rr50_6201_c1 nmdc:mga0rr50_6201_c1_1843_2094 83
204 3300050514 nmdc:mga08x19_160_c1 nmdc:mga08x19_160_c1_14428_14679 83
205 3300050514 nmdc:mga08x19_415510_c1 nmdc:mga08x19_415510_c1_431_682 83
206 3300050514 nmdc:mga08x19_79557_c1 nmdc:mga08x19_79557_c1_673_924 83
207 3300053136 Ga0500559_0162951 Ga0500559_0162951_127_378 83
208 iso_pu_bacteria 2582581305 2585260719 83
209 3300003187 JGI25151J46595_10145939 JGI25151J46595_101459391 84
210 3300003215 JGI25153J46596_10000002 JGI25153J46596_1000000222 84
211 3300003759 Ga0055525_1000104 Ga0055525_1000104104 84
212 3300003781 Ga0055536_1012711 Ga0055536_10127114 84
213 3300003791 Ga0055530_10000013 Ga0055530_10000013115 84
214 3300003794 Ga0055531_10000627 Ga0055531_1000062714 84
215 3300005339 Ga0070660_100826399 Ga0070660_1008263991 84
216 3300005344 Ga0070661_100146165 Ga0070661_1001461653 84
217 3300006051 Ga0075364_10572033 Ga0075364_105720332 84
218 3300006178 Ga0075367_10464646 Ga0075367_104646462 84
219 3300006195 Ga0075366_10046739 Ga0075366_100467392 84
220 3300006353 Ga0075370_10216592 Ga0075370_102165922 84
221 3300009545 Ga0105237_10002989 Ga0105237_1000298920 84
222 3300010375 Ga0105239_10000061 Ga0105239_1000006140 84
223 3300025229 Ga0209147_100453 Ga0209147_10045320 84
224 3300025230 Ga0209563_100116 Ga0209563_10011634 84
225 3300025292 Ga0209676_1000221 Ga0209676_1000221113 84
226 3300025297 Ga0209758_1000001 Ga0209758_1000001821 84
227 3300025298 Ga0209050_1000042 Ga0209050_1000042274 84
228 3300025304 Ga0209257_1000135 Ga0209257_1000135113 84
229 3300025913 Ga0207695_10013684 Ga0207695_100136848 84
230 3300025914 Ga0207671_10005232 Ga0207671_100052326 84
231 3300025919 Ga0207657_10527226 Ga0207657_105272262 84
232 3300025920 Ga0207649_10037880 Ga0207649_100378804 84
233 3300025949 Ga0207667_11420978 Ga0207667_114209782 84
234 3300025981 Ga0207640_10017027 Ga0207640_100170273 84
235 3300046491 Ga0495584_0258990 Ga0495584_0258990_345_599 84
236 3300046507 Ga0495606_0136231 Ga0495606_0136231_847_1101 84
237 3300046507 Ga0495606_0144270 Ga0495606_0144270_733_987 84
238 3300046520 Ga0495637_0064823 Ga0495637_0064823_995_1249 84
239 3300046522 Ga0495643_0026149 Ga0495643_0026149_2995_3249 84
240 3300046616 Ga0495668_0079931 Ga0495668_0079931_387_641 84
241 3300046684 Ga0495669_0001039 Ga0495669_0001039_9215_9469 84
242 3300047318 Ga0495636_0081643 Ga0495636_0081643_462_716 84
243 3300047445 Ga0495677_0033336 Ga0495677_0033336_1277_1531 84
244 3300048904 Ga0496101_1542495 Ga0496101_1542495_113_367 84
245 3300048924 Ga0496121_0000584 Ga0496121_0000584_27754_28008 84
246 3300048929 Ga0496126_0170820 Ga0496126_0170820_362_616 84
247 3300053080 Ga0500635_0326306 Ga0500635_0326306_218_472 84
248 iso_pu_bacteria 2523231067 2523469400 84
249 3300001989 JGI24739J22299_10128976 JGI24739J22299_101289762 85
250 3300002076 JGI24749J21850_1000076 JGI24749J21850_100007618 85
251 3300002459 JGI24751J29686_10000195 JGI24751J29686_1000019517 85
252 3300003781 Ga0055536_1008019 Ga0055536_10080195 85
253 3300003791 Ga0055530_10028706 Ga0055530_100287062 85
254 3300003794 Ga0055531_10006022 Ga0055531_100060223 85
255 3300005262 Ga0065165_1009533 Ga0065165_10095333 85
