F462919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 335 | 546 | 84 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0396019|Ga0501039_0396019_769_1059 |
| Length | 96 |
| Sequence | VPLGLQENATAMPVKLLYFAWVREKIGRAEEVVDLPANLTTVADLVDWLRQRGPEYEAALSRPGVVRAAVDKRHVQSDTMIAGAREIALFPPVTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 4 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 5 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 6 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 7 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 116 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 196 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 262 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 265 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 288 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 289 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 291 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 292 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 294 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 297 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 298 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 311 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 312 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 313 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 314 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 316 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 317 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 319 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 320 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 323 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 327 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 329 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 330 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 331 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 334 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.73 |
| Metatranscriptomes | 0 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.64 |
| Nodule | 0 |
| Rhizoplane | 3.44 |
| Rhizosphere | 76.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10128976 | 3300001989 | Bacteria | 753 |
| 2 | JGI24749J21850_1000076 | 3300002076 | Bacteria | 17900 |
| 3 | JGI24751J29686_10000195 | 3300002459 | Bacteria | 26688 |
| 4 | JGI25152J39213_1053442 | 3300002773 | Bacteria | 518 |
| 5 | JGI25150J39212_1000498 | 3300002774 | Bacteria | 16317 |
| 6 | JGI25151J46595_10145939 | 3300003187 | Bacteria | 571 |
| 7 | JGI25153J46596_10000002 | 3300003215 | Bacteria | 653569 |
| 8 | JGI25153J46596_10000361 | 3300003215 | Bacteria | 31415 |
| 9 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 10 | Ga0055526_1001039 | 3300003771 | Bacteria | 20291 |
| 11 | Ga0055537_1007000 | 3300003773 | Bacteria | 2780 |
| 12 | Ga0055536_1008019 | 3300003781 | Bacteria | 4618 |
| 13 | Ga0055536_1012711 | 3300003781 | Bacteria | 3098 |
| 14 | Ga0055536_1013025 | 3300003781 | Bacteria | 3033 |
| 15 | Ga0055536_1016996 | 3300003781 | Bacteria | 2402 |
| 16 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 17 | Ga0055530_10012977 | 3300003791 | Bacteria | 2872 |
| 18 | Ga0055530_10028706 | 3300003791 | Bacteria | 1498 |
| 19 | Ga0055530_10059230 | 3300003791 | Bacteria | 859 |
| 20 | Ga0055540_1001214 | 3300003792 | Bacteria | 15851 |
| 21 | Ga0055531_10000627 | 3300003794 | Bacteria | 30500 |
| 22 | Ga0055531_10006022 | 3300003794 | Bacteria | 6957 |
| 23 | Ga0055531_10018483 | 3300003794 | Bacteria | 2873 |
| 24 | Ga0055531_10018492 | 3300003794 | Bacteria | 2872 |
| 25 | Ga0065165_1009533 | 3300005262 | Bacteria | 4340 |
| 26 | Ga0065165_1057455 | 3300005262 | Bacteria | 1078 |
| 27 | Ga0065707_10087462 | 3300005295 | Bacteria | 5014 |
| 28 | Ga0070690_100345633 | 3300005330 | Bacteria | 1078 |
| 29 | Ga0070670_100000033 | 3300005331 | Bacteria | 158509 |
| 30 | Ga0068869_100535616 | 3300005334 | Bacteria | 982 |
| 31 | Ga0070666_10034718 | 3300005335 | Bacteria | 3342 |
| 32 | Ga0070680_100001191 | 3300005336 | Bacteria | 18734 |
| 33 | Ga0070660_100826399 | 3300005339 | Bacteria | 780 |
| 34 | Ga0070689_100485531 | 3300005340 | Bacteria | 1056 |
| 35 | Ga0070691_10001146 | 3300005341 | Bacteria | 11033 |
| 36 | Ga0070687_100273271 | 3300005343 | Bacteria | 1060 |
| 37 | Ga0070661_100146165 | 3300005344 | Bacteria | 1785 |
| 38 | Ga0070668_100072912 | 3300005347 | Bacteria | 2676 |
| 39 | Ga0070668_100633807 | 3300005347 | Bacteria | 938 |
| 40 | Ga0070668_102088262 | 3300005347 | Bacteria | 523 |
| 41 | Ga0070669_100000005 | 3300005353 | Bacteria | 309134 |
| 42 | Ga0070669_101251793 | 3300005353 | Bacteria | 642 |
| 43 | Ga0070675_100378139 | 3300005354 | Bacteria | 1260 |
| 44 | Ga0070671_100212684 | 3300005355 | Bacteria | 1640 |
| 45 | Ga0070674_100179362 | 3300005356 | Bacteria | 1621 |
| 46 | Ga0070667_100005221 | 3300005367 | Bacteria | 10854 |
| 47 | Ga0070667_100632902 | 3300005367 | Bacteria | 987 |
| 48 | Ga0070703_10010769 | 3300005406 | Bacteria | 2579 |
| 49 | Ga0070709_11087665 | 3300005434 | Bacteria | 639 |
| 50 | Ga0070714_100220252 | 3300005435 | Bacteria | 1744 |
| 51 | Ga0070714_100924806 | 3300005435 | Unclassified | 847 |
| 52 | Ga0070713_100000137 | 3300005436 | Bacteria | 48167 |
| 53 | Ga0070710_10509418 | 3300005437 | Bacteria | 825 |
| 54 | Ga0070701_10052747 | 3300005438 | Bacteria | 2114 |
| 55 | Ga0070711_100184496 | 3300005439 | Bacteria | 1599 |
| 56 | Ga0070705_100000042 | 3300005440 | Bacteria | 64569 |
| 57 | Ga0070705_100202078 | 3300005440 | Bacteria | 1363 |
| 58 | Ga0070700_100009319 | 3300005441 | Bacteria | 5381 |
| 59 | Ga0070694_100000934 | 3300005444 | Bacteria | 16504 |
| 60 | Ga0070708_100438445 | 3300005445 | Bacteria | 1232 |
| 61 | Ga0070663_100005131 | 3300005455 | Bacteria | 7754 |
| 62 | Ga0070663_100990798 | 3300005455 | Bacteria | 730 |
| 63 | Ga0070678_100742932 | 3300005456 | Bacteria | 887 |
| 64 | Ga0070678_101532712 | 3300005456 | Bacteria | 625 |
| 65 | Ga0070662_101723602 | 3300005457 | Bacteria | 541 |
| 66 | Ga0070681_10527303 | 3300005458 | Bacteria | 1094 |
| 67 | Ga0070707_100233325 | 3300005468 | Bacteria | 1791 |
| 68 | Ga0070707_101922456 | 3300005468 | Bacteria | 559 |
| 69 | Ga0070699_100000770 | 3300005518 | Bacteria | 29605 |
| 70 | Ga0070699_100490323 | 3300005518 | Bacteria | 1116 |
| 71 | Ga0070679_100378582 | 3300005530 | Bacteria | 1362 |
| 72 | Ga0070697_100083394 | 3300005536 | Bacteria | 2636 |
| 73 | Ga0068853_100039901 | 3300005539 | Bacteria | 4005 |
| 74 | Ga0068853_100256703 | 3300005539 | Bacteria | 1606 |
| 75 | Ga0070672_101757862 | 3300005543 | Bacteria | 557 |
| 76 | Ga0070686_100063163 | 3300005544 | Bacteria | 2398 |
| 77 | Ga0070695_100003671 | 3300005545 | Bacteria | 8937 |
| 78 | Ga0070695_100083387 | 3300005545 | Bacteria | 2118 |
| 79 | Ga0070696_100000734 | 3300005546 | Bacteria | 20936 |
| 80 | Ga0070693_100074514 | 3300005547 | Bacteria | 2008 |
| 81 | Ga0070693_100325884 | 3300005547 | Bacteria | 1044 |
| 82 | Ga0070704_100000273 | 3300005549 | Bacteria | 22734 |
| 83 | Ga0068855_100090917 | 3300005563 | Bacteria | 3521 |
| 84 | Ga0070664_100176887 | 3300005564 | Bacteria | 1895 |
| 85 | Ga0068857_100004447 | 3300005577 | Bacteria | 11848 |
| 86 | Ga0068857_100004666 | 3300005577 | Bacteria | 11606 |
| 87 | Ga0068857_100184472 | 3300005577 | Bacteria | 1899 |
| 88 | Ga0068854_100176289 | 3300005578 | Bacteria | 1667 |
| 89 | Ga0068856_100064923 | 3300005614 | Bacteria | 3607 |
| 90 | Ga0070702_100346244 | 3300005615 | Bacteria | 1045 |
| 91 | Ga0068852_100070398 | 3300005616 | Bacteria | 3069 |
| 92 | Ga0068852_100873100 | 3300005616 | Bacteria | 916 |
| 93 | Ga0068852_101902397 | 3300005616 | Bacteria | 617 |
| 94 | Ga0068859_100002190 | 3300005617 | Bacteria | 19848 |
| 95 | Ga0068859_100007105 | 3300005617 | Bacteria | 11364 |
| 96 | Ga0068864_100000042 | 3300005618 | Bacteria | 162930 |
| 97 | Ga0068864_100250892 | 3300005618 | Bacteria | 1643 |
| 98 | Ga0068864_101063769 | 3300005618 | Bacteria | 804 |
| 99 | Ga0068861_100000085 | 3300005719 | Bacteria | 44952 |
| 100 | Ga0068861_100002413 | 3300005719 | Bacteria | 12172 |
| 101 | Ga0068861_101092410 | 3300005719 | Bacteria | 766 |
| 102 | Ga0068863_100001219 | 3300005841 | Bacteria | 25689 |
| 103 | Ga0068863_100068601 | 3300005841 | Bacteria | 3354 |
| 104 | Ga0068863_100393185 | 3300005841 | Bacteria | 1355 |
| 105 | Ga0068863_100400638 | 3300005841 | Bacteria | 1342 |
| 106 | Ga0068858_101606114 | 3300005842 | Bacteria | 642 |
| 107 | Ga0068860_100053584 | 3300005843 | Bacteria | 3836 |
| 108 | Ga0068860_100332267 | 3300005843 | Bacteria | 1493 |
| 109 | Ga0068862_100000005 | 3300005844 | Bacteria | 350713 |
| 110 | Ga0068862_100000149 | 3300005844 | Bacteria | 79784 |
| 111 | Ga0068862_100008887 | 3300005844 | Bacteria | 8319 |
| 112 | Ga0068862_100323134 | 3300005844 | Bacteria | 1425 |
| 113 | Ga0081455_10190567 | 3300005937 | Bacteria | 1544 |
| 114 | Ga0081455_10498668 | 3300005937 | Bacteria | 818 |
| 115 | Ga0075364_10572033 | 3300006051 | Bacteria | 772 |
| 116 | Ga0070716_100008484 | 3300006173 | Bacteria | 5098 |
| 117 | Ga0070712_100000239 | 3300006175 | Bacteria | 30829 |
| 118 | Ga0075367_10464646 | 3300006178 | Bacteria | 802 |
| 119 | Ga0075366_10046739 | 3300006195 | Bacteria | 2565 |
| 120 | Ga0075370_10216592 | 3300006353 | Bacteria | 1131 |
| 121 | Ga0068871_100168211 | 3300006358 | Bacteria | 1878 |