256 3300005295 Ga0065707_10087462 Ga0065707_100874624 85
257 3300005330 Ga0070690_100345633 Ga0070690_1003456333 85
258 3300005331 Ga0070670_100000033 Ga0070670_10000003356 85
259 3300005334 Ga0068869_100535616 Ga0068869_1005356162 85
260 3300005336 Ga0070680_100001191 Ga0070680_10000119112 85
261 3300005340 Ga0070689_100485531 Ga0070689_1004855312 85
262 3300005341 Ga0070691_10001146 Ga0070691_1000114611 85
263 3300005343 Ga0070687_100273271 Ga0070687_1002732711 85
264 3300005347 Ga0070668_100072912 Ga0070668_1000729123 85
265 3300005347 Ga0070668_102088262 Ga0070668_1020882622 85
266 3300005353 Ga0070669_100000005 Ga0070669_10000000571 85
267 3300005367 Ga0070667_100005221 Ga0070667_10000522112 85
268 3300005367 Ga0070667_100632902 Ga0070667_1006329022 85
269 3300005406 Ga0070703_10010769 Ga0070703_100107693 85
270 3300005438 Ga0070701_10052747 Ga0070701_100527472 85
271 3300005440 Ga0070705_100000042 Ga0070705_10000004216 85
272 3300005441 Ga0070700_100009319 Ga0070700_1000093196 85
273 3300005444 Ga0070694_100000934 Ga0070694_10000093418 85
274 3300005445 Ga0070708_100438445 Ga0070708_1004384452 85
275 3300005455 Ga0070663_100005131 Ga0070663_10000513110 85
276 3300005456 Ga0070678_100742932 Ga0070678_1007429321 85
277 3300005457 Ga0070662_101723602 Ga0070662_1017236022 85
278 3300005468 Ga0070707_100233325 Ga0070707_1002333253 85
279 3300005518 Ga0070699_100000770 Ga0070699_1000007708 85
280 3300005530 Ga0070679_100378582 Ga0070679_1003785822 85
281 3300005536 Ga0070697_100083394 Ga0070697_1000833942 85
282 3300005539 Ga0068853_100256703 Ga0068853_1002567033 85
283 3300005544 Ga0070686_100063163 Ga0070686_1000631635 85
284 3300005545 Ga0070695_100003671 Ga0070695_1000036712 85
285 3300005546 Ga0070696_100000734 Ga0070696_10000073410 85
286 3300005547 Ga0070693_100074514 Ga0070693_1000745142 85
287 3300005549 Ga0070704_100000273 Ga0070704_1000002738 85
288 3300005577 Ga0068857_100004666 Ga0068857_10000466612 85
289 3300005577 Ga0068857_100184472 Ga0068857_1001844723 85
290 3300005578 Ga0068854_100176289 Ga0068854_1001762893 85
291 3300005615 Ga0070702_100346244 Ga0070702_1003462442 85
292 3300005616 Ga0068852_100873100 Ga0068852_1008731003 85
293 3300005616 Ga0068852_101902397 Ga0068852_1019023972 85
294 3300005617 Ga0068859_100002190 Ga0068859_10000219019 85
295 3300005617 Ga0068859_100007105 Ga0068859_1000071058 85
296 3300005618 Ga0068864_100000042 Ga0068864_10000004257 85
297 3300005618 Ga0068864_100250892 Ga0068864_1002508922 85
298 3300005618 Ga0068864_101063769 Ga0068864_1010637692 85
299 3300005719 Ga0068861_100000085 Ga0068861_1000000854 85
300 3300005719 Ga0068861_100002413 Ga0068861_1000024134 85
301 3300005719 Ga0068861_101092410 Ga0068861_1010924101 85
302 3300005841 Ga0068863_100001219 Ga0068863_1000012191 85
303 3300005841 Ga0068863_100068601 Ga0068863_1000686015 85
304 3300005841 Ga0068863_100393185 Ga0068863_1003931852 85
305 3300005843 Ga0068860_100053584 Ga0068860_1000535846 85
306 3300005843 Ga0068860_100332267 Ga0068860_1003322673 85
307 3300005844 Ga0068862_100000005 Ga0068862_10000000578 85
308 3300005844 Ga0068862_100000149 Ga0068862_10000014968 85
309 3300005844 Ga0068862_100008887 Ga0068862_1000088874 85
310 3300005844 Ga0068862_100323134 Ga0068862_1003231343 85
311 3300005937 Ga0081455_10190567 Ga0081455_101905672 85
312 3300005937 Ga0081455_10498668 Ga0081455_104986682 85
313 3300006846 Ga0075430_100059184 Ga0075430_1000591843 85
314 3300006847 Ga0075431_100025956 Ga0075431_1000259566 85
315 3300006847 Ga0075431_100347112 Ga0075431_1003471122 85
316 3300006880 Ga0075429_101470379 Ga0075429_1014703792 85
317 3300006931 Ga0097620_100002190 Ga0097620_1000021905 85
318 3300006931 Ga0097620_100007105 Ga0097620_10000710510 85
319 3300006931 Ga0097620_100011274 Ga0097620_10001127411 85
320 3300009093 Ga0105240_11844911 Ga0105240_118449112 85
321 3300009101 Ga0105247_10004166 Ga0105247_1000416612 85
322 3300009147 Ga0114129_10232685 Ga0114129_102326855 85
323 3300009174 Ga0105241_12547078 Ga0105241_125470782 85
324 3300009177 Ga0105248_10000171 Ga0105248_1000017117 85
325 3300009177 Ga0105248_10013399 Ga0105248_100133997 85
326 3300009177 Ga0105248_10102363 Ga0105248_101023634 85
327 3300009553 Ga0105249_10000056 Ga0105249_1000005680 85
328 3300009553 Ga0105249_10017548 Ga0105249_100175483 85
329 3300010375 Ga0105239_11365865 Ga0105239_113658652 85
330 3300010375 Ga0105239_12687839 Ga0105239_126878392 85
331 3300011119 Ga0105246_10036426 Ga0105246_100364263 85
332 3300013105 Ga0157369_10094953 Ga0157369_100949533 85
333 3300013306 Ga0163162_12458742 Ga0163162_124587422 85
334 3300014325 Ga0163163_10013144 Ga0163163_100131445 85
335 3300014326 Ga0157380_10006098 Ga0157380_1000609811 85
336 3300014968 Ga0157379_10046909 Ga0157379_100469096 85
337 3300015690 Ga0183363_1008 Ga0183363_100858 85
338 3300016635 Ga0183361_15479 Ga0183361_154792 85
339 3300017792 Ga0163161_10328917 Ga0163161_103289173 85
340 3300025292 Ga0209676_1000349 Ga0209676_100034982 85
341 3300025292 Ga0209676_1000453 Ga0209676_100045325 85
342 3300025298 Ga0209050_1000822 Ga0209050_100082224 85
343 3300025298 Ga0209050_1019380 Ga0209050_10193803 85
344 3300025298 Ga0209050_1031520 Ga0209050_10315203 85
345 3300025303 Ga0209051_1067540 Ga0209051_10675403 85
346 3300025304 Ga0209257_1000487 Ga0209257_100048713 85
347 3300025885 Ga0207653_10004593 Ga0207653_100045936 85
348 3300025900 Ga0207710_10075737 Ga0207710_100757372 85
349 3300025900 Ga0207710_10330329 Ga0207710_103303291 85
350 3300025901 Ga0207688_10216775 Ga0207688_102167752 85
351 3300025904 Ga0207647_10587679 Ga0207647_105876792 85
352 3300025917 Ga0207660_10002046 Ga0207660_1000204611 85
353 3300025918 Ga0207662_10533774 Ga0207662_105337742 85
354 3300025921 Ga0207652_10245347 Ga0207652_102453472 85
355 3300025922 Ga0207646_10241257 Ga0207646_102412573 85
356 3300025923 Ga0207681_10000003 Ga0207681_10000003242 85
357 3300025924 Ga0207694_11406428 Ga0207694_114064282 85
358 3300025925 Ga0207650_10000012 Ga0207650_10000012250 85
359 3300025926 Ga0207659_10199817 Ga0207659_101998171 85
360 3300025933 Ga0207706_10468972 Ga0207706_104689721 85
361 3300025935 Ga0207709_10871201 Ga0207709_108712012 85
362 3300025936 Ga0207670_10603416 Ga0207670_106034162 85
363 3300025941 Ga0207711_10001461 Ga0207711_100014616 85
364 3300025941 Ga0207711_10011132 Ga0207711_100111326 85
365 3300025941 Ga0207711_10370348 Ga0207711_103703482 85