| 122 | Ga0068871_102311581 | 3300006358 | Bacteria | 513 |
| 123 | Ga0075430_100059184 | 3300006846 | Bacteria | 3221 |
| 124 | Ga0075431_100025956 | 3300006847 | Bacteria | 6005 |
| 125 | Ga0075431_100347112 | 3300006847 | Bacteria | 1493 |
| 126 | Ga0075434_100026909 | 3300006871 | Bacteria | 5642 |
| 127 | Ga0075429_101470379 | 3300006880 | Bacteria | 593 |
| 128 | Ga0075436_100001310 | 3300006914 | Bacteria | 16921 |
| 129 | Ga0075436_100116938 | 3300006914 | Bacteria | 1864 |
| 130 | Ga0075436_100371023 | 3300006914 | Bacteria | 1034 |
| 131 | Ga0097620_100002190 | 3300006931 | Bacteria | 19848 |
| 132 | Ga0097620_100007105 | 3300006931 | Bacteria | 11364 |
| 133 | Ga0097620_100011274 | 3300006931 | Bacteria | 8995 |
| 134 | Ga0075435_100071476 | 3300007076 | Bacteria | 2834 |
| 135 | Ga0075435_100983209 | 3300007076 | Bacteria | 737 |
| 136 | Ga0105240_10003562 | 3300009093 | Bacteria | 24155 |
| 137 | Ga0105240_11844911 | 3300009093 | Bacteria | 630 |
| 138 | Ga0105245_11295182 | 3300009098 | Bacteria | 778 |
| 139 | Ga0105245_12849658 | 3300009098 | Bacteria | 536 |
| 140 | Ga0105247_10004166 | 3300009101 | Bacteria | 9275 |
| 141 | Ga0114129_10232685 | 3300009147 | Bacteria | 2481 |
| 142 | Ga0105241_10036953 | 3300009174 | Bacteria | 3677 |
| 143 | Ga0105241_11027853 | 3300009174 | Bacteria | 772 |
| 144 | Ga0105241_12547078 | 3300009174 | Bacteria | 513 |
| 145 | Ga0105248_10000171 | 3300009177 | Bacteria | 75565 |
| 146 | Ga0105248_10013399 | 3300009177 | Bacteria | 9025 |
| 147 | Ga0105248_10102363 | 3300009177 | Bacteria | 3228 |
| 148 | Ga0105237_10002989 | 3300009545 | Bacteria | 20424 |
| 149 | Ga0105237_10009554 | 3300009545 | Bacteria | 10384 |
| 150 | Ga0105238_10001025 | 3300009551 | Bacteria | 28423 |
| 151 | Ga0105249_10000056 | 3300009553 | Bacteria | 160443 |
| 152 | Ga0105249_10017548 | 3300009553 | Bacteria | 6355 |
| 153 | Ga0105239_10000061 | 3300010375 | Bacteria | 154661 |
| 154 | Ga0105239_10131618 | 3300010375 | Bacteria | 2783 |
| 155 | Ga0105239_11365865 | 3300010375 | Bacteria | 818 |
| 156 | Ga0105239_12687839 | 3300010375 | Bacteria | 581 |
| 157 | Ga0105246_10036426 | 3300011119 | Bacteria | 3296 |
| 158 | Ga0157373_10002530 | 3300013100 | Bacteria | 13920 |
| 159 | Ga0157373_10191518 | 3300013100 | Bacteria | 1441 |
| 160 | Ga0157370_10016043 | 3300013104 | Bacteria | 7595 |
| 161 | Ga0157369_10044165 | 3300013105 | Bacteria | 4852 |
| 162 | Ga0157369_10094953 | 3300013105 | Bacteria | 3183 |
| 163 | Ga0157369_12437252 | 3300013105 | Bacteria | 530 |
| 164 | Ga0157374_10930230 | 3300013296 | Bacteria | 887 |
| 165 | Ga0163162_12458742 | 3300013306 | Bacteria | 599 |
| 166 | Ga0157372_10109483 | 3300013307 | Bacteria | 3163 |
| 167 | Ga0163163_10013144 | 3300014325 | Bacteria | 7565 |
| 168 | Ga0163163_10248525 | 3300014325 | Bacteria | 1829 |
| 169 | Ga0163163_10324036 | 3300014325 | Bacteria | 1594 |
| 170 | Ga0157380_10006098 | 3300014326 | Bacteria | 8448 |
| 171 | Ga0157379_10046909 | 3300014968 | Bacteria | 3855 |
| 172 | Ga0157379_10165907 | 3300014968 | Bacteria | 1993 |
| 173 | Ga0183363_1008 | 3300015690 | Bacteria | 194027 |
| 174 | Ga0183361_15479 | 3300016635 | Bacteria | 688 |
| 175 | Ga0163161_10328917 | 3300017792 | Bacteria | 1210 |
| 176 | Ga0163161_10390500 | 3300017792 | Bacteria | 1114 |
| 177 | Ga0209147_100453 | 3300025229 | Bacteria | 25782 |
| 178 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 179 | Ga0207425_1000041 | 3300025245 | Bacteria | 210441 |
| 180 | Ga0209129_1001877 | 3300025258 | Bacteria | 11093 |
| 181 | Ga0209565_1000753 | 3300025263 | Bacteria | 19035 |
| 182 | Ga0209676_1000049 | 3300025292 | Bacteria | 403210 |
| 183 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 184 | Ga0209676_1000349 | 3300025292 | Bacteria | 87517 |
| 185 | Ga0209676_1000453 | 3300025292 | Bacteria | 69137 |
| 186 | Ga0209676_1002202 | 3300025292 | Bacteria | 14549 |
| 187 | Ga0209676_1061043 | 3300025292 | Bacteria | 938 |
| 188 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 189 | Ga0209564_1005033 | 3300025295 | Bacteria | 7738 |
| 190 | Ga0209564_1007114 | 3300025295 | Bacteria | 5842 |
| 191 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 192 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 193 | Ga0209758_1038476 | 3300025297 | Bacteria | 1834 |
| 194 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 195 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 196 | Ga0209050_1000822 | 3300025298 | Bacteria | 43254 |
| 197 | Ga0209050_1006139 | 3300025298 | Bacteria | 7239 |
| 198 | Ga0209050_1007307 | 3300025298 | Bacteria | 6235 |
| 199 | Ga0209050_1009678 | 3300025298 | Bacteria | 4889 |
| 200 | Ga0209050_1019380 | 3300025298 | Bacteria | 2585 |
| 201 | Ga0209050_1031520 | 3300025298 | Bacteria | 1651 |
| 202 | Ga0207426_1017332 | 3300025302 | Bacteria | 2563 |
| 203 | Ga0209051_1000232 | 3300025303 | Bacteria | 93680 |
| 204 | Ga0209051_1067540 | 3300025303 | Bacteria | 1093 |
| 205 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 206 | Ga0209257_1000487 | 3300025304 | Bacteria | 71315 |
| 207 | Ga0209257_1002216 | 3300025304 | Bacteria | 20005 |
| 208 | Ga0209257_1002243 | 3300025304 | Bacteria | 19820 |
| 209 | Ga0209257_1002730 | 3300025304 | Bacteria | 16776 |
| 210 | Ga0207653_10004593 | 3300025885 | Bacteria | 4331 |
| 211 | Ga0207692_10071073 | 3300025898 | Bacteria | 1834 |
| 212 | Ga0207710_10075737 | 3300025900 | Bacteria | 1551 |
| 213 | Ga0207710_10330329 | 3300025900 | Bacteria | 774 |
| 214 | Ga0207688_10216775 | 3300025901 | Bacteria | 1152 |
| 215 | Ga0207688_10716662 | 3300025901 | Bacteria | 633 |
| 216 | Ga0207680_10743809 | 3300025903 | Bacteria | 703 |
| 217 | Ga0207647_10587679 | 3300025904 | Bacteria | 615 |
| 218 | Ga0207699_10000510 | 3300025906 | Bacteria | 19285 |
| 219 | Ga0207654_10930931 | 3300025911 | Bacteria | 631 |
| 220 | Ga0207695_10013684 | 3300025913 | Bacteria | 9657 |
| 221 | Ga0207671_10005232 | 3300025914 | Bacteria | 12051 |
| 222 | Ga0207671_10105574 | 3300025914 | Bacteria | 2138 |
| 223 | Ga0207693_10000668 | 3300025915 | Bacteria | 30811 |
| 224 | Ga0207663_10011019 | 3300025916 | Bacteria | 4836 |
| 225 | Ga0207663_10181128 | 3300025916 | Bacteria | 1505 |
| 226 | Ga0207660_10002046 | 3300025917 | Bacteria | 13403 |
| 227 | Ga0207660_11011263 | 3300025917 | Bacteria | 678 |
| 228 | Ga0207662_10533774 | 3300025918 | Bacteria | 811 |
| 229 | Ga0207657_10527226 | 3300025919 | Bacteria | 924 |
| 230 | Ga0207649_10037880 | 3300025920 | Bacteria | 2916 |
| 231 | Ga0207649_11448668 | 3300025920 | Bacteria | 544 |
| 232 | Ga0207652_10245347 | 3300025921 | Bacteria | 1615 |
| 233 | Ga0207646_10241257 | 3300025922 | Bacteria | 1633 |
| 234 | Ga0207646_10437367 | 3300025922 | Bacteria | 1180 |
| 235 | Ga0207681_10000003 | 3300025923 | Bacteria | 713245 |
| 236 | Ga0207694_10195536 | 3300025924 | Bacteria | 1644 |
| 237 | Ga0207694_11406428 | 3300025924 | Bacteria | 589 |
| 238 | Ga0207650_10000012 | 3300025925 | Bacteria | 437889 |
| 239 | Ga0207659_10199817 | 3300025926 | Bacteria | 1596 |
| 240 | Ga0207659_10317806 | 3300025926 | Bacteria | 1284 |
| 241 | Ga0207700_10000005 | 3300025928 | Bacteria | 394836 |
| 242 | Ga0207664_10080204 | 3300025929 | Bacteria | 2652 |
| 243 | Ga0207644_10293912 | 3300025931 | Bacteria | 1307 |
| 244 | Ga0207706_10043912 | 3300025933 | Bacteria | 3961 |
| 245 | Ga0207706_10468972 | 3300025933 | Bacteria | 1088 |
| 246 | Ga0207709_10871201 | 3300025935 | Bacteria | 730 |
| 247 | Ga0207670_10603416 | 3300025936 | Bacteria | 901 |
| 248 | Ga0207669_10411154 | 3300025937 | Bacteria | 1062 |
| 249 | Ga0207665_10138331 | 3300025939 | Bacteria | 1734 |
| 250 | Ga0207711_10001461 | 3300025941 | Bacteria | 22080 |
| 251 | Ga0207711_10011132 | 3300025941 | Bacteria | 7475 |
| 252 | Ga0207711_10370348 | 3300025941 | Bacteria | 1328 |
| 253 | Ga0207689_10306454 | 3300025942 | Bacteria | 1317 |
| 254 | Ga0207679_10661544 | 3300025945 | Bacteria | 945 |
| 255 | Ga0207667_10053892 | 3300025949 | Bacteria | 4231 |
| 256 | Ga0207667_11420978 | 3300025949 | Bacteria | 667 |
| 257 | Ga0207712_10000015 | 3300025961 | Bacteria | 346689 |
| 258 | Ga0207712_10016802 | 3300025961 | Bacteria | 4744 |
| 259 | Ga0207668_10026421 | 3300025972 | Bacteria | 3769 |
| 260 | Ga0207668_10333954 | 3300025972 | Bacteria | 1262 |
| 261 | Ga0207668_11289646 | 3300025972 | Bacteria | 657 |
| 262 | Ga0207640_10017027 | 3300025981 | Bacteria | 4244 |
| 263 | Ga0207640_10137462 | 3300025981 | Bacteria | 1776 |
| 264 | Ga0207640_10491500 | 3300025981 | Bacteria | 1020 |
| 265 | Ga0207658_10009247 | 3300025986 | Bacteria | 6683 |
| 266 | Ga0207703_10959614 | 3300026035 | Bacteria | 820 |
| 267 | Ga0207639_10018727 | 3300026041 | Bacteria | 4924 |
| 268 | Ga0207639_10190824 | 3300026041 | Bacteria | 1750 |
| 269 | Ga0207639_11199156 | 3300026041 | Bacteria | 712 |
| 270 | Ga0207678_10023825 | 3300026067 | Bacteria | 5353 |
| 271 | Ga0207678_10707324 | 3300026067 | Bacteria | 887 |
| 272 | Ga0207708_10011810 | 3300026075 | Bacteria | 6504 |
| 273 | Ga0207702_10000055 | 3300026078 | Bacteria | 136325 |
| 274 | Ga0207702_10000102 | 3300026078 | Bacteria | 99313 |
| 275 | Ga0207702_10002975 | 3300026078 | Bacteria | 15769 |
| 276 | Ga0207641_10004476 | 3300026088 | Bacteria | 12094 |
| 277 | Ga0207641_10107442 | 3300026088 | Bacteria | 2468 |
| 278 | Ga0207641_10160768 | 3300026088 | Bacteria | 2042 |
| 279 | Ga0207641_10345245 | 3300026088 | Bacteria | 1417 |