366 3300025942 Ga0207689_10306454 Ga0207689_103064542 85
367 3300025961 Ga0207712_10000015 Ga0207712_10000015215 85
368 3300025961 Ga0207712_10016802 Ga0207712_100168024 85
369 3300025972 Ga0207668_10026421 Ga0207668_100264215 85
370 3300025972 Ga0207668_11289646 Ga0207668_112896462 85
371 3300025981 Ga0207640_10137462 Ga0207640_101374622 85
372 3300025986 Ga0207658_10009247 Ga0207658_100092476 85
373 3300026041 Ga0207639_10190824 Ga0207639_101908243 85
374 3300026067 Ga0207678_10023825 Ga0207678_100238253 85
375 3300026075 Ga0207708_10011810 Ga0207708_100118103 85
376 3300026088 Ga0207641_10004476 Ga0207641_1000447613 85
377 3300026088 Ga0207641_10107442 Ga0207641_101074423 85
378 3300026088 Ga0207641_10345245 Ga0207641_103452452 85
379 3300026095 Ga0207676_10000009 Ga0207676_10000009239 85
380 3300026116 Ga0207674_10015609 Ga0207674_1001560910 85
381 3300026116 Ga0207674_10159794 Ga0207674_101597943 85
382 3300026118 Ga0207675_100000012 Ga0207675_10000001297 85
383 3300026118 Ga0207675_100001338 Ga0207675_10000133811 85
384 3300026118 Ga0207675_100434749 Ga0207675_1004347492 85
385 3300027876 Ga0209974_10359962 Ga0209974_103599622 85
386 3300028379 Ga0268266_11262592 Ga0268266_112625922 85
387 3300028380 Ga0268265_10000001 Ga0268265_10000001170 85
388 3300028380 Ga0268265_10000021 Ga0268265_1000002129 85
389 3300028380 Ga0268265_10009112 Ga0268265_100091126 85
390 3300028380 Ga0268265_10399614 Ga0268265_103996143 85
391 3300028381 Ga0268264_10000820 Ga0268264_1000082028 85
392 3300028381 Ga0268264_10011692 Ga0268264_100116922 85
393 3300031456 Ga0307513_10379964 Ga0307513_103799642 85
394 3300031548 Ga0307408_100003396 Ga0307408_1000033968 85
395 3300031548 Ga0307408_100103881 Ga0307408_1001038814 85
396 3300031548 Ga0307408_100288246 Ga0307408_1002882463 85
397 3300031548 Ga0307408_100944126 Ga0307408_1009441262 85
398 3300031548 Ga0307408_102460041 Ga0307408_1024600412 85
399 3300031731 Ga0307405_10014422 Ga0307405_100144223 85
400 3300031731 Ga0307405_11297191 Ga0307405_112971912 85
401 3300031824 Ga0307413_10727132 Ga0307413_107271322 85
402 3300031901 Ga0307406_10031543 Ga0307406_100315434 85
403 3300031901 Ga0307406_10372115 Ga0307406_103721153 85
404 3300031911 Ga0307412_10000933 Ga0307412_1000093310 85
405 3300031911 Ga0307412_10013627 Ga0307412_100136274 85
406 3300031911 Ga0307412_10081832 Ga0307412_100818323 85
407 3300031911 Ga0307412_10323819 Ga0307412_103238193 85
408 3300031911 Ga0307412_10352527 Ga0307412_103525273 85
409 3300031911 Ga0307412_10418028 Ga0307412_104180282 85
410 3300031911 Ga0307412_11634182 Ga0307412_116341822 85
411 3300032002 Ga0307416_100090872 Ga0307416_1000908721 85
412 3300032002 Ga0307416_100967713 Ga0307416_1009677132 85
413 3300032004 Ga0307414_10008109 Ga0307414_100081096 85
414 3300032004 Ga0307414_10083132 Ga0307414_100831322 85
415 3300032004 Ga0307414_10187265 Ga0307414_101872652 85
416 3300032004 Ga0307414_10643565 Ga0307414_106435652 85
417 3300032005 Ga0307411_11813690 Ga0307411_118136901 85
418 3300035242 Ga0373962_0209787 Ga0373962_0209787_68_325 85
419 3300035695 Ga0373927_0218525 Ga0373927_0218525_197_460 85
420 3300035725 Ga0373947_0595454 Ga0373947_0595454_151_414 85
421 3300037068 Ga0373925_0086519 Ga0373925_0086519_1361_1624 85
422 3300039437 Ga0436365_0932987 Ga0436365_0932987_147_404 85
423 3300044659 Ga0466973_0107406 Ga0466973_0107406_1306_1563 85
424 3300044735 Ga0466968_0144925 Ga0466968_0144925_128_385 85
425 3300046512 Ga0495610_0024981 Ga0495610_0024981_1506_1766 85
426 3300046519 Ga0495632_0056089 Ga0495632_0056089_175_432 85
427 3300046520 Ga0495637_0075120 Ga0495637_0075120_1021_1284 85
428 3300046522 Ga0495643_0020968 Ga0495643_0020968_1343_1600 85
429 3300046522 Ga0495643_0074926 Ga0495643_0074926_240_503 85
430 3300046530 Ga0495654_0072550 Ga0495654_0072550_1332_1589 85
431 3300046538 Ga0495609_0031379 Ga0495609_0031379_1297_1560 85
432 3300046542 Ga0495597_0017289 Ga0495597_0017289_462_725 85
433 3300046558 Ga0495633_0300528 Ga0495633_0300528_239_502 85
434 3300046616 Ga0495668_0000001 Ga0495668_0000001_864406_864663 85
435 3300046616 Ga0495668_0029995 Ga0495668_0029995_497_754 85
436 3300046616 Ga0495668_0077976 Ga0495668_0077976_331_594 85
437 3300046660 Ga0495625_0000652 Ga0495625_0000652_22744_23001 85
438 3300046660 Ga0495625_0048543 Ga0495625_0048543_1355_1618 85
439 3300046684 Ga0495669_0003417 Ga0495669_0003417_454_717 85
440 3300047469 Ga0495673_0035658 Ga0495673_0035658_1362_1619 85
441 3300047472 Ga0495686_0000197 Ga0495686_0000197_32506_32763 85
442 3300047472 Ga0495686_0001481 Ga0495686_0001481_8750_9007 85
443 3300047472 Ga0495686_0005357 Ga0495686_0005357_8112_8369 85
444 3300047472 Ga0495686_0116844 Ga0495686_0116844_283_543 85
445 3300048904 Ga0496101_0433807 Ga0496101_0433807_277_534 85
446 3300048905 Ga0496102_0007370 Ga0496102_0007370_3135_3392 85
447 3300048906 Ga0496103_0023766 Ga0496103_0023766_1248_1505 85
448 3300048908 Ga0496105_0456236 Ga0496105_0456236_665_922 85
449 3300048909 Ga0496106_0020285 Ga0496106_0020285_4339_4596 85
450 3300048910 Ga0496107_0248481 Ga0496107_0248481_988_1245 85
451 3300048912 Ga0496109_0146611 Ga0496109_0146611_151_408 85
452 3300048912 Ga0496109_1370700 Ga0496109_1370700_325_582 85
453 3300048918 Ga0496115_0009879 Ga0496115_0009879_2299_2556 85
454 3300048922 Ga0496119_0072336 Ga0496119_0072336_552_809 85
455 3300048925 Ga0496122_0115288 Ga0496122_0115288_1128_1388 85
456 3300048927 Ga0496124_0552451 Ga0496124_0552451_491_748 85
457 3300048928 Ga0496125_0011116 Ga0496125_0011116_1468_1725 85
458 3300048928 Ga0496125_0380688 Ga0496125_0380688_549_806 85
459 3300048929 Ga0496126_0236607 Ga0496126_0236607_343_600 85
460 3300048929 Ga0496126_0244351 Ga0496126_0244351_504_761 85
461 3300048929 Ga0496126_0248848 Ga0496126_0248848_991_1248 85
462 3300049513 Ga0501290_000181 Ga0501290_000181_7529_7786 85
463 3300049515 Ga0501292_000065 Ga0501292_000065_9270_9527 85
464 3300049570 Ga0501033_0667423 Ga0501033_0667423_291_548 85
465 3300049571 Ga0501034_1363133 Ga0501034_1363133_141_398 85
466 3300049573 Ga0501037_0332876 Ga0501037_0332876_341_613 85
467 3300049574 Ga0501038_1221893 Ga0501038_1221893_50_307 85
468 3300049575 Ga0501039_0396019 Ga0501039_0396019_769_1059 85
469 3300049576 Ga0501040_0205215 Ga0501040_0205215_675_947 85
470 3300049577 Ga0501041_0572605 Ga0501041_0572605_442_699 85
471 3300049577 Ga0501041_0989273 Ga0501041_0989273_238_495 85