| 280 | Ga0207676_10000009 | 3300026095 | Bacteria | 545256 |
| 281 | Ga0207674_10000378 | 3300026116 | Bacteria | 57957 |
| 282 | Ga0207674_10015609 | 3300026116 | Bacteria | 8337 |
| 283 | Ga0207674_10159794 | 3300026116 | Bacteria | 2208 |
| 284 | Ga0207675_100000012 | 3300026118 | Bacteria | 140594 |
| 285 | Ga0207675_100001338 | 3300026118 | Bacteria | 24709 |
| 286 | Ga0207675_100434749 | 3300026118 | Bacteria | 1298 |
| 287 | Ga0207675_102637589 | 3300026118 | Bacteria | 512 |
| 288 | Ga0207683_11601963 | 3300026121 | Bacteria | 600 |
| 289 | Ga0207698_10145093 | 3300026142 | Bacteria | 2051 |
| 290 | Ga0209974_10359962 | 3300027876 | Bacteria | 566 |
| 291 | Ga0268266_11262592 | 3300028379 | Bacteria | 714 |
| 292 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 293 | Ga0268265_10000021 | 3300028380 | Bacteria | 272292 |
| 294 | Ga0268265_10009112 | 3300028380 | Bacteria | 6710 |
| 295 | Ga0268265_10399614 | 3300028380 | Bacteria | 1270 |
| 296 | Ga0268264_10000820 | 3300028381 | Bacteria | 33465 |
| 297 | Ga0268264_10011692 | 3300028381 | Bacteria | 7239 |
| 298 | Ga0265340_10021945 | 3300031247 | Bacteria | 3269 |
| 299 | Ga0307513_10089017 | 3300031456 | Bacteria | 3153 |
| 300 | Ga0307513_10379964 | 3300031456 | Bacteria | 1152 |
| 301 | Ga0307408_100003396 | 3300031548 | Bacteria | 10921 |
| 302 | Ga0307408_100103881 | 3300031548 | Bacteria | 2170 |
| 303 | Ga0307408_100288246 | 3300031548 | Bacteria | 1370 |
| 304 | Ga0307408_100944126 | 3300031548 | Bacteria | 792 |
| 305 | Ga0307408_102460041 | 3300031548 | Bacteria | 506 |
| 306 | Ga0307405_10014422 | 3300031731 | Bacteria | 4250 |
| 307 | Ga0307405_10873216 | 3300031731 | Bacteria | 759 |
| 308 | Ga0307405_11297191 | 3300031731 | Bacteria | 633 |
| 309 | Ga0307405_11440506 | 3300031731 | Bacteria | 603 |
| 310 | Ga0307413_10727132 | 3300031824 | Bacteria | 827 |
| 311 | Ga0307406_10031543 | 3300031901 | Bacteria | 3228 |
| 312 | Ga0307406_10372115 | 3300031901 | Bacteria | 1124 |
| 313 | Ga0307412_10000933 | 3300031911 | Bacteria | 16724 |
| 314 | Ga0307412_10005222 | 3300031911 | Bacteria | 7281 |
| 315 | Ga0307412_10013627 | 3300031911 | Bacteria | 4774 |
| 316 | Ga0307412_10081832 | 3300031911 | Bacteria | 2234 |
| 317 | Ga0307412_10323819 | 3300031911 | Bacteria | 1227 |
| 318 | Ga0307412_10352527 | 3300031911 | Bacteria | 1182 |
| 319 | Ga0307412_10418028 | 3300031911 | Bacteria | 1096 |
| 320 | Ga0307412_11634182 | 3300031911 | Bacteria | 589 |
| 321 | Ga0307416_100090872 | 3300032002 | Bacteria | 2620 |
| 322 | Ga0307416_100967713 | 3300032002 | Bacteria | 953 |
| 323 | Ga0307414_10008109 | 3300032004 | Bacteria | 5934 |
| 324 | Ga0307414_10083132 | 3300032004 | Bacteria | 2350 |
| 325 | Ga0307414_10187265 | 3300032004 | Bacteria | 1671 |
| 326 | Ga0307414_10643565 | 3300032004 | Bacteria | 955 |
| 327 | Ga0307411_11813690 | 3300032005 | Bacteria | 566 |
| 328 | Ga0307510_10217272 | 3300033180 | Bacteria | 1427 |
| 329 | Ga0373930_0075199 | 3300034816 | Bacteria | 774 |
| 330 | Ga0373948_0151930 | 3300034817 | Bacteria | 579 |
| 331 | Ga0373923_0650819 | 3300035111 | Bacteria | 521 |
| 332 | Ga0373932_0035597 | 3300035112 | Bacteria | 1409 |
| 333 | Ga0373945_0247382 | 3300035116 | Bacteria | 752 |
| 334 | Ga0373962_0209787 | 3300035242 | Bacteria | 662 |
| 335 | Ga0373931_0055059 | 3300035691 | Bacteria | 2127 |
| 336 | Ga0373927_0218525 | 3300035695 | Bacteria | 1252 |
| 337 | Ga0373947_0595454 | 3300035725 | Unclassified | 753 |
| 338 | Ga0373925_0048688 | 3300037068 | Bacteria | 3159 |
| 339 | Ga0373925_0077363 | 3300037068 | Bacteria | 2525 |
| 340 | Ga0373925_0086519 | 3300037068 | Bacteria | 2391 |
| 341 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 342 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 343 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 344 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 345 | Ga0436365_0932987 | 3300039437 | Bacteria | 652 |
| 346 | Ga0439448_0006881 | 3300042005 | Bacteria | 3280 |
| 347 | Ga0439455_0028761 | 3300042012 | Bacteria | 1370 |
| 348 | Ga0466973_0107406 | 3300044659 | Bacteria | 2345 |
| 349 | Ga0466968_0144925 | 3300044735 | Bacteria | 1088 |
| 350 | Ga0495629_0085102 | 3300046459 | Bacteria | 2206 |
| 351 | Ga0495653_0614015 | 3300046463 | Bacteria | 667 |
| 352 | Ga0495580_0002971 | 3300046472 | Bacteria | 14554 |
| 353 | Ga0495580_0551921 | 3300046472 | Bacteria | 765 |
| 354 | Ga0495582_0330399 | 3300046473 | Bacteria | 877 |
| 355 | Ga0495639_0611732 | 3300046475 | Bacteria | 560 |
| 356 | Ga0495584_0258990 | 3300046491 | Bacteria | 884 |
| 357 | Ga0495606_0136231 | 3300046507 | Bacteria | 1454 |
| 358 | Ga0495606_0144270 | 3300046507 | Bacteria | 1403 |
| 359 | Ga0495610_0024981 | 3300046512 | Bacteria | 3217 |
| 360 | Ga0495632_0056089 | 3300046519 | Bacteria | 1927 |
| 361 | Ga0495637_0064823 | 3300046520 | Bacteria | 1489 |
| 362 | Ga0495637_0075120 | 3300046520 | Bacteria | 1356 |
| 363 | Ga0495643_0020968 | 3300046522 | Bacteria | 3758 |
| 364 | Ga0495643_0026149 | 3300046522 | Bacteria | 3296 |
| 365 | Ga0495643_0074926 | 3300046522 | Bacteria | 1771 |
| 366 | Ga0495648_0088305 | 3300046524 | Bacteria | 1743 |
| 367 | Ga0495654_0072550 | 3300046530 | Bacteria | 1629 |
| 368 | Ga0495586_0463582 | 3300046535 | Bacteria | 730 |
| 369 | Ga0495609_0031379 | 3300046538 | Bacteria | 2416 |
| 370 | Ga0495597_0017289 | 3300046542 | Bacteria | 3397 |
| 371 | Ga0495633_0300528 | 3300046558 | Bacteria | 729 |
| 372 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 373 | Ga0495668_0029995 | 3300046616 | Bacteria | 3072 |
| 374 | Ga0495668_0077976 | 3300046616 | Bacteria | 1819 |
| 375 | Ga0495668_0079931 | 3300046616 | Bacteria | 1794 |
| 376 | Ga0495625_0000652 | 3300046660 | Bacteria | 49796 |
| 377 | Ga0495625_0001386 | 3300046660 | Bacteria | 29753 |
| 378 | Ga0495625_0048543 | 3300046660 | Bacteria | 3056 |
| 379 | Ga0495658_0003511 | 3300046683 | Bacteria | 7758 |
| 380 | Ga0495669_0001039 | 3300046684 | Bacteria | 11573 |
| 381 | Ga0495669_0003417 | 3300046684 | Bacteria | 6539 |
| 382 | Ga0495613_0194098 | 3300046689 | Bacteria | 1434 |
| 383 | Ga0495660_0304027 | 3300046810 | Bacteria | 722 |
| 384 | Ga0495581_0193625 | 3300047315 | Bacteria | 1189 |
| 385 | Ga0495636_0081643 | 3300047318 | Bacteria | 1393 |
| 386 | Ga0495674_0159523 | 3300047319 | Bacteria | 1887 |
| 387 | Ga0495687_080891 | 3300047443 | Bacteria | 1273 |
| 388 | Ga0495677_0000990 | 3300047445 | Bacteria | 11436 |
| 389 | Ga0495677_0033336 | 3300047445 | Bacteria | 1877 |
| 390 | Ga0495673_0035658 | 3300047469 | Bacteria | 2289 |
| 391 | Ga0495684_0980359 | 3300047471 | Bacteria | 538 |
| 392 | Ga0495686_0000197 | 3300047472 | Bacteria | 112818 |
| 393 | Ga0495686_0001481 | 3300047472 | Bacteria | 25533 |
| 394 | Ga0495686_0005357 | 3300047472 | Bacteria | 10149 |
| 395 | Ga0495686_0116844 | 3300047472 | Bacteria | 1594 |
| 396 | Ga0496100_1413926 | 3300048903 | Bacteria | 549 |
| 397 | Ga0496101_0433807 | 3300048904 | Bacteria | 1036 |
| 398 | Ga0496101_1542495 | 3300048904 | Bacteria | 517 |
| 399 | Ga0496102_0007370 | 3300048905 | Bacteria | 9400 |
| 400 | Ga0496102_0152255 | 3300048905 | Bacteria | 2174 |
| 401 | Ga0496103_0023766 | 3300048906 | Bacteria | 3695 |
| 402 | Ga0496103_0316949 | 3300048906 | Bacteria | 1003 |
| 403 | Ga0496105_0456236 | 3300048908 | Bacteria | 1008 |
| 404 | Ga0496106_0020285 | 3300048909 | Bacteria | 4931 |
| 405 | Ga0496106_0688392 | 3300048909 | Bacteria | 815 |
| 406 | Ga0496107_0248481 | 3300048910 | Bacteria | 1323 |
| 407 | Ga0496107_0708557 | 3300048910 | Bacteria | 740 |
| 408 | Ga0496108_1022799 | 3300048911 | Bacteria | 705 |
| 409 | Ga0496109_0146611 | 3300048912 | Bacteria | 2208 |
| 410 | Ga0496109_1020220 | 3300048912 | Bacteria | 765 |
| 411 | Ga0496109_1370700 | 3300048912 | Bacteria | 643 |
| 412 | Ga0496114_1240890 | 3300048917 | Bacteria | 632 |
| 413 | Ga0496115_0003662 | 3300048918 | Bacteria | 11055 |
| 414 | Ga0496115_0009879 | 3300048918 | Bacteria | 7105 |
| 415 | Ga0496117_0164243 | 3300048920 | Bacteria | 1297 |
| 416 | Ga0496118_0339920 | 3300048921 | Bacteria | 805 |
| 417 | Ga0496119_0072336 | 3300048922 | Bacteria | 2015 |
| 418 | Ga0496121_0000584 | 3300048924 | Bacteria | 68507 |
| 419 | Ga0496122_0115288 | 3300048925 | Bacteria | 1751 |
| 420 | Ga0496124_0552451 | 3300048927 | Bacteria | 760 |
| 421 | Ga0496125_0011116 | 3300048928 | Bacteria | 9030 |
| 422 | Ga0496125_0380688 | 3300048928 | Bacteria | 832 |
| 423 | Ga0496126_0170820 | 3300048929 | Bacteria | 1852 |
| 424 | Ga0496126_0236607 | 3300048929 | Bacteria | 1528 |
| 425 | Ga0496126_0244351 | 3300048929 | Bacteria | 1498 |
| 426 | Ga0496126_0248848 | 3300048929 | Bacteria | 1482 |
| 427 | Ga0501290_000181 | 3300049513 | Bacteria | 10137 |
| 428 | Ga0501292_000065 | 3300049515 | Bacteria | 21691 |
| 429 | Ga0501031_0332692 | 3300049568 | Bacteria | 983 |
| 430 | Ga0501032_0059401 | 3300049569 | Bacteria | 2566 |
| 431 | Ga0501032_0294076 | 3300049569 | Bacteria | 1050 |
| 432 | Ga0501033_0020758 | 3300049570 | Bacteria | 4962 |
| 433 | Ga0501033_0667423 | 3300049570 | Bacteria | 709 |
| 434 | Ga0501034_0224338 | 3300049571 | Bacteria | 1830 |
| 435 | Ga0501034_1363133 | 3300049571 | Bacteria | 585 |
| 436 | Ga0501036_0151015 | 3300049572 | Bacteria | 1959 |
| 437 | Ga0501037_0190420 | 3300049573 | Bacteria | 1452 |
| 438 | Ga0501037_0332876 | 3300049573 | Bacteria | 1050 |
| 439 | Ga0501037_0687675 | 3300049573 | Bacteria | 681 |