472 3300049578 Ga0501042_0178616 Ga0501042_0178616_429_686 85
473 3300049579 Ga0501043_0479669 Ga0501043_0479669_639_896 85
474 3300049580 Ga0501046_0031392 Ga0501046_0031392_475_732 85
475 3300049580 Ga0501046_0107625 Ga0501046_0107625_1250_1522 85
476 3300049581 Ga0501047_0001735 Ga0501047_0001735_4372_4629 85
477 3300049581 Ga0501047_0825806 Ga0501047_0825806_66_323 85
478 3300049583 Ga0501067_0565429 Ga0501067_0565429_348_605 85
479 3300049584 Ga0501068_1121980 Ga0501068_1121980_120_377 85
480 3300049588 Ga0501072_1531089 Ga0501072_1531089_111_368 85
481 3300049590 Ga0501074_0081648 Ga0501074_0081648_1515_1772 85
482 3300049590 Ga0501074_0598019 Ga0501074_0598019_91_381 85
483 3300049590 Ga0501074_0842326 Ga0501074_0842326_170_427 85
484 3300049591 Ga0501075_0028748 Ga0501075_0028748_2677_2934 85
485 3300049591 Ga0501075_0081653 Ga0501075_0081653_57_329 85
486 3300049591 Ga0501075_0391324 Ga0501075_0391324_41_298 85
487 3300049592 Ga0501076_0160981 Ga0501076_0160981_1088_1360 85
488 3300049592 Ga0501076_0904124 Ga0501076_0904124_454_711 85
489 3300049593 Ga0501077_0017980 Ga0501077_0017980_2424_2681 85
490 3300049593 Ga0501077_0218965 Ga0501077_0218965_550_807 85
491 3300049653 Ga0501206_000553 Ga0501206_000553_4261_4518 85
492 3300049662 Ga0501222_002643 Ga0501222_002643_359_616 85
493 3300049669 Ga0501235_053637 Ga0501235_053637_235_492 85
494 3300049688 Ga0501259_000873 Ga0501259_000873_4293_4550 85
495 3300049690 Ga0501261_000083 Ga0501261_000083_12039_12296 85
496 3300049705 Ga0501225_0002881 Ga0501225_0002881_3097_3354 85
497 3300049708 Ga0501245_000315 Ga0501245_000315_4465_4722 85
498 3300049741 Ga0501079_0013080 Ga0501079_0013080_1357_1629 85
499 3300049741 Ga0501079_0085233 Ga0501079_0085233_2123_2380 85
500 3300049741 Ga0501079_0605917 Ga0501079_0605917_556_813 85
501 3300049741 Ga0501079_1003844 Ga0501079_1003844_180_470 85
502 3300049743 Ga0501081_0033306 Ga0501081_0033306_2652_2909 85
503 3300049743 Ga0501081_0294688 Ga0501081_0294688_313_570 85
504 3300049743 Ga0501081_0402694 Ga0501081_0402694_507_779 85
505 3300049743 Ga0501081_0824323 Ga0501081_0824323_360_617 85
506 3300049775 Ga0501279_000010 Ga0501279_000010_98696_98953 85
507 3300049776 Ga0501280_000132 Ga0501280_000132_9147_9404 85
508 3300049778 Ga0501282_000304 Ga0501282_000304_1265_1522 85
509 3300049823 Ga0501044_0470846 Ga0501044_0470846_700_957 85
510 3300049824 Ga0501045_0213741 Ga0501045_0213741_948_1205 85
511 3300049824 Ga0501045_0264245 Ga0501045_0264245_642_899 85
512 3300050493 nmdc:mga0k408_751319_c1 nmdc:mga0k408_751319_c1_200_457 85
513 3300050507 nmdc:mga05p37_195268_c1 nmdc:mga05p37_195268_c1_30_314 85
514 3300050509 nmdc:mga0qj67_3755_c1 nmdc:mga0qj67_3755_c1_7852_8136 85
515 3300050510 nmdc:mga06r32_26245_c1 nmdc:mga06r32_26245_c1_1786_2070 85
516 3300050510 nmdc:mga06r32_53443_c1 nmdc:mga06r32_53443_c1_2847_3119 85
517 3300053087 Ga0500643_018789 Ga0500643_018789_1162_1419 85
518 3300053091 Ga0500647_0210559 Ga0500647_0210559_425_688 85
519 3300053093 Ga0500651_0042012 Ga0500651_0042012_2600_2863 85
520 3300053093 Ga0500651_0197459 Ga0500651_0197459_28_291 85
521 3300053103 Ga0500555_030865 Ga0500555_030865_106_363 85
522 3300053116 Ga0500592_000112 Ga0500592_000112_16448_16705 85
523 3300053116 Ga0500592_003159 Ga0500592_003159_1943_2200 85
524 3300053116 Ga0500592_005212 Ga0500592_005212_1442_1699 85
525 3300053123 Ga0500614_049042 Ga0500614_049042_217_480 85
526 3300053125 Ga0500618_075755 Ga0500618_075755_307_570 85
527 3300053130 Ga0500642_0000929 Ga0500642_0000929_35_298 85
528 3300053133 Ga0500655_002261 Ga0500655_002261_1062_1325 85
529 3300053134 Ga0500658_0020189 Ga0500658_0020189_1055_1312 85
530 3300053134 Ga0500658_0068383 Ga0500658_0068383_1071_1328 85
531 3300053136 Ga0500559_0402736 Ga0500559_0402736_266_529 85
532 3300053142 Ga0500577_0097501 Ga0500577_0097501_506_769 85
533 3300053148 Ga0500590_025754 Ga0500590_025754_646_909 85
534 3300053151 Ga0500604_0087141 Ga0500604_0087141_609_866 85
535 3300053153 Ga0500616_0083242 Ga0500616_0083242_347_604 85
536 3300053156 Ga0500622_0025432 Ga0500622_0025432_1049_1312 85
537 3300053158 Ga0500627_0006860 Ga0500627_0006860_3032_3289 85
538 3300053158 Ga0500627_0093338 Ga0500627_0093338_627_884 85
539 3300053158 Ga0500627_0482623 Ga0500627_0482623_118_375 85
540 3300053163 Ga0500639_015232 Ga0500639_015232_2090_2353 85
541 3300053724 Ga0500570_000250 Ga0500570_000250_15662_15925 85
542 3300053730 Ga0500645_012570 Ga0500645_012570_2200_2469 85
543 3300053735 Ga0500596_001810 Ga0500596_001810_641_898 85
544 3300054114 Ga0501084_0249586 Ga0501084_0249586_22_279 85
545 3300054114 Ga0501084_1360827 Ga0501084_1360827_107_364 85
546 3300055283 Ga0500661_010604 Ga0500661_010604_1250_1507 85
547 3300060353 Ga0501082_0058228 Ga0501082_0058228_2177_2449 85
548 3300060353 Ga0501082_0199023 Ga0501082_0199023_1077_1334 85
549 3300060353 Ga0501082_0283385 Ga0501082_0283385_560_817 85
550 3300060353 Ga0501082_1151464 Ga0501082_1151464_160_417 85
551 3300060353 Ga0501082_1364792 Ga0501082_1364792_274_531 85
552 3300061734 Ga0530510_0046429 Ga0530510_0046429_584_841 85
553 3300061734 Ga0530510_0123370 Ga0530510_0123370_220_477 85

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

16

96

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8329 2 85
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8217 3 85
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8126 3 85
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8092 1 85
6jc0-assembly1.cif.gz_A structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.7977 2 85
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8457 3 85 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8432 3 82 3.10.20.30
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8344 1 85 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8334 3 82 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8268 3 85 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A531KZU9-F1-model_v4 deleted 0.9814 1 81
AF-A0A531ML93-F1-model_v4 Molybdopterin converting factor subunit 1 0.9784 1 81
AF-A0A529KCI5-F1-model_v4 Molybdopterin converting factor subunit 1 0.9752 1 82
AF-A0A4U6CC69-F1-model_v4 Molybdopterin converting factor subunit 1 0.9703 3 85
AF-A0A1X7P2F6-F1-model_v4 Molybdopterin synthase subunit MoaD 0.9671 3 85

Feature Viewer

pLDDT pTM Quality
94.97 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map