| 440 | Ga0501038_0007690 | 3300049574 | Bacteria | 9937 |
| 441 | Ga0501038_1221893 | 3300049574 | Bacteria | 545 |
| 442 | Ga0501039_0071371 | 3300049575 | Bacteria | 2698 |
| 443 | Ga0501039_0396019 | 3300049575 | Bacteria | 1085 |
| 444 | Ga0501040_0205215 | 3300049576 | Bacteria | 1400 |
| 445 | Ga0501041_0572605 | 3300049577 | Bacteria | 720 |
| 446 | Ga0501041_0989273 | 3300049577 | Bacteria | 541 |
| 447 | Ga0501042_0178616 | 3300049578 | Bacteria | 1531 |
| 448 | Ga0501042_0226406 | 3300049578 | Bacteria | 1349 |
| 449 | Ga0501043_0125756 | 3300049579 | Bacteria | 2010 |
| 450 | Ga0501043_0479669 | 3300049579 | Bacteria | 931 |
| 451 | Ga0501046_0031392 | 3300049580 | Bacteria | 4306 |
| 452 | Ga0501046_0084567 | 3300049580 | Bacteria | 2447 |
| 453 | Ga0501046_0107625 | 3300049580 | Bacteria | 2133 |
| 454 | Ga0501047_0001735 | 3300049581 | Bacteria | 21178 |
| 455 | Ga0501047_0174128 | 3300049581 | Bacteria | 2020 |
| 456 | Ga0501047_0825806 | 3300049581 | Bacteria | 741 |
| 457 | Ga0501067_0565429 | 3300049583 | Bacteria | 637 |
| 458 | Ga0501068_1121980 | 3300049584 | Bacteria | 520 |
| 459 | Ga0501072_1531089 | 3300049588 | Bacteria | 514 |
| 460 | Ga0501074_0081648 | 3300049590 | Bacteria | 2319 |
| 461 | Ga0501074_0598019 | 3300049590 | Bacteria | 780 |
| 462 | Ga0501074_0842326 | 3300049590 | Bacteria | 646 |
| 463 | Ga0501075_0028748 | 3300049591 | Bacteria | 4106 |
| 464 | Ga0501075_0081653 | 3300049591 | Bacteria | 2448 |
| 465 | Ga0501075_0391324 | 3300049591 | Bacteria | 1060 |
| 466 | Ga0501076_0160981 | 3300049592 | Bacteria | 1828 |
| 467 | Ga0501076_0904124 | 3300049592 | Bacteria | 728 |
| 468 | Ga0501077_0017980 | 3300049593 | Bacteria | 4468 |
| 469 | Ga0501077_0218965 | 3300049593 | Bacteria | 1210 |
| 470 | Ga0501206_000553 | 3300049653 | Bacteria | 4545 |
| 471 | Ga0501222_002643 | 3300049662 | Bacteria | 2475 |
| 472 | Ga0501235_053637 | 3300049669 | Bacteria | 937 |
| 473 | Ga0501259_000873 | 3300049688 | Bacteria | 4962 |
| 474 | Ga0501261_000083 | 3300049690 | Bacteria | 15292 |
| 475 | Ga0501225_0002881 | 3300049705 | Bacteria | 5282 |
| 476 | Ga0501245_000315 | 3300049708 | Bacteria | 5713 |
| 477 | Ga0501079_0013080 | 3300049741 | Bacteria | 6330 |
| 478 | Ga0501079_0085233 | 3300049741 | Bacteria | 2445 |
| 479 | Ga0501079_0605917 | 3300049741 | Bacteria | 862 |
| 480 | Ga0501079_1003844 | 3300049741 | Bacteria | 657 |
| 481 | Ga0501081_0033306 | 3300049743 | Bacteria | 3500 |
| 482 | Ga0501081_0294688 | 3300049743 | Bacteria | 1190 |
| 483 | Ga0501081_0402694 | 3300049743 | Bacteria | 1013 |
| 484 | Ga0501081_0824323 | 3300049743 | Bacteria | 699 |
| 485 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 486 | Ga0501280_000132 | 3300049776 | Bacteria | 19443 |
| 487 | Ga0501282_000304 | 3300049778 | Bacteria | 5945 |
| 488 | Ga0501035_0010025 | 3300049822 | Bacteria | 8791 |
| 489 | Ga0501035_0202184 | 3300049822 | Bacteria | 1703 |
| 490 | Ga0501044_0005940 | 3300049823 | Bacteria | 13522 |
| 491 | Ga0501044_0470846 | 3300049823 | Bacteria | 1160 |
| 492 | Ga0501044_0684985 | 3300049823 | Bacteria | 912 |
| 493 | Ga0501045_0213741 | 3300049824 | Bacteria | 1436 |
| 494 | Ga0501045_0264245 | 3300049824 | Bacteria | 1281 |
| 495 | nmdc:mga03683_466927_c1 | 3300050489 | Unclassified | 608 |
| 496 | nmdc:mga0k408_751319_c1 | 3300050493 | Bacteria | 570 |
| 497 | nmdc:mga05p37_195268_c1 | 3300050507 | Bacteria | 2454 |
| 498 | nmdc:mga0qj67_3755_c1 | 3300050509 | Bacteria | 10967 |
| 499 | nmdc:mga06r32_26245_c1 | 3300050510 | Bacteria | 5429 |
| 500 | nmdc:mga06r32_53443_c1 | 3300050510 | Bacteria | 3869 |
| 501 | nmdc:mga0n895_18222_c1 | 3300050512 | Bacteria | 6492 |
| 502 | nmdc:mga0n895_192213_c1 | 3300050512 | Bacteria | 2072 |
| 503 | nmdc:mga0rr50_365312_c1 | 3300050513 | Bacteria | 1215 |
| 504 | nmdc:mga0rr50_6201_c1 | 3300050513 | Bacteria | 7245 |
| 505 | nmdc:mga08x19_160_c1 | 3300050514 | Bacteria | 55694 |
| 506 | nmdc:mga08x19_415510_c1 | 3300050514 | Bacteria | 945 |
| 507 | nmdc:mga08x19_79557_c1 | 3300050514 | Bacteria | 2150 |
| 508 | Ga0500635_0326306 | 3300053080 | Bacteria | 607 |
| 509 | Ga0500643_018789 | 3300053087 | Bacteria | 2287 |
| 510 | Ga0500647_0210559 | 3300053091 | Bacteria | 876 |
| 511 | Ga0500651_0042012 | 3300053093 | Bacteria | 2881 |
| 512 | Ga0500651_0197459 | 3300053093 | Bacteria | 1188 |
| 513 | Ga0500555_030865 | 3300053103 | Bacteria | 1520 |
| 514 | Ga0500592_000112 | 3300053116 | Bacteria | 17479 |
| 515 | Ga0500592_003159 | 3300053116 | Bacteria | 2633 |
| 516 | Ga0500592_005212 | 3300053116 | Bacteria | 2065 |
| 517 | Ga0500614_049042 | 3300053123 | Bacteria | 1102 |
| 518 | Ga0500618_075755 | 3300053125 | Bacteria | 754 |
| 519 | Ga0500642_0000929 | 3300053130 | Bacteria | 8497 |
| 520 | Ga0500655_002261 | 3300053133 | Bacteria | 3536 |
| 521 | Ga0500658_0020189 | 3300053134 | Bacteria | 2513 |
| 522 | Ga0500658_0068383 | 3300053134 | Bacteria | 1493 |
| 523 | Ga0500559_0162951 | 3300053136 | Bacteria | 1048 |
| 524 | Ga0500559_0402736 | 3300053136 | Unclassified | 636 |
| 525 | Ga0500577_0097501 | 3300053142 | Bacteria | 1197 |
| 526 | Ga0500590_025754 | 3300053148 | Bacteria | 3054 |
| 527 | Ga0500604_0087141 | 3300053151 | Bacteria | 1016 |
| 528 | Ga0500616_0083242 | 3300053153 | Bacteria | 1603 |
| 529 | Ga0500622_0025432 | 3300053156 | Bacteria | 3127 |
| 530 | Ga0500627_0006860 | 3300053158 | Bacteria | 3915 |
| 531 | Ga0500627_0093338 | 3300053158 | Bacteria | 1347 |
| 532 | Ga0500627_0482623 | 3300053158 | Bacteria | 518 |
| 533 | Ga0500639_015232 | 3300053163 | Bacteria | 4047 |
| 534 | Ga0500570_000250 | 3300053724 | Bacteria | 18136 |
| 535 | Ga0500645_012570 | 3300053730 | Bacteria | 2734 |
| 536 | Ga0500596_001810 | 3300053735 | Bacteria | 4296 |
| 537 | Ga0501084_0249586 | 3300054114 | Bacteria | 1498 |
| 538 | Ga0501084_1360827 | 3300054114 | Bacteria | 595 |
| 539 | Ga0500661_010604 | 3300055283 | Bacteria | 1677 |
| 540 | Ga0501082_0058228 | 3300060353 | Bacteria | 3329 |
| 541 | Ga0501082_0199023 | 3300060353 | Bacteria | 1743 |
| 542 | Ga0501082_0283385 | 3300060353 | Bacteria | 1442 |
| 543 | Ga0501082_1151464 | 3300060353 | Bacteria | 678 |
| 544 | Ga0501082_1364792 | 3300060353 | Bacteria | 619 |
| 545 | Ga0530510_0046429 | 3300061734 | Bacteria | 3138 |
| 546 | Ga0530510_0123370 | 3300061734 | Bacteria | 1903 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025292 | Ga0209676_1061043 | Ga0209676_10610433 | 70 |
| 2 | 3300025304 | Ga0209257_1002730 | Ga0209257_100273014 | 70 |
| 3 | 3300005456 | Ga0070678_101532712 | Ga0070678_1015327122 | 81 |
| 4 | 3300026121 | Ga0207683_11601963 | Ga0207683_116019632 | 81 |
| 5 | 3300031456 | Ga0307513_10089017 | Ga0307513_100890174 | 81 |
| 6 | 3300033180 | Ga0307510_10217272 | Ga0307510_102172722 | 81 |
| 7 | 3300046524 | Ga0495648_0088305 | Ga0495648_0088305_227_472 | 81 |
| 8 | 3300046660 | Ga0495625_0001386 | Ga0495625_0001386_13713_13958 | 81 |
| 9 | 3300047445 | Ga0495677_0000990 | Ga0495677_0000990_3115_3360 | 81 |
| 10 | iso_pu_bacteria | 2643221541 | 2643727850 | 81 |
| 11 | iso_pu_bacteria | 2643221606 | 2644043200 | 81 |
| 12 | iso_pu_bacteria | 2643221671 | 2644395369 | 81 |
| 13 | iso_pu_bacteria | 2852653556 | 2852655012 | 81 |
| 14 | iso_pu_bacteria | 2852680915 | 2852681833 | 81 |
| 15 | 3300002773 | JGI25152J39213_1053442 | JGI25152J39213_10534422 | 83 |
| 16 | 3300002774 | JGI25150J39212_1000498 | JGI25150J39212_10004984 | 83 |
| 17 | 3300003215 | JGI25153J46596_10000361 | JGI25153J46596_100003618 | 83 |
| 18 | 3300003771 | Ga0055526_1001039 | Ga0055526_100103914 | 83 |
| 19 | 3300003773 | Ga0055537_1007000 | Ga0055537_10070005 | 83 |
| 20 | 3300003781 | Ga0055536_1013025 | Ga0055536_10130252 | 83 |
| 21 | 3300003781 | Ga0055536_1016996 | Ga0055536_10169963 | 83 |
| 22 | 3300003791 | Ga0055530_10012977 | Ga0055530_100129775 | 83 |
| 23 | 3300003791 | Ga0055530_10059230 | Ga0055530_100592301 | 83 |
| 24 | 3300003792 | Ga0055540_1001214 | Ga0055540_10012146 | 83 |
| 25 | 3300003794 | Ga0055531_10018483 | Ga0055531_100184835 | 83 |
| 26 | 3300003794 | Ga0055531_10018492 | Ga0055531_100184925 | 83 |
| 27 | 3300005262 | Ga0065165_1057455 | Ga0065165_10574553 | 83 |
| 28 | 3300005335 | Ga0070666_10034718 | Ga0070666_100347182 | 83 |
| 29 | 3300005347 | Ga0070668_100633807 | Ga0070668_1006338072 | 83 |
| 30 | 3300005353 | Ga0070669_101251793 | Ga0070669_1012517931 | 83 |
| 31 | 3300005354 | Ga0070675_100378139 | Ga0070675_1003781392 | 83 |
| 32 | 3300005355 | Ga0070671_100212684 | Ga0070671_1002126843 | 83 |
| 33 | 3300005356 | Ga0070674_100179362 | Ga0070674_1001793622 | 83 |
| 34 | 3300005434 | Ga0070709_11087665 | Ga0070709_110876652 | 83 |
| 35 | 3300005435 | Ga0070714_100220252 | Ga0070714_1002202523 | 83 |
| 36 | 3300005435 | Ga0070714_100924806 | Ga0070714_1009248062 | 83 |
| 37 | 3300005436 | Ga0070713_100000137 | Ga0070713_10000013750 | 83 |
| 38 | 3300005437 | Ga0070710_10509418 | Ga0070710_105094182 | 83 |
| 39 | 3300005439 | Ga0070711_100184496 | Ga0070711_1001844962 | 83 |
| 40 | 3300005440 | Ga0070705_100202078 | Ga0070705_1002020783 | 83 |
| 41 | 3300005455 | Ga0070663_100990798 | Ga0070663_1009907982 | 83 |
| 42 | 3300005458 | Ga0070681_10527303 | Ga0070681_105273032 | 83 |
| 43 | 3300005468 | Ga0070707_101922456 | Ga0070707_1019224562 | 83 |
| 44 | 3300005518 | Ga0070699_100490323 | Ga0070699_1004903232 | 83 |
| 45 | 3300005539 | Ga0068853_100039901 | Ga0068853_1000399013 | 83 |
| 46 | 3300005543 | Ga0070672_101757862 | Ga0070672_1017578622 | 83 |
| 47 | 3300005545 | Ga0070695_100083387 | Ga0070695_1000833872 | 83 |
| 48 | 3300005547 | Ga0070693_100325884 | Ga0070693_1003258843 | 83 |
| 49 | 3300005563 | Ga0068855_100090917 | Ga0068855_1000909174 | 83 |
| 50 | 3300005564 | Ga0070664_100176887 | Ga0070664_1001768873 | 83 |
| 51 | 3300005577 | Ga0068857_100004447 | Ga0068857_1000044479 | 83 |
| 52 | 3300005614 | Ga0068856_100064923 | Ga0068856_1000649234 | 83 |
| 53 | 3300005616 | Ga0068852_100070398 | Ga0068852_1000703982 | 83 |
| 54 | 3300005841 | Ga0068863_100400638 | Ga0068863_1004006382 | 83 |
| 55 | 3300005842 | Ga0068858_101606114 | Ga0068858_1016061142 | 83 |
| 56 | 3300006173 | Ga0070716_100008484 | Ga0070716_1000084846 | 83 |
| 57 | 3300006175 | Ga0070712_100000239 | Ga0070712_10000023934 | 83 |
| 58 | 3300006358 | Ga0068871_100168211 | Ga0068871_1001682113 | 83 |
| 59 | 3300006358 | Ga0068871_102311581 | Ga0068871_1023115811 | 83 |
| 60 | 3300006871 | Ga0075434_100026909 | Ga0075434_1000269092 | 83 |
| 61 | 3300006914 | Ga0075436_100001310 | Ga0075436_10000131017 | 83 |
| 62 | 3300006914 | Ga0075436_100116938 | Ga0075436_1001169382 | 83 |
| 63 | 3300006914 | Ga0075436_100371023 | Ga0075436_1003710232 | 83 |
| 64 | 3300007076 | Ga0075435_100071476 | Ga0075435_1000714763 | 83 |
| 65 | 3300007076 | Ga0075435_100983209 | Ga0075435_1009832092 | 83 |
| 66 | 3300009093 | Ga0105240_10003562 | Ga0105240_1000356224 | 83 |
| 67 | 3300009098 | Ga0105245_11295182 | Ga0105245_112951822 | 83 |
| 68 | 3300009098 | Ga0105245_12849658 | Ga0105245_128496582 | 83 |
| 69 | 3300009174 | Ga0105241_10036953 | Ga0105241_100369533 | 83 |
| 70 | 3300009174 | Ga0105241_11027853 | Ga0105241_110278532 | 83 |
| 71 | 3300009545 | Ga0105237_10009554 | Ga0105237_100095543 | 83 |
| 72 | 3300009551 | Ga0105238_10001025 | Ga0105238_1000102515 | 83 |
| 73 | 3300010375 | Ga0105239_10131618 | Ga0105239_101316183 | 83 |
| 74 | 3300013100 | Ga0157373_10002530 | Ga0157373_1000253016 | 83 |
| 75 | 3300013100 | Ga0157373_10191518 | Ga0157373_101915182 | 83 |
| 76 | 3300013104 | Ga0157370_10016043 | Ga0157370_100160432 | 83 |
| 77 | 3300013105 | Ga0157369_10044165 | Ga0157369_100441653 | 83 |
| 78 | 3300013105 | Ga0157369_12437252 | Ga0157369_124372522 | 83 |
| 79 | 3300013296 | Ga0157374_10930230 | Ga0157374_109302302 | 83 |
| 80 | 3300013307 | Ga0157372_10109483 | Ga0157372_101094833 | 83 |
| 81 | 3300014325 | Ga0163163_10248525 | Ga0163163_102485252 | 83 |
| 82 | 3300014325 | Ga0163163_10324036 | Ga0163163_103240363 | 83 |
| 83 | 3300014968 | Ga0157379_10165907 | Ga0157379_101659074 | 83 |
| 84 | 3300017792 | Ga0163161_10390500 | Ga0163161_103905001 | 83 |
| 85 | 3300025245 | Ga0207425_1000041 | Ga0207425_1000041101 | 83 |
| 86 | 3300025258 | Ga0209129_1001877 | Ga0209129_100187711 | 83 |
| 87 | 3300025263 | Ga0209565_1000753 | Ga0209565_10007538 | 83 |
| 88 | 3300025292 | Ga0209676_1000049 | Ga0209676_1000049328 | 83 |
| 89 | 3300025292 | Ga0209676_1002202 | Ga0209676_100220215 | 83 |
| 90 | 3300025294 | Ga0209025_1000068 | Ga0209025_1000068270 | 83 |
| 91 | 3300025295 | Ga0209564_1005033 | Ga0209564_10050336 | 83 |
| 92 | 3300025295 | Ga0209564_1007114 | Ga0209564_10071143 | 83 |
| 93 | 3300025297 | Ga0209758_1000004 | Ga0209758_1000004169 | 83 |
| 94 | 3300025297 | Ga0209758_1038476 | Ga0209758_10384764 | 83 |
| 95 | 3300025298 | Ga0209050_1000001 | Ga0209050_10000012120 | 83 |
| 96 | 3300025298 | Ga0209050_1006139 | Ga0209050_10061395 | 83 |
| 97 | 3300025298 | Ga0209050_1007307 | Ga0209050_10073074 | 83 |
| 98 | 3300025298 | Ga0209050_1009678 | Ga0209050_10096785 | 83 |
| 99 | 3300025302 | Ga0207426_1017332 | Ga0207426_10173323 | 83 |
| 100 | 3300025303 | Ga0209051_1000232 | Ga0209051_100023253 | 83 |
| 101 | 3300025304 | Ga0209257_1002216 | Ga0209257_10022166 | 83 |
| 102 | 3300025304 | Ga0209257_1002243 | Ga0209257_10022436 | 83 |
| 103 | 3300025898 | Ga0207692_10071073 | Ga0207692_100710732 | 83 |
| 104 | 3300025901 | Ga0207688_10716662 | Ga0207688_107166622 | 83 |
| 105 | 3300025903 | Ga0207680_10743809 | Ga0207680_107438092 | 83 |
| 106 | 3300025906 | Ga0207699_10000510 | Ga0207699_1000051022 | 83 |
| 107 | 3300025911 | Ga0207654_10930931 | Ga0207654_109309312 | 83 |
| 108 | 3300025914 | Ga0207671_10105574 | Ga0207671_101055743 | 83 |
| 109 | 3300025915 | Ga0207693_10000668 | Ga0207693_1000066834 | 83 |
| 110 | 3300025916 | Ga0207663_10011019 | Ga0207663_100110192 | 83 |
| 111 | 3300025916 | Ga0207663_10181128 | Ga0207663_101811282 | 83 |
| 112 | 3300025917 | Ga0207660_11011263 | Ga0207660_110112631 | 83 |
| 113 | 3300025920 | Ga0207649_11448668 | Ga0207649_114486682 | 83 |
| 114 | 3300025922 | Ga0207646_10437367 | Ga0207646_104373672 | 83 |
| 115 | 3300025924 | Ga0207694_10195536 | Ga0207694_101955362 | 83 |
| 116 | 3300025926 | Ga0207659_10317806 | Ga0207659_103178062 | 83 |
| 117 | 3300025928 | Ga0207700_10000005 | Ga0207700_10000005284 | 83 |
| 118 | 3300025929 | Ga0207664_10080204 | Ga0207664_100802043 | 83 |
| 119 | 3300025931 | Ga0207644_10293912 | Ga0207644_102939122 | 83 |
| 120 | 3300025933 | Ga0207706_10043912 | Ga0207706_100439123 | 83 |
| 121 | 3300025937 | Ga0207669_10411154 | Ga0207669_104111542 | 83 |
| 122 | 3300025939 | Ga0207665_10138331 | Ga0207665_101383312 | 83 |
| 123 | 3300025945 | Ga0207679_10661544 | Ga0207679_106615442 | 83 |
| 124 | 3300025949 | Ga0207667_10053892 | Ga0207667_100538923 | 83 |
| 125 | 3300025972 | Ga0207668_10333954 | Ga0207668_103339542 | 83 |
| 126 | 3300025981 | Ga0207640_10491500 | Ga0207640_104915002 | 83 |
| 127 | 3300026035 | Ga0207703_10959614 | Ga0207703_109596142 | 83 |
| 128 | 3300026041 | Ga0207639_10018727 | Ga0207639_100187274 | 83 |
| 129 | 3300026041 | Ga0207639_11199156 | Ga0207639_111991562 | 83 |
| 130 | 3300026067 | Ga0207678_10707324 | Ga0207678_107073242 | 83 |
| 131 | 3300026078 | Ga0207702_10000055 | Ga0207702_10000055149 | 83 |
| 132 | 3300026078 | Ga0207702_10000102 | Ga0207702_1000010243 | 83 |
| 133 | 3300026078 | Ga0207702_10002975 | Ga0207702_100029753 | 83 |
| 134 | 3300026088 | Ga0207641_10160768 | Ga0207641_101607683 | 83 |
| 135 | 3300026116 | Ga0207674_10000378 | Ga0207674_1000037846 | 83 |
| 136 | 3300026118 | Ga0207675_102637589 | Ga0207675_1026375892 | 83 |
| 137 | 3300026142 | Ga0207698_10145093 | Ga0207698_101450932 | 83 |
| 138 | 3300031247 | Ga0265340_10021945 | Ga0265340_100219452 | 83 |
| 139 | 3300031731 | Ga0307405_10873216 | Ga0307405_108732162 | 83 |
| 140 | 3300031731 | Ga0307405_11440506 | Ga0307405_114405061 | 83 |
| 141 | 3300031911 | Ga0307412_10005222 | Ga0307412_100052228 | 83 |
| 142 | 3300034816 | Ga0373930_0075199 | Ga0373930_0075199_202_453 | 83 |
| 143 | 3300034817 | Ga0373948_0151930 | Ga0373948_0151930_94_345 | 83 |
| 144 | 3300035111 | Ga0373923_0650819 | Ga0373923_0650819_73_324 | 83 |
| 145 | 3300035112 | Ga0373932_0035597 | Ga0373932_0035597_1085_1336 | 83 |
| 146 | 3300035116 | Ga0373945_0247382 | Ga0373945_0247382_386_637 | 83 |
| 147 | 3300035691 | Ga0373931_0055059 | Ga0373931_0055059_325_576 | 83 |
| 148 | 3300037068 | Ga0373925_0048688 | Ga0373925_0048688_2547_2798 | 83 |
| 149 | 3300037068 | Ga0373925_0077363 | Ga0373925_0077363_111_362 | 83 |
| 150 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_87310_87561 | 83 |
| 151 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_47466_47717 | 83 |
| 152 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_47450_47701 | 83 |
| 153 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_87310_87561 | 83 |
| 154 | 3300042005 | Ga0439448_0006881 | Ga0439448_0006881_1965_2216 | 83 |
| 155 | 3300042012 | Ga0439455_0028761 | Ga0439455_0028761_1055_1306 | 83 |
| 156 | 3300046459 | Ga0495629_0085102 | Ga0495629_0085102_1179_1430 | 83 |
| 157 | 3300046463 | Ga0495653_0614015 | Ga0495653_0614015_70_321 | 83 |
| 158 | 3300046472 | Ga0495580_0002971 | Ga0495580_0002971_6484_6735 | 83 |
| 159 | 3300046472 | Ga0495580_0551921 | Ga0495580_0551921_66_317 | 83 |
| 160 | 3300046473 | Ga0495582_0330399 | Ga0495582_0330399_331_582 | 83 |
| 161 | 3300046475 | Ga0495639_0611732 | Ga0495639_0611732_233_484 | 83 |
| 162 | 3300046535 | Ga0495586_0463582 | Ga0495586_0463582_34_285 | 83 |
| 163 | 3300046683 | Ga0495658_0003511 | Ga0495658_0003511_5682_5933 | 83 |
| 164 | 3300046689 | Ga0495613_0194098 | Ga0495613_0194098_866_1117 | 83 |
| 165 | 3300046810 | Ga0495660_0304027 | Ga0495660_0304027_158_409 | 83 |
| 166 | 3300047315 | Ga0495581_0193625 | Ga0495581_0193625_328_579 | 83 |
| 167 | 3300047319 | Ga0495674_0159523 | Ga0495674_0159523_1148_1399 | 83 |
| 168 | 3300047443 | Ga0495687_080891 | Ga0495687_080891_278_529 | 83 |
| 169 | 3300047471 | Ga0495684_0980359 | Ga0495684_0980359_60_311 | 83 |
| 170 | 3300048903 | Ga0496100_1413926 | Ga0496100_1413926_205_456 | 83 |
| 171 | 3300048905 | Ga0496102_0152255 | Ga0496102_0152255_715_966 | 83 |
| 172 | 3300048906 | Ga0496103_0316949 | Ga0496103_0316949_662_913 | 83 |
| 173 | 3300048909 | Ga0496106_0688392 | Ga0496106_0688392_384_635 | 83 |
| 174 | 3300048910 | Ga0496107_0708557 | Ga0496107_0708557_395_646 | 83 |
| 175 | 3300048911 | Ga0496108_1022799 | Ga0496108_1022799_295_546 | 83 |
| 176 | 3300048912 | Ga0496109_1020220 | Ga0496109_1020220_452_703 | 83 |
| 177 | 3300048917 | Ga0496114_1240890 | Ga0496114_1240890_273_524 | 83 |
| 178 | 3300048918 | Ga0496115_0003662 | Ga0496115_0003662_4098_4349 | 83 |
| 179 | 3300048920 | Ga0496117_0164243 | Ga0496117_0164243_155_406 | 83 |
| 180 | 3300048921 | Ga0496118_0339920 | Ga0496118_0339920_273_524 | 83 |
| 181 | 3300049568 | Ga0501031_0332692 | Ga0501031_0332692_535_786 | 83 |
| 182 | 3300049569 | Ga0501032_0059401 | Ga0501032_0059401_1611_1862 | 83 |
| 183 | 3300049569 | Ga0501032_0294076 | Ga0501032_0294076_161_412 | 83 |
| 184 | 3300049570 | Ga0501033_0020758 | Ga0501033_0020758_3945_4196 | 83 |
| 185 | 3300049571 | Ga0501034_0224338 | Ga0501034_0224338_416_667 | 83 |
| 186 | 3300049572 | Ga0501036_0151015 | Ga0501036_0151015_804_1055 | 83 |
| 187 | 3300049573 | Ga0501037_0190420 | Ga0501037_0190420_579_830 | 83 |
| 188 | 3300049573 | Ga0501037_0687675 | Ga0501037_0687675_347_598 | 83 |
| 189 | 3300049574 | Ga0501038_0007690 | Ga0501038_0007690_417_668 | 83 |
| 190 | 3300049575 | Ga0501039_0071371 | Ga0501039_0071371_901_1152 | 83 |
| 191 | 3300049578 | Ga0501042_0226406 | Ga0501042_0226406_139_390 | 83 |
| 192 | 3300049579 | Ga0501043_0125756 | Ga0501043_0125756_1102_1353 | 83 |
| 193 | 3300049580 | Ga0501046_0084567 | Ga0501046_0084567_592_843 | 83 |
| 194 | 3300049581 | Ga0501047_0174128 | Ga0501047_0174128_1199_1450 | 83 |
| 195 | 3300049822 | Ga0501035_0010025 | Ga0501035_0010025_972_1223 | 83 |
| 196 | 3300049822 | Ga0501035_0202184 | Ga0501035_0202184_850_1101 | 83 |
| 197 | 3300049823 | Ga0501044_0005940 | Ga0501044_0005940_3930_4181 | 83 |
| 198 | 3300049823 | Ga0501044_0684985 | Ga0501044_0684985_118_369 | 83 |
| 199 | 3300050489 | nmdc:mga03683_466927_c1 | nmdc:mga03683_466927_c1_337_588 | 83 |
| 200 | 3300050512 | nmdc:mga0n895_18222_c1 | nmdc:mga0n895_18222_c1_4942_5193 | 83 |
| 201 | 3300050512 | nmdc:mga0n895_192213_c1 | nmdc:mga0n895_192213_c1_292_543 | 83 |
| 202 | 3300050513 | nmdc:mga0rr50_365312_c1 | nmdc:mga0rr50_365312_c1_876_1127 | 83 |
| 203 | 3300050513 | nmdc:mga0rr50_6201_c1 | nmdc:mga0rr50_6201_c1_1843_2094 | 83 |
| 204 | 3300050514 | nmdc:mga08x19_160_c1 | nmdc:mga08x19_160_c1_14428_14679 | 83 |
| 205 | 3300050514 | nmdc:mga08x19_415510_c1 | nmdc:mga08x19_415510_c1_431_682 | 83 |
| 206 | 3300050514 | nmdc:mga08x19_79557_c1 | nmdc:mga08x19_79557_c1_673_924 | 83 |
| 207 | 3300053136 | Ga0500559_0162951 | Ga0500559_0162951_127_378 | 83 |
| 208 | iso_pu_bacteria | 2582581305 | 2585260719 | 83 |
| 209 | 3300003187 | JGI25151J46595_10145939 | JGI25151J46595_101459391 | 84 |
| 210 | 3300003215 | JGI25153J46596_10000002 | JGI25153J46596_1000000222 | 84 |
| 211 | 3300003759 | Ga0055525_1000104 | Ga0055525_1000104104 | 84 |
| 212 | 3300003781 | Ga0055536_1012711 | Ga0055536_10127114 | 84 |
| 213 | 3300003791 | Ga0055530_10000013 | Ga0055530_10000013115 | 84 |
| 214 | 3300003794 | Ga0055531_10000627 | Ga0055531_1000062714 | 84 |
| 215 | 3300005339 | Ga0070660_100826399 | Ga0070660_1008263991 | 84 |
| 216 | 3300005344 | Ga0070661_100146165 | Ga0070661_1001461653 | 84 |
| 217 | 3300006051 | Ga0075364_10572033 | Ga0075364_105720332 | 84 |
| 218 | 3300006178 | Ga0075367_10464646 | Ga0075367_104646462 | 84 |
| 219 | 3300006195 | Ga0075366_10046739 | Ga0075366_100467392 | 84 |
| 220 | 3300006353 | Ga0075370_10216592 | Ga0075370_102165922 | 84 |
| 221 | 3300009545 | Ga0105237_10002989 | Ga0105237_1000298920 | 84 |
| 222 | 3300010375 | Ga0105239_10000061 | Ga0105239_1000006140 | 84 |
| 223 | 3300025229 | Ga0209147_100453 | Ga0209147_10045320 | 84 |
| 224 | 3300025230 | Ga0209563_100116 | Ga0209563_10011634 | 84 |
| 225 | 3300025292 | Ga0209676_1000221 | Ga0209676_1000221113 | 84 |
| 226 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001821 | 84 |
| 227 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042274 | 84 |
| 228 | 3300025304 | Ga0209257_1000135 | Ga0209257_1000135113 | 84 |
| 229 | 3300025913 | Ga0207695_10013684 | Ga0207695_100136848 | 84 |
| 230 | 3300025914 | Ga0207671_10005232 | Ga0207671_100052326 | 84 |
| 231 | 3300025919 | Ga0207657_10527226 | Ga0207657_105272262 | 84 |
| 232 | 3300025920 | Ga0207649_10037880 | Ga0207649_100378804 | 84 |
| 233 | 3300025949 | Ga0207667_11420978 | Ga0207667_114209782 | 84 |
| 234 | 3300025981 | Ga0207640_10017027 | Ga0207640_100170273 | 84 |
| 235 | 3300046491 | Ga0495584_0258990 | Ga0495584_0258990_345_599 | 84 |
| 236 | 3300046507 | Ga0495606_0136231 | Ga0495606_0136231_847_1101 | 84 |
| 237 | 3300046507 | Ga0495606_0144270 | Ga0495606_0144270_733_987 | 84 |
| 238 | 3300046520 | Ga0495637_0064823 | Ga0495637_0064823_995_1249 | 84 |
| 239 | 3300046522 | Ga0495643_0026149 | Ga0495643_0026149_2995_3249 | 84 |
| 240 | 3300046616 | Ga0495668_0079931 | Ga0495668_0079931_387_641 | 84 |
| 241 | 3300046684 | Ga0495669_0001039 | Ga0495669_0001039_9215_9469 | 84 |
| 242 | 3300047318 | Ga0495636_0081643 | Ga0495636_0081643_462_716 | 84 |
| 243 | 3300047445 | Ga0495677_0033336 | Ga0495677_0033336_1277_1531 | 84 |
| 244 | 3300048904 | Ga0496101_1542495 | Ga0496101_1542495_113_367 | 84 |
| 245 | 3300048924 | Ga0496121_0000584 | Ga0496121_0000584_27754_28008 | 84 |
| 246 | 3300048929 | Ga0496126_0170820 | Ga0496126_0170820_362_616 | 84 |
| 247 | 3300053080 | Ga0500635_0326306 | Ga0500635_0326306_218_472 | 84 |
| 248 | iso_pu_bacteria | 2523231067 | 2523469400 | 84 |
| 249 | 3300001989 | JGI24739J22299_10128976 | JGI24739J22299_101289762 | 85 |
| 250 | 3300002076 | JGI24749J21850_1000076 | JGI24749J21850_100007618 | 85 |
| 251 | 3300002459 | JGI24751J29686_10000195 | JGI24751J29686_1000019517 | 85 |
| 252 | 3300003781 | Ga0055536_1008019 | Ga0055536_10080195 | 85 |
| 253 | 3300003791 | Ga0055530_10028706 | Ga0055530_100287062 | 85 |
| 254 | 3300003794 | Ga0055531_10006022 | Ga0055531_100060223 | 85 |
| 255 | 3300005262 | Ga0065165_1009533 | Ga0065165_10095333 | 85 |
| 256 | 3300005295 | Ga0065707_10087462 | Ga0065707_100874624 | 85 |
| 257 | 3300005330 | Ga0070690_100345633 | Ga0070690_1003456333 | 85 |
| 258 | 3300005331 | Ga0070670_100000033 | Ga0070670_10000003356 | 85 |
| 259 | 3300005334 | Ga0068869_100535616 | Ga0068869_1005356162 | 85 |
| 260 | 3300005336 | Ga0070680_100001191 | Ga0070680_10000119112 | 85 |
| 261 | 3300005340 | Ga0070689_100485531 | Ga0070689_1004855312 | 85 |
| 262 | 3300005341 | Ga0070691_10001146 | Ga0070691_1000114611 | 85 |
| 263 | 3300005343 | Ga0070687_100273271 | Ga0070687_1002732711 | 85 |
| 264 | 3300005347 | Ga0070668_100072912 | Ga0070668_1000729123 | 85 |
| 265 | 3300005347 | Ga0070668_102088262 | Ga0070668_1020882622 | 85 |
| 266 | 3300005353 | Ga0070669_100000005 | Ga0070669_10000000571 | 85 |
| 267 | 3300005367 | Ga0070667_100005221 | Ga0070667_10000522112 | 85 |
| 268 | 3300005367 | Ga0070667_100632902 | Ga0070667_1006329022 | 85 |
| 269 | 3300005406 | Ga0070703_10010769 | Ga0070703_100107693 | 85 |
| 270 | 3300005438 | Ga0070701_10052747 | Ga0070701_100527472 | 85 |
| 271 | 3300005440 | Ga0070705_100000042 | Ga0070705_10000004216 | 85 |
| 272 | 3300005441 | Ga0070700_100009319 | Ga0070700_1000093196 | 85 |
| 273 | 3300005444 | Ga0070694_100000934 | Ga0070694_10000093418 | 85 |
| 274 | 3300005445 | Ga0070708_100438445 | Ga0070708_1004384452 | 85 |
| 275 | 3300005455 | Ga0070663_100005131 | Ga0070663_10000513110 | 85 |
| 276 | 3300005456 | Ga0070678_100742932 | Ga0070678_1007429321 | 85 |
| 277 | 3300005457 | Ga0070662_101723602 | Ga0070662_1017236022 | 85 |
| 278 | 3300005468 | Ga0070707_100233325 | Ga0070707_1002333253 | 85 |
| 279 | 3300005518 | Ga0070699_100000770 | Ga0070699_1000007708 | 85 |
| 280 | 3300005530 | Ga0070679_100378582 | Ga0070679_1003785822 | 85 |
| 281 | 3300005536 | Ga0070697_100083394 | Ga0070697_1000833942 | 85 |
| 282 | 3300005539 | Ga0068853_100256703 | Ga0068853_1002567033 | 85 |
| 283 | 3300005544 | Ga0070686_100063163 | Ga0070686_1000631635 | 85 |
| 284 | 3300005545 | Ga0070695_100003671 | Ga0070695_1000036712 | 85 |
| 285 | 3300005546 | Ga0070696_100000734 | Ga0070696_10000073410 | 85 |
| 286 | 3300005547 | Ga0070693_100074514 | Ga0070693_1000745142 | 85 |
| 287 | 3300005549 | Ga0070704_100000273 | Ga0070704_1000002738 | 85 |
| 288 | 3300005577 | Ga0068857_100004666 | Ga0068857_10000466612 | 85 |
| 289 | 3300005577 | Ga0068857_100184472 | Ga0068857_1001844723 | 85 |
| 290 | 3300005578 | Ga0068854_100176289 | Ga0068854_1001762893 | 85 |
| 291 | 3300005615 | Ga0070702_100346244 | Ga0070702_1003462442 | 85 |
| 292 | 3300005616 | Ga0068852_100873100 | Ga0068852_1008731003 | 85 |
| 293 | 3300005616 | Ga0068852_101902397 | Ga0068852_1019023972 | 85 |
| 294 | 3300005617 | Ga0068859_100002190 | Ga0068859_10000219019 | 85 |
| 295 | 3300005617 | Ga0068859_100007105 | Ga0068859_1000071058 | 85 |
| 296 | 3300005618 | Ga0068864_100000042 | Ga0068864_10000004257 | 85 |
| 297 | 3300005618 | Ga0068864_100250892 | Ga0068864_1002508922 | 85 |
| 298 | 3300005618 | Ga0068864_101063769 | Ga0068864_1010637692 | 85 |
| 299 | 3300005719 | Ga0068861_100000085 | Ga0068861_1000000854 | 85 |
| 300 | 3300005719 | Ga0068861_100002413 | Ga0068861_1000024134 | 85 |
| 301 | 3300005719 | Ga0068861_101092410 | Ga0068861_1010924101 | 85 |
| 302 | 3300005841 | Ga0068863_100001219 | Ga0068863_1000012191 | 85 |
| 303 | 3300005841 | Ga0068863_100068601 | Ga0068863_1000686015 | 85 |
| 304 | 3300005841 | Ga0068863_100393185 | Ga0068863_1003931852 | 85 |
| 305 | 3300005843 | Ga0068860_100053584 | Ga0068860_1000535846 | 85 |
| 306 | 3300005843 | Ga0068860_100332267 | Ga0068860_1003322673 | 85 |
| 307 | 3300005844 | Ga0068862_100000005 | Ga0068862_10000000578 | 85 |
| 308 | 3300005844 | Ga0068862_100000149 | Ga0068862_10000014968 | 85 |
| 309 | 3300005844 | Ga0068862_100008887 | Ga0068862_1000088874 | 85 |
| 310 | 3300005844 | Ga0068862_100323134 | Ga0068862_1003231343 | 85 |
| 311 | 3300005937 | Ga0081455_10190567 | Ga0081455_101905672 | 85 |
| 312 | 3300005937 | Ga0081455_10498668 | Ga0081455_104986682 | 85 |
| 313 | 3300006846 | Ga0075430_100059184 | Ga0075430_1000591843 | 85 |
| 314 | 3300006847 | Ga0075431_100025956 | Ga0075431_1000259566 | 85 |
| 315 | 3300006847 | Ga0075431_100347112 | Ga0075431_1003471122 | 85 |
| 316 | 3300006880 | Ga0075429_101470379 | Ga0075429_1014703792 | 85 |
| 317 | 3300006931 | Ga0097620_100002190 | Ga0097620_1000021905 | 85 |
| 318 | 3300006931 | Ga0097620_100007105 | Ga0097620_10000710510 | 85 |
| 319 | 3300006931 | Ga0097620_100011274 | Ga0097620_10001127411 | 85 |
| 320 | 3300009093 | Ga0105240_11844911 | Ga0105240_118449112 | 85 |
| 321 | 3300009101 | Ga0105247_10004166 | Ga0105247_1000416612 | 85 |
| 322 | 3300009147 | Ga0114129_10232685 | Ga0114129_102326855 | 85 |
| 323 | 3300009174 | Ga0105241_12547078 | Ga0105241_125470782 | 85 |
| 324 | 3300009177 | Ga0105248_10000171 | Ga0105248_1000017117 | 85 |
| 325 | 3300009177 | Ga0105248_10013399 | Ga0105248_100133997 | 85 |
| 326 | 3300009177 | Ga0105248_10102363 | Ga0105248_101023634 | 85 |
| 327 | 3300009553 | Ga0105249_10000056 | Ga0105249_1000005680 | 85 |
| 328 | 3300009553 | Ga0105249_10017548 | Ga0105249_100175483 | 85 |
| 329 | 3300010375 | Ga0105239_11365865 | Ga0105239_113658652 | 85 |
| 330 | 3300010375 | Ga0105239_12687839 | Ga0105239_126878392 | 85 |
| 331 | 3300011119 | Ga0105246_10036426 | Ga0105246_100364263 | 85 |
| 332 | 3300013105 | Ga0157369_10094953 | Ga0157369_100949533 | 85 |
| 333 | 3300013306 | Ga0163162_12458742 | Ga0163162_124587422 | 85 |
| 334 | 3300014325 | Ga0163163_10013144 | Ga0163163_100131445 | 85 |
| 335 | 3300014326 | Ga0157380_10006098 | Ga0157380_1000609811 | 85 |
| 336 | 3300014968 | Ga0157379_10046909 | Ga0157379_100469096 | 85 |
| 337 | 3300015690 | Ga0183363_1008 | Ga0183363_100858 | 85 |
| 338 | 3300016635 | Ga0183361_15479 | Ga0183361_154792 | 85 |
| 339 | 3300017792 | Ga0163161_10328917 | Ga0163161_103289173 | 85 |
| 340 | 3300025292 | Ga0209676_1000349 | Ga0209676_100034982 | 85 |
| 341 | 3300025292 | Ga0209676_1000453 | Ga0209676_100045325 | 85 |
| 342 | 3300025298 | Ga0209050_1000822 | Ga0209050_100082224 | 85 |
| 343 | 3300025298 | Ga0209050_1019380 | Ga0209050_10193803 | 85 |
| 344 | 3300025298 | Ga0209050_1031520 | Ga0209050_10315203 | 85 |
| 345 | 3300025303 | Ga0209051_1067540 | Ga0209051_10675403 | 85 |
| 346 | 3300025304 | Ga0209257_1000487 | Ga0209257_100048713 | 85 |
| 347 | 3300025885 | Ga0207653_10004593 | Ga0207653_100045936 | 85 |
| 348 | 3300025900 | Ga0207710_10075737 | Ga0207710_100757372 | 85 |
| 349 | 3300025900 | Ga0207710_10330329 | Ga0207710_103303291 | 85 |
| 350 | 3300025901 | Ga0207688_10216775 | Ga0207688_102167752 | 85 |
| 351 | 3300025904 | Ga0207647_10587679 | Ga0207647_105876792 | 85 |
| 352 | 3300025917 | Ga0207660_10002046 | Ga0207660_1000204611 | 85 |
| 353 | 3300025918 | Ga0207662_10533774 | Ga0207662_105337742 | 85 |
| 354 | 3300025921 | Ga0207652_10245347 | Ga0207652_102453472 | 85 |
| 355 | 3300025922 | Ga0207646_10241257 | Ga0207646_102412573 | 85 |
| 356 | 3300025923 | Ga0207681_10000003 | Ga0207681_10000003242 | 85 |
| 357 | 3300025924 | Ga0207694_11406428 | Ga0207694_114064282 | 85 |
| 358 | 3300025925 | Ga0207650_10000012 | Ga0207650_10000012250 | 85 |
| 359 | 3300025926 | Ga0207659_10199817 | Ga0207659_101998171 | 85 |
| 360 | 3300025933 | Ga0207706_10468972 | Ga0207706_104689721 | 85 |
| 361 | 3300025935 | Ga0207709_10871201 | Ga0207709_108712012 | 85 |
| 362 | 3300025936 | Ga0207670_10603416 | Ga0207670_106034162 | 85 |
| 363 | 3300025941 | Ga0207711_10001461 | Ga0207711_100014616 | 85 |
| 364 | 3300025941 | Ga0207711_10011132 | Ga0207711_100111326 | 85 |
| 365 | 3300025941 | Ga0207711_10370348 | Ga0207711_103703482 | 85 |
| 366 | 3300025942 | Ga0207689_10306454 | Ga0207689_103064542 | 85 |
| 367 | 3300025961 | Ga0207712_10000015 | Ga0207712_10000015215 | 85 |
| 368 | 3300025961 | Ga0207712_10016802 | Ga0207712_100168024 | 85 |
| 369 | 3300025972 | Ga0207668_10026421 | Ga0207668_100264215 | 85 |
| 370 | 3300025972 | Ga0207668_11289646 | Ga0207668_112896462 | 85 |
| 371 | 3300025981 | Ga0207640_10137462 | Ga0207640_101374622 | 85 |
| 372 | 3300025986 | Ga0207658_10009247 | Ga0207658_100092476 | 85 |
| 373 | 3300026041 | Ga0207639_10190824 | Ga0207639_101908243 | 85 |
| 374 | 3300026067 | Ga0207678_10023825 | Ga0207678_100238253 | 85 |
| 375 | 3300026075 | Ga0207708_10011810 | Ga0207708_100118103 | 85 |
| 376 | 3300026088 | Ga0207641_10004476 | Ga0207641_1000447613 | 85 |
| 377 | 3300026088 | Ga0207641_10107442 | Ga0207641_101074423 | 85 |
| 378 | 3300026088 | Ga0207641_10345245 | Ga0207641_103452452 | 85 |
| 379 | 3300026095 | Ga0207676_10000009 | Ga0207676_10000009239 | 85 |
| 380 | 3300026116 | Ga0207674_10015609 | Ga0207674_1001560910 | 85 |
| 381 | 3300026116 | Ga0207674_10159794 | Ga0207674_101597943 | 85 |
| 382 | 3300026118 | Ga0207675_100000012 | Ga0207675_10000001297 | 85 |
| 383 | 3300026118 | Ga0207675_100001338 | Ga0207675_10000133811 | 85 |
| 384 | 3300026118 | Ga0207675_100434749 | Ga0207675_1004347492 | 85 |
| 385 | 3300027876 | Ga0209974_10359962 | Ga0209974_103599622 | 85 |
| 386 | 3300028379 | Ga0268266_11262592 | Ga0268266_112625922 | 85 |
| 387 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001170 | 85 |
| 388 | 3300028380 | Ga0268265_10000021 | Ga0268265_1000002129 | 85 |
| 389 | 3300028380 | Ga0268265_10009112 | Ga0268265_100091126 | 85 |
| 390 | 3300028380 | Ga0268265_10399614 | Ga0268265_103996143 | 85 |
| 391 | 3300028381 | Ga0268264_10000820 | Ga0268264_1000082028 | 85 |
| 392 | 3300028381 | Ga0268264_10011692 | Ga0268264_100116922 | 85 |
| 393 | 3300031456 | Ga0307513_10379964 | Ga0307513_103799642 | 85 |
| 394 | 3300031548 | Ga0307408_100003396 | Ga0307408_1000033968 | 85 |
| 395 | 3300031548 | Ga0307408_100103881 | Ga0307408_1001038814 | 85 |
| 396 | 3300031548 | Ga0307408_100288246 | Ga0307408_1002882463 | 85 |
| 397 | 3300031548 | Ga0307408_100944126 | Ga0307408_1009441262 | 85 |
| 398 | 3300031548 | Ga0307408_102460041 | Ga0307408_1024600412 | 85 |
| 399 | 3300031731 | Ga0307405_10014422 | Ga0307405_100144223 | 85 |
| 400 | 3300031731 | Ga0307405_11297191 | Ga0307405_112971912 | 85 |
| 401 | 3300031824 | Ga0307413_10727132 | Ga0307413_107271322 | 85 |
| 402 | 3300031901 | Ga0307406_10031543 | Ga0307406_100315434 | 85 |
| 403 | 3300031901 | Ga0307406_10372115 | Ga0307406_103721153 | 85 |
| 404 | 3300031911 | Ga0307412_10000933 | Ga0307412_1000093310 | 85 |
| 405 | 3300031911 | Ga0307412_10013627 | Ga0307412_100136274 | 85 |
| 406 | 3300031911 | Ga0307412_10081832 | Ga0307412_100818323 | 85 |
| 407 | 3300031911 | Ga0307412_10323819 | Ga0307412_103238193 | 85 |
| 408 | 3300031911 | Ga0307412_10352527 | Ga0307412_103525273 | 85 |
| 409 | 3300031911 | Ga0307412_10418028 | Ga0307412_104180282 | 85 |
| 410 | 3300031911 | Ga0307412_11634182 | Ga0307412_116341822 | 85 |
| 411 | 3300032002 | Ga0307416_100090872 | Ga0307416_1000908721 | 85 |
| 412 | 3300032002 | Ga0307416_100967713 | Ga0307416_1009677132 | 85 |
| 413 | 3300032004 | Ga0307414_10008109 | Ga0307414_100081096 | 85 |
| 414 | 3300032004 | Ga0307414_10083132 | Ga0307414_100831322 | 85 |
| 415 | 3300032004 | Ga0307414_10187265 | Ga0307414_101872652 | 85 |
| 416 | 3300032004 | Ga0307414_10643565 | Ga0307414_106435652 | 85 |
| 417 | 3300032005 | Ga0307411_11813690 | Ga0307411_118136901 | 85 |
| 418 | 3300035242 | Ga0373962_0209787 | Ga0373962_0209787_68_325 | 85 |
| 419 | 3300035695 | Ga0373927_0218525 | Ga0373927_0218525_197_460 | 85 |
| 420 | 3300035725 | Ga0373947_0595454 | Ga0373947_0595454_151_414 | 85 |
| 421 | 3300037068 | Ga0373925_0086519 | Ga0373925_0086519_1361_1624 | 85 |
| 422 | 3300039437 | Ga0436365_0932987 | Ga0436365_0932987_147_404 | 85 |
| 423 | 3300044659 | Ga0466973_0107406 | Ga0466973_0107406_1306_1563 | 85 |
| 424 | 3300044735 | Ga0466968_0144925 | Ga0466968_0144925_128_385 | 85 |
| 425 | 3300046512 | Ga0495610_0024981 | Ga0495610_0024981_1506_1766 | 85 |
| 426 | 3300046519 | Ga0495632_0056089 | Ga0495632_0056089_175_432 | 85 |
| 427 | 3300046520 | Ga0495637_0075120 | Ga0495637_0075120_1021_1284 | 85 |
| 428 | 3300046522 | Ga0495643_0020968 | Ga0495643_0020968_1343_1600 | 85 |
| 429 | 3300046522 | Ga0495643_0074926 | Ga0495643_0074926_240_503 | 85 |
| 430 | 3300046530 | Ga0495654_0072550 | Ga0495654_0072550_1332_1589 | 85 |
| 431 | 3300046538 | Ga0495609_0031379 | Ga0495609_0031379_1297_1560 | 85 |
| 432 | 3300046542 | Ga0495597_0017289 | Ga0495597_0017289_462_725 | 85 |
| 433 | 3300046558 | Ga0495633_0300528 | Ga0495633_0300528_239_502 | 85 |
| 434 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_864406_864663 | 85 |
| 435 | 3300046616 | Ga0495668_0029995 | Ga0495668_0029995_497_754 | 85 |
| 436 | 3300046616 | Ga0495668_0077976 | Ga0495668_0077976_331_594 | 85 |
| 437 | 3300046660 | Ga0495625_0000652 | Ga0495625_0000652_22744_23001 | 85 |
| 438 | 3300046660 | Ga0495625_0048543 | Ga0495625_0048543_1355_1618 | 85 |
| 439 | 3300046684 | Ga0495669_0003417 | Ga0495669_0003417_454_717 | 85 |
| 440 | 3300047469 | Ga0495673_0035658 | Ga0495673_0035658_1362_1619 | 85 |
| 441 | 3300047472 | Ga0495686_0000197 | Ga0495686_0000197_32506_32763 | 85 |
| 442 | 3300047472 | Ga0495686_0001481 | Ga0495686_0001481_8750_9007 | 85 |
| 443 | 3300047472 | Ga0495686_0005357 | Ga0495686_0005357_8112_8369 | 85 |
| 444 | 3300047472 | Ga0495686_0116844 | Ga0495686_0116844_283_543 | 85 |
| 445 | 3300048904 | Ga0496101_0433807 | Ga0496101_0433807_277_534 | 85 |
| 446 | 3300048905 | Ga0496102_0007370 | Ga0496102_0007370_3135_3392 | 85 |
| 447 | 3300048906 | Ga0496103_0023766 | Ga0496103_0023766_1248_1505 | 85 |
| 448 | 3300048908 | Ga0496105_0456236 | Ga0496105_0456236_665_922 | 85 |
| 449 | 3300048909 | Ga0496106_0020285 | Ga0496106_0020285_4339_4596 | 85 |
| 450 | 3300048910 | Ga0496107_0248481 | Ga0496107_0248481_988_1245 | 85 |
| 451 | 3300048912 | Ga0496109_0146611 | Ga0496109_0146611_151_408 | 85 |
| 452 | 3300048912 | Ga0496109_1370700 | Ga0496109_1370700_325_582 | 85 |
| 453 | 3300048918 | Ga0496115_0009879 | Ga0496115_0009879_2299_2556 | 85 |
| 454 | 3300048922 | Ga0496119_0072336 | Ga0496119_0072336_552_809 | 85 |
| 455 | 3300048925 | Ga0496122_0115288 | Ga0496122_0115288_1128_1388 | 85 |
| 456 | 3300048927 | Ga0496124_0552451 | Ga0496124_0552451_491_748 | 85 |
| 457 | 3300048928 | Ga0496125_0011116 | Ga0496125_0011116_1468_1725 | 85 |
| 458 | 3300048928 | Ga0496125_0380688 | Ga0496125_0380688_549_806 | 85 |
| 459 | 3300048929 | Ga0496126_0236607 | Ga0496126_0236607_343_600 | 85 |
| 460 | 3300048929 | Ga0496126_0244351 | Ga0496126_0244351_504_761 | 85 |
| 461 | 3300048929 | Ga0496126_0248848 | Ga0496126_0248848_991_1248 | 85 |
| 462 | 3300049513 | Ga0501290_000181 | Ga0501290_000181_7529_7786 | 85 |
| 463 | 3300049515 | Ga0501292_000065 | Ga0501292_000065_9270_9527 | 85 |
| 464 | 3300049570 | Ga0501033_0667423 | Ga0501033_0667423_291_548 | 85 |
| 465 | 3300049571 | Ga0501034_1363133 | Ga0501034_1363133_141_398 | 85 |
| 466 | 3300049573 | Ga0501037_0332876 | Ga0501037_0332876_341_613 | 85 |
| 467 | 3300049574 | Ga0501038_1221893 | Ga0501038_1221893_50_307 | 85 |
| 468 | 3300049575 | Ga0501039_0396019 | Ga0501039_0396019_769_1059 | 85 |
| 469 | 3300049576 | Ga0501040_0205215 | Ga0501040_0205215_675_947 | 85 |
| 470 | 3300049577 | Ga0501041_0572605 | Ga0501041_0572605_442_699 | 85 |
| 471 | 3300049577 | Ga0501041_0989273 | Ga0501041_0989273_238_495 | 85 |
| 472 | 3300049578 | Ga0501042_0178616 | Ga0501042_0178616_429_686 | 85 |
| 473 | 3300049579 | Ga0501043_0479669 | Ga0501043_0479669_639_896 | 85 |
| 474 | 3300049580 | Ga0501046_0031392 | Ga0501046_0031392_475_732 | 85 |
| 475 | 3300049580 | Ga0501046_0107625 | Ga0501046_0107625_1250_1522 | 85 |
| 476 | 3300049581 | Ga0501047_0001735 | Ga0501047_0001735_4372_4629 | 85 |
| 477 | 3300049581 | Ga0501047_0825806 | Ga0501047_0825806_66_323 | 85 |
| 478 | 3300049583 | Ga0501067_0565429 | Ga0501067_0565429_348_605 | 85 |
| 479 | 3300049584 | Ga0501068_1121980 | Ga0501068_1121980_120_377 | 85 |
| 480 | 3300049588 | Ga0501072_1531089 | Ga0501072_1531089_111_368 | 85 |
| 481 | 3300049590 | Ga0501074_0081648 | Ga0501074_0081648_1515_1772 | 85 |
| 482 | 3300049590 | Ga0501074_0598019 | Ga0501074_0598019_91_381 | 85 |
| 483 | 3300049590 | Ga0501074_0842326 | Ga0501074_0842326_170_427 | 85 |
| 484 | 3300049591 | Ga0501075_0028748 | Ga0501075_0028748_2677_2934 | 85 |
| 485 | 3300049591 | Ga0501075_0081653 | Ga0501075_0081653_57_329 | 85 |
| 486 | 3300049591 | Ga0501075_0391324 | Ga0501075_0391324_41_298 | 85 |
| 487 | 3300049592 | Ga0501076_0160981 | Ga0501076_0160981_1088_1360 | 85 |
| 488 | 3300049592 | Ga0501076_0904124 | Ga0501076_0904124_454_711 | 85 |
| 489 | 3300049593 | Ga0501077_0017980 | Ga0501077_0017980_2424_2681 | 85 |
| 490 | 3300049593 | Ga0501077_0218965 | Ga0501077_0218965_550_807 | 85 |
| 491 | 3300049653 | Ga0501206_000553 | Ga0501206_000553_4261_4518 | 85 |
| 492 | 3300049662 | Ga0501222_002643 | Ga0501222_002643_359_616 | 85 |
| 493 | 3300049669 | Ga0501235_053637 | Ga0501235_053637_235_492 | 85 |
| 494 | 3300049688 | Ga0501259_000873 | Ga0501259_000873_4293_4550 | 85 |
| 495 | 3300049690 | Ga0501261_000083 | Ga0501261_000083_12039_12296 | 85 |
| 496 | 3300049705 | Ga0501225_0002881 | Ga0501225_0002881_3097_3354 | 85 |
| 497 | 3300049708 | Ga0501245_000315 | Ga0501245_000315_4465_4722 | 85 |
| 498 | 3300049741 | Ga0501079_0013080 | Ga0501079_0013080_1357_1629 | 85 |
| 499 | 3300049741 | Ga0501079_0085233 | Ga0501079_0085233_2123_2380 | 85 |
| 500 | 3300049741 | Ga0501079_0605917 | Ga0501079_0605917_556_813 | 85 |
| 501 | 3300049741 | Ga0501079_1003844 | Ga0501079_1003844_180_470 | 85 |
| 502 | 3300049743 | Ga0501081_0033306 | Ga0501081_0033306_2652_2909 | 85 |
| 503 | 3300049743 | Ga0501081_0294688 | Ga0501081_0294688_313_570 | 85 |
| 504 | 3300049743 | Ga0501081_0402694 | Ga0501081_0402694_507_779 | 85 |
| 505 | 3300049743 | Ga0501081_0824323 | Ga0501081_0824323_360_617 | 85 |
| 506 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_98696_98953 | 85 |
| 507 | 3300049776 | Ga0501280_000132 | Ga0501280_000132_9147_9404 | 85 |
| 508 | 3300049778 | Ga0501282_000304 | Ga0501282_000304_1265_1522 | 85 |
| 509 | 3300049823 | Ga0501044_0470846 | Ga0501044_0470846_700_957 | 85 |
| 510 | 3300049824 | Ga0501045_0213741 | Ga0501045_0213741_948_1205 | 85 |
| 511 | 3300049824 | Ga0501045_0264245 | Ga0501045_0264245_642_899 | 85 |
| 512 | 3300050493 | nmdc:mga0k408_751319_c1 | nmdc:mga0k408_751319_c1_200_457 | 85 |
| 513 | 3300050507 | nmdc:mga05p37_195268_c1 | nmdc:mga05p37_195268_c1_30_314 | 85 |
| 514 | 3300050509 | nmdc:mga0qj67_3755_c1 | nmdc:mga0qj67_3755_c1_7852_8136 | 85 |
| 515 | 3300050510 | nmdc:mga06r32_26245_c1 | nmdc:mga06r32_26245_c1_1786_2070 | 85 |
| 516 | 3300050510 | nmdc:mga06r32_53443_c1 | nmdc:mga06r32_53443_c1_2847_3119 | 85 |
| 517 | 3300053087 | Ga0500643_018789 | Ga0500643_018789_1162_1419 | 85 |
| 518 | 3300053091 | Ga0500647_0210559 | Ga0500647_0210559_425_688 | 85 |
| 519 | 3300053093 | Ga0500651_0042012 | Ga0500651_0042012_2600_2863 | 85 |
| 520 | 3300053093 | Ga0500651_0197459 | Ga0500651_0197459_28_291 | 85 |
| 521 | 3300053103 | Ga0500555_030865 | Ga0500555_030865_106_363 | 85 |
| 522 | 3300053116 | Ga0500592_000112 | Ga0500592_000112_16448_16705 | 85 |
| 523 | 3300053116 | Ga0500592_003159 | Ga0500592_003159_1943_2200 | 85 |
| 524 | 3300053116 | Ga0500592_005212 | Ga0500592_005212_1442_1699 | 85 |
| 525 | 3300053123 | Ga0500614_049042 | Ga0500614_049042_217_480 | 85 |
| 526 | 3300053125 | Ga0500618_075755 | Ga0500618_075755_307_570 | 85 |
| 527 | 3300053130 | Ga0500642_0000929 | Ga0500642_0000929_35_298 | 85 |
| 528 | 3300053133 | Ga0500655_002261 | Ga0500655_002261_1062_1325 | 85 |
| 529 | 3300053134 | Ga0500658_0020189 | Ga0500658_0020189_1055_1312 | 85 |
| 530 | 3300053134 | Ga0500658_0068383 | Ga0500658_0068383_1071_1328 | 85 |
| 531 | 3300053136 | Ga0500559_0402736 | Ga0500559_0402736_266_529 | 85 |
| 532 | 3300053142 | Ga0500577_0097501 | Ga0500577_0097501_506_769 | 85 |
| 533 | 3300053148 | Ga0500590_025754 | Ga0500590_025754_646_909 | 85 |
| 534 | 3300053151 | Ga0500604_0087141 | Ga0500604_0087141_609_866 | 85 |
| 535 | 3300053153 | Ga0500616_0083242 | Ga0500616_0083242_347_604 | 85 |
| 536 | 3300053156 | Ga0500622_0025432 | Ga0500622_0025432_1049_1312 | 85 |
| 537 | 3300053158 | Ga0500627_0006860 | Ga0500627_0006860_3032_3289 | 85 |
| 538 | 3300053158 | Ga0500627_0093338 | Ga0500627_0093338_627_884 | 85 |
| 539 | 3300053158 | Ga0500627_0482623 | Ga0500627_0482623_118_375 | 85 |
| 540 | 3300053163 | Ga0500639_015232 | Ga0500639_015232_2090_2353 | 85 |
| 541 | 3300053724 | Ga0500570_000250 | Ga0500570_000250_15662_15925 | 85 |
| 542 | 3300053730 | Ga0500645_012570 | Ga0500645_012570_2200_2469 | 85 |
| 543 | 3300053735 | Ga0500596_001810 | Ga0500596_001810_641_898 | 85 |
| 544 | 3300054114 | Ga0501084_0249586 | Ga0501084_0249586_22_279 | 85 |
| 545 | 3300054114 | Ga0501084_1360827 | Ga0501084_1360827_107_364 | 85 |
| 546 | 3300055283 | Ga0500661_010604 | Ga0500661_010604_1250_1507 | 85 |
| 547 | 3300060353 | Ga0501082_0058228 | Ga0501082_0058228_2177_2449 | 85 |
| 548 | 3300060353 | Ga0501082_0199023 | Ga0501082_0199023_1077_1334 | 85 |
| 549 | 3300060353 | Ga0501082_0283385 | Ga0501082_0283385_560_817 | 85 |
| 550 | 3300060353 | Ga0501082_1151464 | Ga0501082_1151464_160_417 | 85 |
| 551 | 3300060353 | Ga0501082_1364792 | Ga0501082_1364792_274_531 | 85 |
| 552 | 3300061734 | Ga0530510_0046429 | Ga0530510_0046429_584_841 | 85 |
| 553 | 3300061734 | Ga0530510_0123370 | Ga0530510_0123370_220_477 | 85 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8329 | 2 | 85 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8217 | 3 | 85 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8126 | 3 | 85 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8092 | 1 | 85 |
| 6jc0-assembly1.cif.gz_A | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.7977 | 2 | 85 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8457 | 3 | 85 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8432 | 3 | 82 | 3.10.20.30 |
| af_A0A0B4J391_26_106_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8344 | 1 | 85 | 3.10.20.30 |
| af_Q6MWY3_4_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8334 | 3 | 82 | 3.10.20.30 |
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8268 | 3 | 85 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A531KZU9-F1-model_v4 | deleted | 0.9814 | 1 | 81 |
|
| AF-A0A531ML93-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9784 | 1 | 81 |
|
| AF-A0A529KCI5-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9752 | 1 | 82 |
|
| AF-A0A4U6CC69-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9703 | 3 | 85 |
|
| AF-A0A1X7P2F6-F1-model_v4 | Molybdopterin synthase subunit MoaD | 0.9671 | 3 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar