F462894

General Info

Members Datasets Scaffolds Average Seq Length
553 281 545 160

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0533095|Ga0466961_0533095_172_669
Length 165
Sequence MTSTTHHETSIVADPDVPLVRIVREFDAPVEKVFRAHTDPDLLVRWLGPRDLTMTIDHFDCRTGGSYRYVHSRDGQDGREEYGFHGSFHEVRPHELIVQTFTFEGFPDGVALEKLVLEDLGDGRTRLTATSLVDSFEGRDAFVASGMETGVVQGYERLDEVLARG

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
4 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
5 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
6 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
7 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
8 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
156 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
157 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
160 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
161 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
162 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
163 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
164 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
165 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
166 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
167 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
176 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
205 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
209 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
215 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
249 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
256 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
257 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
258 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
259 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.19
Metatranscriptomes 0.54
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.98
Nodule 0
Rhizoplane 5.79
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1012115 3300000549 Bacteria 1021
2 Ga0070658_10323692 3300005327 Bacteria 1317
3 Ga0070658_10329785 3300005327 Bacteria 1304
4 Ga0070658_11581360 3300005327 Bacteria 568
5 Ga0070676_10622763 3300005328 Bacteria 780
6 Ga0070683_100575991 3300005329 Bacteria 1077
7 Ga0070690_100431176 3300005330 Bacteria 974
8 Ga0070670_100023142 3300005331 Bacteria 5348
9 Ga0070677_10777013 3300005333 Unclassified 545
10 Ga0070680_100279966 3300005336 Bacteria 1413
11 Ga0070680_100908646 3300005336 Bacteria 760
12 Ga0068868_100803523 3300005338 Bacteria 849
13 Ga0070687_100534054 3300005343 Bacteria 795
14 Ga0070661_100836364 3300005344 Bacteria 757
15 Ga0070668_100489661 3300005347 Bacteria 1063
16 Ga0070668_100569135 3300005347 Bacteria 988
17 Ga0070669_100006056 3300005353 Bacteria 8727
18 Ga0070674_100163248 3300005356 Bacteria 1692
19 Ga0070674_100609856 3300005356 Bacteria 923
20 Ga0070659_100296318 3300005366 Bacteria 1348
21 Ga0070709_10060775 3300005434 Bacteria 2403
22 Ga0070714_100703545 3300005435 Bacteria 975
23 Ga0070701_10016962 3300005438 Bacteria 3397
24 Ga0070705_100615189 3300005440 Bacteria 842
25 Ga0070700_100319136 3300005441 Bacteria 1141
26 Ga0070694_100076508 3300005444 Bacteria 2317
27 Ga0070708_100067657 3300005445 Bacteria 3209
28 Ga0070708_100422178 3300005445 Bacteria 1258
29 Ga0070663_100292206 3300005455 Bacteria 1302
30 Ga0070663_101001344 3300005455 Bacteria 727
31 Ga0070678_100268701 3300005456 Bacteria 1437
32 Ga0070678_100516849 3300005456 Bacteria 1056
33 Ga0070662_100102755 3300005457 Bacteria 2166
34 Ga0070681_10699929 3300005458 Bacteria 929
35 Ga0068867_100192663 3300005459 Bacteria 1627
36 Ga0070706_100040845 3300005467 Bacteria 4282
37 Ga0070706_100109636 3300005467 Bacteria 2569
38 Ga0070706_100301669 3300005467 Bacteria 1494
39 Ga0070706_101514841 3300005467 Bacteria 613
40 Ga0070707_100000368 3300005468 Bacteria 44585
41 Ga0070707_100063112 3300005468 Bacteria 3555
42 Ga0070707_100089106 3300005468 Bacteria 2985
43 Ga0070699_100743244 3300005518 Bacteria 897
44 Ga0070699_101065417 3300005518 Bacteria 742
45 Ga0070684_101265998 3300005535 Bacteria 694
46 Ga0070672_100632378 3300005543 Bacteria 934
47 Ga0070672_101148633 3300005543 Bacteria 691
48 Ga0070696_100281068 3300005546 Bacteria 1269
49 Ga0070693_100072170 3300005547 Bacteria 2036
50 Ga0070665_100435049 3300005548 Bacteria 1321
51 Ga0068857_100050641 3300005577 Bacteria 3684
52 Ga0068854_100498254 3300005578 Bacteria 1025
53 Ga0068854_101286979 3300005578 Bacteria 658
54 Ga0068856_100146167 3300005614 Bacteria 2372
55 Ga0070702_100000708 3300005615 Bacteria 12590
56 Ga0070702_101533048 3300005615 Unclassified 549
57 Ga0068852_101605067 3300005616 Bacteria 673
58 Ga0068866_10027607 3300005718 Bacteria 2695
59 Ga0068861_100008205 3300005719 Bacteria 7184
60 Ga0068861_100617330 3300005719 Bacteria 997
61 Ga0068851_10537288 3300005834 Bacteria 705
62 Ga0068863_100613736 3300005841 Bacteria 1077
63 Ga0068862_100004865 3300005844 Bacteria 11308
64 Ga0081455_10000854 3300005937 Bacteria 39254
65 Ga0081455_10203414 3300005937 Bacteria 1481
66 Ga0075365_10061995 3300006038 Bacteria 2499
67 Ga0075365_10070251 3300006038 Bacteria 2355
68 Ga0075365_10859986 3300006038 Bacteria 640
69 Ga0075363_100053183 3300006048 Bacteria 2163
70 Ga0075363_100862288 3300006048 Bacteria 553
71 Ga0075364_10011126 3300006051 Bacteria 5462
72 Ga0075364_10022489 3300006051 Bacteria 3982
73 Ga0075364_10091485 3300006051 Bacteria 2018
74 Ga0075364_10964164 3300006051 Bacteria 580
75 Ga0075432_10598061 3300006058 Bacteria 504
76 Ga0070715_10107247 3300006163 Bacteria 1312
77 Ga0070716_100602860 3300006173 Bacteria 826
78 Ga0075362_10069206 3300006177 Bacteria 1609
79 Ga0075362_10388193 3300006177 Bacteria 703
80 Ga0068871_100289936 3300006358 Unclassified 1434
81 Ga0075428_100253069 3300006844 Bacteria 1898
82 Ga0075431_101034763 3300006847 Bacteria 787
83 Ga0075429_100335770 3300006880 Bacteria 1323
84 Ga0068865_100611843 3300006881 Bacteria 922
85 Ga0099794_10085908 3300007265 Bacteria 1557
86 Ga0105244_10065079 3300009036 Bacteria 1827
87 Ga0111539_10455140 3300009094 Bacteria 1490
88 Ga0111539_11110929 3300009094 Bacteria 919
89 Ga0105245_10327890 3300009098 Bacteria 1510
90 Ga0105245_10358983 3300009098 Bacteria 1446
91 Ga0105245_10793550 3300009098 Bacteria 985
92 Ga0105245_11286302 3300009098 Bacteria 780
93 Ga0105245_12046747 3300009098 Bacteria 626
94 Ga0114129_10113217 3300009147 Bacteria 3741
95 Ga0105243_10114155 3300009148 Bacteria 2266
96 Ga0105243_10159647 3300009148 Bacteria 1943
97 Ga0105243_10231306 3300009148 Bacteria 1640
98 Ga0105243_11074929 3300009148 Bacteria 811
99 Ga0105242_10038314 3300009176 Bacteria 3854
100 Ga0105248_11306595 3300009177 Bacteria 820
101 Ga0105248_12022493 3300009177 Bacteria 655
102 Ga0105238_10036584 3300009551 Bacteria 4991
103 Ga0105238_10449057 3300009551 Bacteria 1286
104 Ga0105238_10541185 3300009551 Bacteria 1168
105 Ga0105249_10000970 3300009553 Bacteria 25417
106 Ga0105249_10087274 3300009553 Bacteria 2911
107 Ga0105239_10700725 3300010375 Bacteria 1158
108 Ga0157369_10328917 3300013105 Bacteria 1588
109 Ga0157378_10036310 3300013297 Bacteria 4361
110 Ga0157378_10040156 3300013297 Bacteria 4149
111 Ga0163162_10134816 3300013306 Bacteria 2580
112 Ga0163162_11378844 3300013306 Bacteria 802
113 Ga0157375_10020155 3300013308 Bacteria 6086
114 Ga0157375_10557136 3300013308 Bacteria 1307
115 Ga0157375_10813296 3300013308 Bacteria 1083
116 Ga0157375_11467249 3300013308 Bacteria 804
117 Ga0163163_11508589 3300014325 Bacteria 733
118 Ga0157380_10007789 3300014326 Bacteria 7622
119 Ga0157380_10682854 3300014326 Bacteria 1029
120 Ga0157380_11122588 3300014326 Bacteria 826
121 Ga0163161_10129344 3300017792 Bacteria 1903
122 Ga0163161_10207021 3300017792 Bacteria 1514
123 Ga0163161_10257341 3300017792 Bacteria 1362
124 Ga0206356_10679917 3300020070 Bacteria 793
125 Ga0206354_11624847 3300020081 Bacteria 1074
126 Ga0224712_10392076 3300022467 Bacteria 661
127 Ga0207692_10726418 3300025898 Unclassified 646
128 Ga0207699_10060774 3300025906 Bacteria 2271
129 Ga0207643_10008413 3300025908 Bacteria 5536
130 Ga0207684_10014005 3300025910 Bacteria 6928
131 Ga0207684_10160581 3300025910 Bacteria 1935
132 Ga0207652_10561318 3300025921 Bacteria 1025
133 Ga0207646_10002107 3300025922 Bacteria 23851
134 Ga0207646_10075799 3300025922 Bacteria 3005
135 Ga0207646_10343710 3300025922 Bacteria 1348
136 Ga0207646_10655669 3300025922 Bacteria 940
137 Ga0207681_10022282 3300025923 Bacteria 4039
138 Ga0207694_10116696 3300025924 Bacteria 2127
139 Ga0207650_10028167 3300025925 Bacteria 4026
140 Ga0207659_10314976 3300025926 Bacteria 1289
141 Ga0207659_10720487 3300025926 Bacteria 855
142 Ga0207687_10244178 3300025927 Bacteria 1424
143 Ga0207700_10631843 3300025928 Bacteria 954
144 Ga0207644_10109037 3300025931 Bacteria 2091
145 Ga0207690_10663928 3300025932 Bacteria 855
146 Ga0207706_10015247 3300025933 Bacteria 6950
147 Ga0207706_10390083 3300025933 Bacteria 1208
148 Ga0207686_10776853 3300025934 Bacteria 766
149 Ga0207709_10221112 3300025935 Bacteria 1366
150 Ga0207709_10729532 3300025935 Bacteria 795
151 Ga0207709_10978203 3300025935 Bacteria 691
152 Ga0207669_10128973 3300025937 Unclassified 1734
153 Ga0207669_10281642 3300025937 Bacteria 1254
154 Ga0207704_10280968 3300025938 Unclassified 1265
155 Ga0207704_11002497 3300025938 Bacteria 706
156 Ga0207691_10164451 3300025940 Bacteria 1945
157 Ga0207691_10408449 3300025940 Bacteria 1158
158 Ga0207712_10136472 3300025961 Bacteria 1877
159 Ga0207712_10168457 3300025961 Bacteria 1710
160 Ga0207668_10066232 3300025972 Bacteria 2560
161 Ga0207668_10557396 3300025972 Bacteria 993
162 Ga0207640_11794967 3300025981 Bacteria 554
163 Ga0207708_10096404 3300026075 Bacteria 2285
164 Ga0207702_10186458 3300026078 Bacteria 1914
165 Ga0207648_10020719 3300026089 Bacteria 5918
166 Ga0207674_10030941 3300026116 Bacteria 5625
167 Ga0207674_10884356 3300026116 Bacteria 861
168 Ga0207675_100019825 3300026118 Bacteria 6276
169 Ga0207675_100308357 3300026118 Bacteria 1543
170 Ga0207683_10294734 3300026121 Bacteria 1484
171 Ga0207698_10729708 3300026142 Bacteria 988
172 Ga0207698_10922172 3300026142 Bacteria 881
173 Ga0207428_10202655 3300027907 Bacteria 1492
174 Ga0268265_10666527 3300028380 Bacteria 1001
175 Ga0307515_10320082 3300028794 Bacteria 1218
176 Ga0307515_10405510 3300028794 Bacteria 987
177 Ga0307515_10407782 3300028794 Bacteria 983
178 Ga0307513_10001518 3300031456 Bacteria 33342
179 Ga0307408_100172872 3300031548 Bacteria 1726
180 Ga0307408_100274585 3300031548 Bacteria 1401
181 Ga0307408_100337679 3300031548 Bacteria 1274
182 Ga0307408_100583740 3300031548 Bacteria 991
183 Ga0307508_10172561 3300031616 Bacteria 1766
184 Ga0316576_10061380 3300031727 Bacteria 2755
185 Ga0307405_10013580 3300031731 Bacteria 4349
186 Ga0307405_10135323 3300031731 Bacteria 1710
187 Ga0307405_10362087 3300031731 Bacteria 1123
188 Ga0307405_10563245 3300031731 Bacteria 924
189 Ga0307413_10157269 3300031824 Bacteria 1592
190 Ga0307413_10444782 3300031824 Bacteria 1027
191 Ga0307413_10812092 3300031824 Bacteria 787
192 Ga0307410_10058437 3300031852 Bacteria 2629
193 Ga0307410_10076800 3300031852 Bacteria 2332
194 Ga0307410_10145640 3300031852 Bacteria 1757
195 Ga0307410_10178650 3300031852 Bacteria 1605
196 Ga0307410_10354054 3300031852 Bacteria 1174
197 Ga0307410_10427897 3300031852 Bacteria 1075
198 Ga0307410_10445461 3300031852 Bacteria 1055
199 Ga0307410_10767446 3300031852 Bacteria 818
200 Ga0307406_10267398 3300031901 Bacteria 1297
201 Ga0307406_10291989 3300031901 Bacteria 1248
202 Ga0307406_10373819 3300031901 Bacteria 1121
203 Ga0307406_10692560 3300031901 Bacteria 850
204 Ga0307406_10705506 3300031901 Bacteria 843
205 Ga0307406_10732397 3300031901 Bacteria 828
206 Ga0307407_10047195 3300031903 Bacteria 2442
207 Ga0307407_10128678 3300031903 Bacteria 1616
208 Ga0307407_10160237 3300031903 Bacteria 1472
209 Ga0307407_10172648 3300031903 Bacteria 1425
210 Ga0307407_10735020 3300031903 Bacteria 746
211 Ga0307412_10065506 3300031911 Bacteria 2459
212 Ga0307412_10764919 3300031911 Bacteria 835
213 Ga0307412_11240780 3300031911 Bacteria 669
214 Ga0307409_100036827 3300031995 Bacteria 3600
215 Ga0307409_100179591 3300031995 Bacteria 1872
216 Ga0307409_100181839 3300031995 Bacteria 1862
217 Ga0307409_100240214 3300031995 Bacteria 1648
218 Ga0307409_100385173 3300031995 Bacteria 1334
219 Ga0307409_100458516 3300031995 Bacteria 1232
220 Ga0307409_100547380 3300031995 Bacteria 1135
221 Ga0307409_100737882 3300031995 Bacteria 987
222 Ga0307409_100968271 3300031995 Bacteria 867
223 Ga0307409_101177122 3300031995 Bacteria 789
224 Ga0307409_101535960 3300031995 Bacteria 693
225 Ga0307409_101773125 3300031995 Bacteria 646
226 Ga0307416_100003197 3300032002 Bacteria 9599
227 Ga0307416_100092040 3300032002 Bacteria 2607
228 Ga0307416_100100785 3300032002 Bacteria 2513
229 Ga0307416_100123286 3300032002 Bacteria 2315
230 Ga0307416_100140270 3300032002 Bacteria 2195
231 Ga0307416_100178411 3300032002 Bacteria 1988
232 Ga0307416_100253424 3300032002 Bacteria 1715
233 Ga0307416_100308225 3300032002 Bacteria 1578
234 Ga0307416_100479771 3300032002 Bacteria 1303
235 Ga0307416_100497885 3300032002 Bacteria 1282
236 Ga0307416_100701667 3300032002 Bacteria 1101
237 Ga0307416_101016776 3300032002 Bacteria 932
238 Ga0307416_101062947 3300032002 Bacteria 913
239 Ga0307416_101855085 3300032002 Bacteria 706
240 Ga0307414_10060528 3300032004 Bacteria 2678
241 Ga0307414_10333273 3300032004 Bacteria 1296
242 Ga0307414_10434788 3300032004 Bacteria 1147
243 Ga0307414_10473386 3300032004 Bacteria 1103
244 Ga0307414_11158294 3300032004 Bacteria 715
245 Ga0307411_10056805 3300032005 Bacteria 2582
246 Ga0307411_10123563 3300032005 Bacteria 1878
247 Ga0307411_10420902 3300032005 Bacteria 1110
248 Ga0307411_10522803 3300032005 Bacteria 1007
249 Ga0307411_11203638 3300032005 Bacteria 687
250 Ga0307411_11289614 3300032005 Bacteria 665
251 Ga0307415_100005224 3300032126 Bacteria 6866
252 Ga0307415_100265345 3300032126 Bacteria 1403
253 Ga0307415_100395372 3300032126 Bacteria 1178
254 Ga0307415_100445078 3300032126 Bacteria 1118
255 Ga0307415_100560223 3300032126 Bacteria 1010
256 Ga0307415_100660825 3300032126 Bacteria 938
257 Ga0307415_100667254 3300032126 Bacteria 934
258 Ga0307415_100671458 3300032126 Bacteria 931
259 Ga0307415_100867709 3300032126 Bacteria 829
260 Ga0307415_101398833 3300032126 Bacteria 666
261 Ga0373926_0001692 3300035083 Bacteria 6830
262 Ga0373943_0444405 3300035170 Bacteria 753
263 Ga0316574_0014859 3300035398 Bacteria 4508
264 Ga0316574_0208763 3300035398 Bacteria 1253
265 Ga0373935_0000278 3300035692 Bacteria 25233
266 Ga0373947_0000136 3300035725 Bacteria 37955
267 Ga0373947_0732181 3300035725 Bacteria 675
268 Ga0373937_0665064 3300036401 Bacteria 987
269 Ga0395899_0167397 3300037312 Bacteria 1550
270 Ga0395898_0037858 3300037466 Bacteria 4782
271 Ga0436364_1325333 3300037853 Bacteria 1004
272 Ga0395901_0104103 3300038443 Bacteria 2978
273 Ga0395901_0473794 3300038443 Bacteria 1278
274 Ga0436361_0652110 3300039447 Bacteria 2789
275 Ga0436363_1155040 3300039450 Bacteria 1113
276 Ga0436362_0137809 3300039453 Bacteria 1035
277 Ga0439461_0043562 3300041410 Bacteria 976
278 Ga0451787_549090 3300041441 Bacteria 1136
279 Ga0451789_1142045 3300041443 Bacteria 735
280 Ga0451793_0224190 3300041452 Bacteria 724
281 Ga0451793_0962940 3300041452 Bacteria 1970
282 Ga0451795_1166415 3300041456 Bacteria 762
283 Ga0451800_0207950 3300041459 Bacteria 742
284 Ga0451800_1364876 3300041459 Bacteria 853
285 Ga0451837_1040030 3300041494 Bacteria 927
286 Ga0451841_1386162 3300041498 Bacteria 755
287 Ga0451851_0366045 3300041507 Bacteria 993
288 Ga0451843_0459762 3300041509 Bacteria 993
289 Ga0451853_1602591 3300041512 Bacteria 691
290 Ga0439445_0055606 3300042004 Bacteria 1075
291 Ga0439448_0057739 3300042005 Bacteria 1279
292 Ga0439450_022778 3300042008 Bacteria 1355
293 Ga0439452_050179 3300042010 Bacteria 958
294 Ga0439455_0057625 3300042012 Bacteria 1025
295 Ga0439463_015096 3300042016 Bacteria 1909
296 Ga0439463_079215 3300042016 Bacteria 844
297 Ga0450922_004121 3300042124 Bacteria 1336
298 Ga0450923_035399 3300042125 Bacteria 1033
299 Ga0450908_028099 3300042184 Bacteria 980
300 Ga0466969_0004631 3300044656 Bacteria 7327
301 Ga0466969_0112689 3300044656 Bacteria 1272
302 Ga0466965_0317054 3300044683 Bacteria 849
303 Ga0466966_0063019 3300044684 Bacteria 2337
304 Ga0466966_0152840 3300044684 Bacteria 1407
305 Ga0466961_0039817 3300044693 Bacteria 3012
306 Ga0466961_0095403 3300044693 Bacteria 1876
307 Ga0466961_0163385 3300044693 Bacteria 1387
308 Ga0466961_0533095 3300044693 Bacteria 708
309 Ga0466963_0263200 3300044694 Bacteria 1211
310 Ga0466971_0226158 3300044719 Bacteria 888
311 Ga0466957_0256653 3300044842 Bacteria 1164
312 Ga0466960_0077785 3300044901 Bacteria 1665
313 Ga0466960_0117983 3300044901 Bacteria 1387
314 Ga0466960_0142913 3300044901 Bacteria 1272
315 Ga0466960_0210291 3300044901 Bacteria 1066
316 Ga0466960_0283384 3300044901 Bacteria 929
317 Ga0466960_0342548 3300044901 Bacteria 851
318 Ga0466960_0500593 3300044901 Bacteria 712
319 Ga0466959_0075447 3300045049 Bacteria 2436
320 Ga0466959_0090991 3300045049 Bacteria 2191
321 Ga0466958_0076736 3300045836 Bacteria 2052
322 Ga0466958_0080626 3300045836 Bacteria 2002
323 Ga0466958_0126741 3300045836 Bacteria 1601
324 Ga0466967_0004977 3300045976 Bacteria 9095
325 Ga0466967_1205748 3300045976 Bacteria 754
326 Ga0495603_0002275 3300046455 Bacteria 11277
327 Ga0495603_0082633 3300046455 Bacteria 1881
328 Ga0495590_0000112 3300046457 Bacteria 49282
329 Ga0495629_0015161 3300046459 Bacteria 5540
330 Ga0495629_0358022 3300046459 Bacteria 995
331 Ga0495638_0086541 3300046460 Bacteria 1894
332 Ga0495580_0010772 3300046472 Bacteria 7102
333 Ga0495582_0255634 3300046473 Bacteria 1005
334 Ga0495605_0015478 3300046474 Bacteria 4147
335 Ga0495639_0069738 3300046475 Bacteria 1622
336 Ga0495585_0126130 3300046492 Bacteria 1350
337 Ga0495594_0059235 3300046499 Bacteria 2117
338 Ga0495607_0053087 3300046501 Bacteria 2344
339 Ga0495606_0004553 3300046507 Bacteria 13778
340 Ga0495620_0005950 3300046515 Bacteria 6758
341 Ga0495620_0217455 3300046515 Bacteria 732
342 Ga0495630_0160473 3300046517 Bacteria 1712
343 Ga0495631_0148127 3300046518 Bacteria 1007
344 Ga0495631_0222977 3300046518 Bacteria 805
345 Ga0495648_0035820 3300046524 Bacteria 3212
346 Ga0495586_0203512 3300046535 Bacteria 1123
347 Ga0495621_0348645 3300046539 Bacteria 621
348 Ga0495597_0073708 3300046542 Bacteria 1467
349 Ga0495667_0818660 3300046559 Bacteria 574
350 Ga0495668_0039199 3300046616 Bacteria 2645
351 Ga0495625_0011064 3300046660 Bacteria 7394
352 Ga0495588_0058569 3300046674 Bacteria 1991
353 Ga0495613_0011252 3300046689 Bacteria 6648
354 Ga0495670_0057930 3300046691 Bacteria 1945
355 Ga0495671_0228084 3300046692 Bacteria 901
356 Ga0495649_0074825 3300046694 Bacteria 1814
357 Ga0495589_0012642 3300046794 Bacteria 4366
358 Ga0495589_0181471 3300046794 Bacteria 998
359 Ga0495600_0087006 3300046809 Bacteria 2039
360 Ga0495660_0091018 3300046810 Bacteria 1585
361 Ga0495581_0192400 3300047315 Bacteria 1193
362 Ga0495581_0374820 3300047315 Bacteria 830
363 Ga0495604_0747066 3300047317 Bacteria 619
364 Ga0495636_0003098 3300047318 Bacteria 6452
365 Ga0495636_0189082 3300047318 Bacteria 937
366 Ga0495636_0264750 3300047318 Bacteria 798
367 Ga0495672_0052841 3300047320 Bacteria 2384
368 Ga0495680_0394326 3300047322 Bacteria 957
369 Ga0495683_0020245 3300047323 Bacteria 3433
370 Ga0495687_007595 3300047443 Bacteria 6352
371 Ga0495675_0073946 3300047444 Bacteria 2148
372 Ga0495685_003755 3300047447 Bacteria 4863
373 Ga0495685_026502 3300047447 Bacteria 1994
374 Ga0495626_0018072 3300048091 Bacteria 3549
375 Ga0496100_0805052 3300048903 Bacteria 736
376 Ga0496102_0056141 3300048905 Bacteria 3592
377 Ga0496102_1053103 3300048905 Bacteria 733
378 Ga0496103_0012286 3300048906 Bacteria 5082
379 Ga0496104_0864873 3300048907 Unclassified 809
380 Ga0496104_0912106 3300048907 Bacteria 783
381 Ga0496105_0207796 3300048908 Bacteria 1597
382 Ga0496105_0884542 3300048908 Bacteria 674
383 Ga0496107_0556766 3300048910 Bacteria 849
384 Ga0496108_0267270 3300048911 Bacteria 1489
385 Ga0496109_0023286 3300048912 Bacteria 5495
386 Ga0496109_0030226 3300048912 Bacteria 4856
387 Ga0496109_0055416 3300048912 Bacteria 3617
388 Ga0496109_0394343 3300048912 Bacteria 1308
389 Ga0496110_0850095 3300048913 Bacteria 818
390 Ga0496110_1113405 3300048913 Bacteria 698
391 Ga0496111_0375733 3300048914 Bacteria 1051
392 Ga0496111_0547442 3300048914 Bacteria 850
393 Ga0496111_0853267 3300048914 Bacteria 657
394 Ga0496112_0059405 3300048915 Bacteria 3767
395 Ga0496112_0478546 3300048915 Bacteria 1182
396 Ga0496114_0118084 3300048917 Bacteria 2279
397 Ga0496114_0524931 3300048917 Bacteria 1047
398 Ga0496114_1558138 3300048917 Unclassified 549
399 Ga0496115_0619421 3300048918 Bacteria 859
400 Ga0496119_0467158 3300048922 Bacteria 592
401 Ga0501031_0050716 3300049568 Bacteria 2703
402 Ga0501031_0059409 3300049568 Bacteria 2492
403 Ga0501031_0103102 3300049568 Bacteria 1862
404 Ga0501031_0112138 3300049568 Bacteria 1781
405 Ga0501031_0261428 3300049568 Bacteria 1124
406 Ga0501031_0720943 3300049568 Unclassified 640
407 Ga0501033_0200420 3300049570 Bacteria 1426
408 Ga0501033_0208721 3300049570 Bacteria 1393
409 Ga0501034_0226810 3300049571 Bacteria 1819
410 Ga0501036_0055433 3300049572 Bacteria 3358
411 Ga0501036_0086257 3300049572 Bacteria 2654
412 Ga0501036_0141445 3300049572 Bacteria 2030
413 Ga0501036_0150204 3300049572 Bacteria 1965
414 Ga0501036_0239418 3300049572 Bacteria 1522
415 Ga0501038_0026164 3300049574 Bacteria 5198
416 Ga0501038_0096659 3300049574 Bacteria 2465
417 Ga0501038_0378476 3300049574 Bacteria 1098
418 Ga0501039_0022657 3300049575 Bacteria 4820
419 Ga0501039_0051810 3300049575 Bacteria 3175
420 Ga0501040_0000429 3300049576 Bacteria 24927
421 Ga0501040_0081071 3300049576 Bacteria 2248
422 Ga0501040_0170325 3300049576 Bacteria 1542
423 Ga0501040_0633312 3300049576 Bacteria 773
424 Ga0501040_1042007 3300049576 Bacteria 593
425 Ga0501041_0106882 3300049577 Bacteria 1734
426 Ga0501041_0177306 3300049577 Bacteria 1334
427 Ga0501041_0568275 3300049577 Bacteria 723
428 Ga0501041_0570396 3300049577 Bacteria 722
429 Ga0501042_0042064 3300049578 Bacteria 3251
430 Ga0501042_0099354 3300049578 Bacteria 2092
431 Ga0501042_0311360 3300049578 Bacteria 1137
432 Ga0501042_0689780 3300049578 Bacteria 743
433 Ga0501043_0465306 3300049579 Bacteria 948
434 Ga0501046_0057695 3300049580 Bacteria 3045
435 Ga0501046_0165066 3300049580 Bacteria 1664
436 Ga0501046_0389516 3300049580 Bacteria 1008
437 Ga0501048_0040709 3300049582 Bacteria 3328
438 Ga0501048_0271530 3300049582 Bacteria 1205
439 Ga0501048_0301713 3300049582 Bacteria 1139
440 Ga0501048_0431646 3300049582 Bacteria 943
441 Ga0501048_0654832 3300049582 Bacteria 754
442 Ga0501068_0158315 3300049584 Bacteria 1426
443 Ga0501068_0231984 3300049584 Bacteria 1174
444 Ga0501068_0235234 3300049584 Bacteria 1165
445 Ga0501068_0754039 3300049584 Bacteria 637
446 Ga0501069_0366341 3300049585 Bacteria 850
447 Ga0501070_0615180 3300049586 Bacteria 865
448 Ga0501070_1029977 3300049586 Bacteria 637
449 Ga0501071_0008764 3300049587 Bacteria 6699
450 Ga0501071_0021303 3300049587 Bacteria 4512
451 Ga0501071_0021699 3300049587 Bacteria 4476
452 Ga0501071_0320125 3300049587 Bacteria 1178
453 Ga0501071_0354881 3300049587 Bacteria 1116
454 Ga0501071_0455213 3300049587 Bacteria 980
455 Ga0501071_0523315 3300049587 Bacteria 910
456 Ga0501072_0021389 3300049588 Bacteria 5016
457 Ga0501072_0146444 3300049588 Bacteria 1883
458 Ga0501072_0281294 3300049588 Bacteria 1323
459 Ga0501072_1094664 3300049588 Bacteria 620
460 Ga0501072_1384853 3300049588 Bacteria 544
461 Ga0501073_0365137 3300049589 Bacteria 997
462 Ga0501073_0555275 3300049589 Bacteria 793
463 Ga0501074_0079596 3300049590 Bacteria 2351
464 Ga0501074_0122251 3300049590 Bacteria 1862
465 Ga0501074_0256989 3300049590 Bacteria 1242
466 Ga0501074_0386026 3300049590 Bacteria 993
467 Ga0501074_0859705 3300049590 Bacteria 639
468 Ga0501075_0006078 3300049591 Bacteria 8287
469 Ga0501075_0138055 3300049591 Bacteria 1857
470 Ga0501075_0148403 3300049591 Bacteria 1787
471 Ga0501075_0427728 3300049591 Bacteria 1010
472 Ga0501075_0732751 3300049591 Bacteria 753
473 Ga0501076_0034231 3300049592 Bacteria 3970
474 Ga0501076_0068687 3300049592 Bacteria 2830
475 Ga0501076_0180211 3300049592 Bacteria 1722
476 Ga0501076_0183271 3300049592 Bacteria 1707
477 Ga0501076_0371691 3300049592 Bacteria 1175
478 Ga0501076_0385712 3300049592 Bacteria 1151
479 Ga0501077_0013071 3300049593 Bacteria 5202
480 Ga0501077_0114897 3300049593 Bacteria 1706
481 Ga0501202_071065 3300049652 Bacteria 802
482 Ga0501206_048647 3300049653 Unclassified 670
483 Ga0501235_041728 3300049669 Bacteria 1050
484 Ga0501243_043345 3300049675 Unclassified 796
485 Ga0501259_031684 3300049688 Bacteria 1001
486 Ga0501079_0008126 3300049741 Bacteria 7951
487 Ga0501079_0039712 3300049741 Bacteria 3630
488 Ga0501079_0073851 3300049741 Bacteria 2636
489 Ga0501079_0141407 3300049741 Bacteria 1875
490 Ga0501079_0370696 3300049741 Bacteria 1122
491 Ga0501079_1228796 3300049741 Bacteria 590
492 Ga0501080_0425015 3300049742 Bacteria 1193
493 Ga0501080_0707742 3300049742 Bacteria 888
494 Ga0501081_0001404 3300049743 Bacteria 14703
495 Ga0501081_0037648 3300049743 Bacteria 3301
496 Ga0501081_0254533 3300049743 Bacteria 1282
497 Ga0501081_0449938 3300049743 Bacteria 957
498 Ga0501081_0494872 3300049743 Bacteria 911
499 Ga0501083_0016786 3300049744 Bacteria 5114
500 Ga0501083_0350070 3300049744 Bacteria 960
501 Ga0501083_0610988 3300049744 Bacteria 709
502 Ga0501035_0234982 3300049822 Bacteria 1561
503 Ga0501035_0277611 3300049822 Bacteria 1417
504 Ga0501035_0510845 3300049822 Bacteria 988
505 Ga0501035_0838615 3300049822 Bacteria 732
506 Ga0501045_0006422 3300049824 Bacteria 8142
507 Ga0501045_0007208 3300049824 Bacteria 7716
508 Ga0501045_0035562 3300049824 Bacteria 3617
509 Ga0501045_0157872 3300049824 Bacteria 1688
510 Ga0501045_0319334 3300049824 Bacteria 1156
511 Ga0501045_0561058 3300049824 Bacteria 847
512 Ga0501045_0789614 3300049824 Bacteria 699
513 nmdc:mga03683_117605_c1 3300050489 Bacteria 1179
514 nmdc:mga03683_79908_c1 3300050489 Bacteria 1410
515 nmdc:mga03n38_184285_c1 3300050490 Bacteria 1071
516 nmdc:mga00v17_141498_c1 3300050491 Bacteria 1543
517 nmdc:mga00v17_213613_c1 3300050491 Bacteria 1248
518 nmdc:mga00v17_9656_c1 3300050491 Bacteria 5233
519 nmdc:mga0yw44_160355_c1 3300050492 Bacteria 1472
520 nmdc:mga0yw44_203728_c1 3300050492 Unclassified 1307
521 nmdc:mga06z11_524334_c1 3300050494 Bacteria 718
522 nmdc:mga05p37_1630028_c1 3300050507 Bacteria 634
523 nmdc:mga06r32_1113227_c1 3300050510 Bacteria 738
524 nmdc:mga08y16_371075_c1 3300050511 Bacteria 1468
525 nmdc:mga08x19_1145068_c1 3300050514 Bacteria 552
526 Ga0500635_0039400 3300053080 Bacteria 1571
527 Ga0495595_0429408 3300053084 Bacteria 671
528 Ga0495619_0120372 3300053085 Bacteria 1800
529 Ga0500616_0030836 3300053153 Bacteria 2941
530 Ga0501084_0005527 3300054114 Bacteria 10376
531 Ga0501084_0034334 3300054114 Bacteria 4241
532 Ga0501084_0107045 3300054114 Bacteria 2349
533 Ga0501084_0503513 3300054114 Bacteria 1024
534 Ga0501084_0609646 3300054114 Bacteria 922
535 Ga0501084_0905483 3300054114 Bacteria 742
536 Ga0501082_0118867 3300060353 Bacteria 2290
537 Ga0501082_0272324 3300060353 Bacteria 1473
538 Ga0501082_0325337 3300060353 Bacteria 1339
539 Ga0501082_0397283 3300060353 Bacteria 1203
540 Ga0530510_0021411 3300061734 Bacteria 4600
541 Ga0530510_0083707 3300061734 Bacteria 2323
542 Ga0530510_0124708 3300061734 Bacteria 1892
543 Ga0530510_0218986 3300061734 Bacteria 1415
544 Ga0530510_0375734 3300061734 Bacteria 1069
545 Ga0530510_0731152 3300061734 Bacteria 754

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0152840 Ga0466966_0152840_990_1388 132
2 3300050494 nmdc:mga06z11_524334_c1 nmdc:mga06z11_524334_c1_144_599 134
3 3300006177 Ga0075362_10388193 Ga0075362_103881932 138
4 3300049576 Ga0501040_0000429 Ga0501040_0000429_9131_9613 139
5 3300049582 Ga0501048_0040709 Ga0501048_0040709_25_507 139
6 3300049586 Ga0501070_1029977 Ga0501070_1029977_21_503 139
7 3300049587 Ga0501071_0008764 Ga0501071_0008764_5851_6333 139
8 3300049590 Ga0501074_0122251 Ga0501074_0122251_115_597 139
9 3300049591 Ga0501075_0006078 Ga0501075_0006078_7414_7896 139
10 3300049592 Ga0501076_0068687 Ga0501076_0068687_20_502 139
11 3300049593 Ga0501077_0013071 Ga0501077_0013071_414_896 139
12 3300049741 Ga0501079_0008126 Ga0501079_0008126_7412_7894 139
13 3300049743 Ga0501081_0001404 Ga0501081_0001404_513_995 139
14 3300049744 Ga0501083_0016786 Ga0501083_0016786_4368_4850 139
15 3300049822 Ga0501035_0277611 Ga0501035_0277611_817_1299 139
16 3300049824 Ga0501045_0006422 Ga0501045_0006422_31_513 139
17 3300054114 Ga0501084_0005527 Ga0501084_0005527_9573_10055 139
18 3300031548 Ga0307408_100274585 Ga0307408_1002745852 140
19 3300049574 Ga0501038_0026164 Ga0501038_0026164_4577_5059 141
20 3300005614 Ga0068856_100146167 Ga0068856_1001461672 142
21 3300013105 Ga0157369_10328917 Ga0157369_103289173 142
22 3300026078 Ga0207702_10186458 Ga0207702_101864582 142
23 3300049576 Ga0501040_0633312 Ga0501040_0633312_19_501 142
24 3300049675 Ga0501243_043345 Ga0501243_043345_76_558 143
25 3300050489 nmdc:mga03683_79908_c1 nmdc:mga03683_79908_c1_968_1399 143
26 3300006048 Ga0075363_100053183 Ga0075363_1000531834 144
27 3300042016 Ga0439463_079215 Ga0439463_079215_145_606 144
28 3300048912 Ga0496109_0055416 Ga0496109_0055416_2989_3450 144
29 3300050490 nmdc:mga03n38_184285_c1 nmdc:mga03n38_184285_c1_471_926 144
30 3300046457 Ga0495590_0000112 Ga0495590_0000112_37202_37684 145
31 3300048913 Ga0496110_1113405 Ga0496110_1113405_168_653 149
32 3300049584 Ga0501068_0158315 Ga0501068_0158315_382_870 149
33 3300049585 Ga0501069_0366341 Ga0501069_0366341_197_685 149
34 3300049589 Ga0501073_0555275 Ga0501073_0555275_156_644 149
35 3300054114 Ga0501084_0503513 Ga0501084_0503513_472_960 149
36 3300005347 Ga0070668_100489661 Ga0070668_1004896611 152
37 3300005548 Ga0070665_100435049 Ga0070665_1004350492 152
38 3300006038 Ga0075365_10070251 Ga0075365_100702512 152
39 3300006048 Ga0075363_100862288 Ga0075363_1008622881 152
40 3300006051 Ga0075364_10091485 Ga0075364_100914853 152
41 3300006177 Ga0075362_10069206 Ga0075362_100692062 152
42 3300009177 Ga0105248_12022493 Ga0105248_120224931 152
43 3300013306 Ga0163162_11378844 Ga0163162_113788442 152
44 3300013308 Ga0157375_11467249 Ga0157375_114672491 152
45 3300014325 Ga0163163_11508589 Ga0163163_115085892 152
46 3300014326 Ga0157380_11122588 Ga0157380_111225881 152
47 3300031852 Ga0307410_10767446 Ga0307410_107674461 152
48 3300032005 Ga0307411_10420902 Ga0307411_104209022 152
49 3300032126 Ga0307415_100667254 Ga0307415_1006672542 152
50 3300041410 Ga0439461_0043562 Ga0439461_0043562_368_826 152
51 3300041459 Ga0451800_0207950 Ga0451800_0207950_16_474 152
52 3300041507 Ga0451851_0366045 Ga0451851_0366045_275_733 152
53 3300042008 Ga0439450_022778 Ga0439450_022778_310_768 152
54 3300042012 Ga0439455_0057625 Ga0439455_0057625_145_603 152
55 3300042016 Ga0439463_015096 Ga0439463_015096_982_1440 152
56 3300042124 Ga0450922_004121 Ga0450922_004121_742_1200 152
57 3300042125 Ga0450923_035399 Ga0450923_035399_52_510 152
58 3300042184 Ga0450908_028099 Ga0450908_028099_190_648 152
59 3300048908 Ga0496105_0207796 Ga0496105_0207796_1126_1584 152
60 3300048914 Ga0496111_0375733 Ga0496111_0375733_372_830 152
61 3300048917 Ga0496114_0118084 Ga0496114_0118084_1442_1900 152
62 3300049582 Ga0501048_0654832 Ga0501048_0654832_103_561 152
63 3300050489 nmdc:mga03683_117605_c1 nmdc:mga03683_117605_c1_65_523 152
64 3300050491 nmdc:mga00v17_213613_c1 nmdc:mga00v17_213613_c1_321_779 152
65 3300050492 nmdc:mga0yw44_203728_c1 nmdc:mga0yw44_203728_c1_76_534 152
66 iso_pu_bacteria 2857737099 2857737895 152
67 3300042005 Ga0439448_0057739 Ga0439448_0057739_97_558 153
68 3300049568 Ga0501031_0720943 Ga0501031_0720943_12_509 153
69 3300049822 Ga0501035_0838615 Ga0501035_0838615_72_569 153
70 3300009036 Ga0105244_10065079 Ga0105244_100650792 154
71 3300013297 Ga0157378_10036310 Ga0157378_100363104 154
72 3300046472 Ga0495580_0010772 Ga0495580_0010772_6097_6567 154
73 3300047320 Ga0495672_0052841 Ga0495672_0052841_1817_2284 154
74 3300048905 Ga0496102_0056141 Ga0496102_0056141_2572_3042 154
75 3300048906 Ga0496103_0012286 Ga0496103_0012286_3861_4331 154
76 3300048915 Ga0496112_0059405 Ga0496112_0059405_2357_2827 154
77 3300049568 Ga0501031_0112138 Ga0501031_0112138_162_626 154
78 3300049572 Ga0501036_0055433 Ga0501036_0055433_1725_2189 154
79 3300049577 Ga0501041_0570396 Ga0501041_0570396_60_524 154
80 3300049578 Ga0501042_0099354 Ga0501042_0099354_1523_1987 154
81 3300049580 Ga0501046_0165066 Ga0501046_0165066_1101_1565 154
82 3300049582 Ga0501048_0271530 Ga0501048_0271530_722_1186 154
83 3300049587 Ga0501071_0021699 Ga0501071_0021699_3037_3501 154
84 3300049588 Ga0501072_0021389 Ga0501072_0021389_1353_1817 154
85 3300049590 Ga0501074_0256989 Ga0501074_0256989_378_842 154
86 3300049592 Ga0501076_0180211 Ga0501076_0180211_1042_1506 154
87 3300049741 Ga0501079_0073851 Ga0501079_0073851_752_1216 154
88 3300049742 Ga0501080_0425015 Ga0501080_0425015_645_1109 154
89 3300049824 Ga0501045_0035562 Ga0501045_0035562_2708_3172 154
90 3300060353 Ga0501082_0118867 Ga0501082_0118867_1210_1674 154
91 3300061734 Ga0530510_0124708 Ga0530510_0124708_583_1047 154
92 3300009098 Ga0105245_11286302 Ga0105245_112863021 155
93 3300005327 Ga0070658_11581360 Ga0070658_115813601 156
94 3300005616 Ga0068852_101605067 Ga0068852_1016050671 156
95 3300005834 Ga0068851_10537288 Ga0068851_105372881 156
96 3300005937 Ga0081455_10000854 Ga0081455_1000085422 156
97 3300006051 Ga0075364_10964164 Ga0075364_109641641 156
98 3300009098 Ga0105245_10327890 Ga0105245_103278902 156
99 3300013308 Ga0157375_10813296 Ga0157375_108132962 156
100 3300026142 Ga0207698_10729708 Ga0207698_107297082 156
101 3300005331 Ga0070670_100023142 Ga0070670_1000231423 157
102 3300005333 Ga0070677_10777013 Ga0070677_107770131 157
103 3300005347 Ga0070668_100569135 Ga0070668_1005691351 157
104 3300005353 Ga0070669_100006056 Ga0070669_1000060568 157
105 3300005356 Ga0070674_100609856 Ga0070674_1006098561 157
106 3300005438 Ga0070701_10016962 Ga0070701_100169624 157
107 3300005444 Ga0070694_100076508 Ga0070694_1000765082 157
108 3300005456 Ga0070678_100268701 Ga0070678_1002687012 157
109 3300005457 Ga0070662_100102755 Ga0070662_1001027552 157
110 3300005459 Ga0068867_100192663 Ga0068867_1001926632 157
111 3300005577 Ga0068857_100050641 Ga0068857_1000506413 157
112 3300005615 Ga0070702_101533048 Ga0070702_1015330481 157
113 3300005719 Ga0068861_100008205 Ga0068861_1000082054 157
114 3300005844 Ga0068862_100004865 Ga0068862_1000048654 157
115 3300006058 Ga0075432_10598061 Ga0075432_105980611 157
116 3300006844 Ga0075428_100253069 Ga0075428_1002530692 157
117 3300006847 Ga0075431_101034763 Ga0075431_1010347631 157
118 3300006880 Ga0075429_100335770 Ga0075429_1003357702 157
119 3300006881 Ga0068865_100611843 Ga0068865_1006118431 157
120 3300009094 Ga0111539_10455140 Ga0111539_104551403 157
121 3300009098 Ga0105245_12046747 Ga0105245_120467471 157
122 3300009148 Ga0105243_10159647 Ga0105243_101596472 157
123 3300009553 Ga0105249_10000970 Ga0105249_100009708 157
124 3300013306 Ga0163162_10134816 Ga0163162_101348164 157
125 3300013308 Ga0157375_10020155 Ga0157375_100201556 157
126 3300014326 Ga0157380_10007789 Ga0157380_100077893 157
127 3300017792 Ga0163161_10129344 Ga0163161_101293441 157
128 3300025908 Ga0207643_10008413 Ga0207643_100084136 157
129 3300025923 Ga0207681_10022282 Ga0207681_100222824 157
130 3300025925 Ga0207650_10028167 Ga0207650_100281674 157
131 3300025926 Ga0207659_10314976 Ga0207659_103149761 157
132 3300025933 Ga0207706_10015247 Ga0207706_100152474 157
133 3300025935 Ga0207709_10221112 Ga0207709_102211122 157
134 3300025937 Ga0207669_10128973 Ga0207669_101289732 157
135 3300025940 Ga0207691_10164451 Ga0207691_101644513 157
136 3300025940 Ga0207691_10408449 Ga0207691_104084491 157
137 3300025961 Ga0207712_10168457 Ga0207712_101684573 157
138 3300025972 Ga0207668_10557396 Ga0207668_105573962 157
139 3300026089 Ga0207648_10020719 Ga0207648_100207195 157
140 3300026116 Ga0207674_10030941 Ga0207674_100309414 157
141 3300026118 Ga0207675_100019825 Ga0207675_1000198254 157
142 3300026121 Ga0207683_10294734 Ga0207683_102947342 157
143 3300027907 Ga0207428_10202655 Ga0207428_102026552 157
144 3300028380 Ga0268265_10666527 Ga0268265_106665272 157
145 3300032004 Ga0307414_11158294 Ga0307414_111582941 157
146 3300041512 Ga0451853_1602591 Ga0451853_1602591_159_638 157
147 3300047315 Ga0495581_0374820 Ga0495581_0374820_290_769 157
148 3300047318 Ga0495636_0264750 Ga0495636_0264750_177_656 157
149 3300047322 Ga0495680_0394326 Ga0495680_0394326_187_666 157
150 3300048907 Ga0496104_0864873 Ga0496104_0864873_124_603 157
151 3300048912 Ga0496109_0023286 Ga0496109_0023286_1424_1903 157
152 3300048917 Ga0496114_0524931 Ga0496114_0524931_291_788 157
153 3300048917 Ga0496114_1558138 Ga0496114_1558138_46_525 157
154 3300048918 Ga0496115_0619421 Ga0496115_0619421_141_638 157
155 3300049572 Ga0501036_0086257 Ga0501036_0086257_41_520 157
156 3300049572 Ga0501036_0239418 Ga0501036_0239418_763_1245 157
157 3300049577 Ga0501041_0177306 Ga0501041_0177306_711_1190 157
158 3300049584 Ga0501068_0754039 Ga0501068_0754039_141_614 157
159 3300049587 Ga0501071_0523315 Ga0501071_0523315_153_632 157
160 3300049588 Ga0501072_0281294 Ga0501072_0281294_395_874 157
161 3300049590 Ga0501074_0859705 Ga0501074_0859705_82_561 157
162 3300049653 Ga0501206_048647 Ga0501206_048647_35_514 157
163 3300049669 Ga0501235_041728 Ga0501235_041728_388_870 157
164 3300049688 Ga0501259_031684 Ga0501259_031684_111_593 157
165 3300049742 Ga0501080_0707742 Ga0501080_0707742_102_584 157
166 3300049822 Ga0501035_0510845 Ga0501035_0510845_200_682 157
167 3300050510 nmdc:mga06r32_1113227_c1 nmdc:mga06r32_1113227_c1_75_554 157
168 3300050511 nmdc:mga08y16_371075_c1 nmdc:mga08y16_371075_c1_458_940 157
169 3300053084 Ga0495595_0429408 Ga0495595_0429408_70_549 157
170 3300053085 Ga0495619_0120372 Ga0495619_0120372_379_858 157
171 3300054114 Ga0501084_0905483 Ga0501084_0905483_118_597 157
172 3300060353 Ga0501082_0397283 Ga0501082_0397283_235_708 157
173 3300061734 Ga0530510_0731152 Ga0530510_0731152_217_699 157
174 iso_pu_bacteria 2622736605 2623499411 157
175 iso_pu_bacteria 2932431166 2932432790 157
176 3300005328 Ga0070676_10622763 Ga0070676_106227631 158
177 3300005435 Ga0070714_100703545 Ga0070714_1007035452 158
178 3300005468 Ga0070707_100089106 Ga0070707_1000891062 158
179 3300005719 Ga0068861_100617330 Ga0068861_1006173302 158
180 3300006038 Ga0075365_10859986 Ga0075365_108599862 158
181 3300006163 Ga0070715_10107247 Ga0070715_101072471 158
182 3300009148 Ga0105243_11074929 Ga0105243_110749291 158
183 3300025922 Ga0207646_10075799 Ga0207646_100757992 158
184 3300025931 Ga0207644_10109037 Ga0207644_101090374 158
185 3300031824 Ga0307413_10444782 Ga0307413_104447821 158
186 3300031852 Ga0307410_10145640 Ga0307410_101456402 158
187 3300031901 Ga0307406_10705506 Ga0307406_107055062 158
188 3300031903 Ga0307407_10735020 Ga0307407_107350202 158
189 3300032004 Ga0307414_10434788 Ga0307414_104347882 158
190 3300032005 Ga0307411_10123563 Ga0307411_101235632 158
191 3300032126 Ga0307415_100560223 Ga0307415_1005602232 158
192 3300035725 Ga0373947_0732181 Ga0373947_0732181_79_558 158
193 3300037853 Ga0436364_1325333 Ga0436364_1325333_147_623 158
194 3300039447 Ga0436361_0652110 Ga0436361_0652110_2016_2498 158
195 3300041452 Ga0451793_0224190 Ga0451793_0224190_186_668 158
196 3300041494 Ga0451837_1040030 Ga0451837_1040030_415_894 158
197 3300042004 Ga0439445_0055606 Ga0439445_0055606_562_1047 158
198 3300044656 Ga0466969_0004631 Ga0466969_0004631_4888_5370 158
199 3300044901 Ga0466960_0077785 Ga0466960_0077785_759_1238 158
200 3300044901 Ga0466960_0342548 Ga0466960_0342548_119_598 158
201 3300046517 Ga0495630_0160473 Ga0495630_0160473_949_1428 158
202 3300046535 Ga0495586_0203512 Ga0495586_0203512_103_582 158
203 3300046559 Ga0495667_0818660 Ga0495667_0818660_66_548 158
204 3300047317 Ga0495604_0747066 Ga0495604_0747066_113_595 158
205 3300049587 Ga0501071_0455213 Ga0501071_0455213_471_950 158
206 3300049588 Ga0501072_1384853 Ga0501072_1384853_42_521 158
207 3300049591 Ga0501075_0427728 Ga0501075_0427728_219_698 158
208 3300049741 Ga0501079_1228796 Ga0501079_1228796_83_562 158
209 3300049743 Ga0501081_0494872 Ga0501081_0494872_58_537 158
210 3300050514 nmdc:mga08x19_1145068_c1 nmdc:mga08x19_1145068_c1_12_494 158
211 3300053080 Ga0500635_0039400 Ga0500635_0039400_237_716 158
212 3300061734 Ga0530510_0083707 Ga0530510_0083707_1710_2189 158
213 iso_pu_bacteria 2839986021 2839988895 158
214 3300005330 Ga0070690_100431176 Ga0070690_1004311762 159
215 3300005445 Ga0070708_100067657 Ga0070708_1000676572 159
216 3300005445 Ga0070708_100422178 Ga0070708_1004221782 159
217 3300005467 Ga0070706_100040845 Ga0070706_1000408453 159
218 3300005467 Ga0070706_100109636 Ga0070706_1001096363 159
219 3300005467 Ga0070706_100301669 Ga0070706_1003016692 159
220 3300005467 Ga0070706_101514841 Ga0070706_1015148411 159
221 3300005468 Ga0070707_100000368 Ga0070707_10000036823 159
222 3300005468 Ga0070707_100063112 Ga0070707_1000631122 159
223 3300005518 Ga0070699_100743244 Ga0070699_1007432442 159
224 3300005518 Ga0070699_101065417 Ga0070699_1010654171 159
225 3300007265 Ga0099794_10085908 Ga0099794_100859082 159
226 3300009147 Ga0114129_10113217 Ga0114129_101132172 159
227 3300022467 Ga0224712_10392076 Ga0224712_103920762 159
228 3300025910 Ga0207684_10014005 Ga0207684_100140058 159
229 3300025910 Ga0207684_10160581 Ga0207684_101605814 159
230 3300025922 Ga0207646_10002107 Ga0207646_1000210710 159
231 3300025922 Ga0207646_10343710 Ga0207646_103437103 159
232 3300025922 Ga0207646_10655669 Ga0207646_106556692 159
233 3300031727 Ga0316576_10061380 Ga0316576_100613802 159
234 3300031995 Ga0307409_101177122 Ga0307409_1011771222 159
235 3300032002 Ga0307416_100253424 Ga0307416_1002534243 159
236 3300032002 Ga0307416_101016776 Ga0307416_1010167762 159
237 3300035398 Ga0316574_0208763 Ga0316574_0208763_108_587 159
238 3300038443 Ga0395901_0473794 Ga0395901_0473794_773_1261 159
239 3300039453 Ga0436362_0137809 Ga0436362_0137809_450_929 159
240 3300044901 Ga0466960_0117983 Ga0466960_0117983_456_941 159
241 3300044901 Ga0466960_0283384 Ga0466960_0283384_172_657 159
242 3300045836 Ga0466958_0126741 Ga0466958_0126741_127_609 159
243 3300049568 Ga0501031_0059409 Ga0501031_0059409_746_1225 159
244 3300049568 Ga0501031_0261428 Ga0501031_0261428_56_535 159
245 3300049570 Ga0501033_0200420 Ga0501033_0200420_804_1283 159
246 3300049570 Ga0501033_0208721 Ga0501033_0208721_228_707 159
247 3300049571 Ga0501034_0226810 Ga0501034_0226810_854_1333 159
248 3300049572 Ga0501036_0141445 Ga0501036_0141445_978_1457 159
249 3300049572 Ga0501036_0150204 Ga0501036_0150204_156_635 159
250 3300049574 Ga0501038_0096659 Ga0501038_0096659_1305_1784 159
251 3300049574 Ga0501038_0378476 Ga0501038_0378476_65_544 159
252 3300049575 Ga0501039_0022657 Ga0501039_0022657_3627_4106 159
253 3300049575 Ga0501039_0051810 Ga0501039_0051810_413_892 159
254 3300049576 Ga0501040_0081071 Ga0501040_0081071_744_1223 159
255 3300049576 Ga0501040_0170325 Ga0501040_0170325_633_1112 159
256 3300049576 Ga0501040_1042007 Ga0501040_1042007_67_546 159
257 3300049577 Ga0501041_0106882 Ga0501041_0106882_679_1158 159
258 3300049578 Ga0501042_0042064 Ga0501042_0042064_1590_2069 159
259 3300049578 Ga0501042_0311360 Ga0501042_0311360_84_563 159
260 3300049579 Ga0501043_0465306 Ga0501043_0465306_80_559 159
261 3300049580 Ga0501046_0057695 Ga0501046_0057695_158_637 159
262 3300049580 Ga0501046_0389516 Ga0501046_0389516_101_580 159
263 3300049582 Ga0501048_0301713 Ga0501048_0301713_97_576 159
264 3300049584 Ga0501068_0231984 Ga0501068_0231984_232_711 159
265 3300049584 Ga0501068_0235234 Ga0501068_0235234_229_708 159
266 3300049587 Ga0501071_0021303 Ga0501071_0021303_1148_1627 159
267 3300049587 Ga0501071_0354881 Ga0501071_0354881_253_732 159
268 3300049588 Ga0501072_0146444 Ga0501072_0146444_387_866 159
269 3300049588 Ga0501072_1094664 Ga0501072_1094664_107_586 159
270 3300049589 Ga0501073_0365137 Ga0501073_0365137_255_734 159
271 3300049590 Ga0501074_0079596 Ga0501074_0079596_503_982 159
272 3300049590 Ga0501074_0386026 Ga0501074_0386026_49_528 159
273 3300049591 Ga0501075_0138055 Ga0501075_0138055_1161_1640 159
274 3300049591 Ga0501075_0148403 Ga0501075_0148403_773_1252 159
275 3300049592 Ga0501076_0034231 Ga0501076_0034231_3247_3726 159
276 3300049592 Ga0501076_0183271 Ga0501076_0183271_94_573 159
277 3300049592 Ga0501076_0385712 Ga0501076_0385712_96_575 159
278 3300049593 Ga0501077_0114897 Ga0501077_0114897_803_1282 159
279 3300049741 Ga0501079_0039712 Ga0501079_0039712_2032_2511 159
280 3300049741 Ga0501079_0141407 Ga0501079_0141407_967_1446 159
281 3300049741 Ga0501079_0370696 Ga0501079_0370696_90_569 159
282 3300049743 Ga0501081_0037648 Ga0501081_0037648_1930_2409 159
283 3300049743 Ga0501081_0254533 Ga0501081_0254533_245_724 159
284 3300049744 Ga0501083_0350070 Ga0501083_0350070_307_786 159
285 3300049744 Ga0501083_0610988 Ga0501083_0610988_69_548 159
286 3300049822 Ga0501035_0234982 Ga0501035_0234982_524_1003 159
287 3300049824 Ga0501045_0007208 Ga0501045_0007208_590_1069 159
288 3300049824 Ga0501045_0789614 Ga0501045_0789614_138_617 159
289 3300050492 nmdc:mga0yw44_160355_c1 nmdc:mga0yw44_160355_c1_11_490 159
290 3300050507 nmdc:mga05p37_1630028_c1 nmdc:mga05p37_1630028_c1_34_513 159
291 3300054114 Ga0501084_0034334 Ga0501084_0034334_446_925 159
292 3300054114 Ga0501084_0107045 Ga0501084_0107045_1164_1643 159
293 3300060353 Ga0501082_0272324 Ga0501082_0272324_158_637 159
294 3300060353 Ga0501082_0325337 Ga0501082_0325337_76_555 159
295 3300061734 Ga0530510_0021411 Ga0530510_0021411_2591_3070 159
296 3300061734 Ga0530510_0375734 Ga0530510_0375734_408_887 159
297 3300005327 Ga0070658_10323692 Ga0070658_103236922 160
298 3300005329 Ga0070683_100575991 Ga0070683_1005759912 160
299 3300005336 Ga0070680_100908646 Ga0070680_1009086461 160
300 3300005344 Ga0070661_100836364 Ga0070661_1008363641 160
301 3300005356 Ga0070674_100163248 Ga0070674_1001632482 160
302 3300005434 Ga0070709_10060775 Ga0070709_100607754 160
303 3300005455 Ga0070663_101001344 Ga0070663_1010013441 160
304 3300005456 Ga0070678_100516849 Ga0070678_1005168492 160
305 3300005458 Ga0070681_10699929 Ga0070681_106999291 160
306 3300005535 Ga0070684_101265998 Ga0070684_1012659982 160
307 3300005543 Ga0070672_101148633 Ga0070672_1011486331 160
308 3300005546 Ga0070696_100281068 Ga0070696_1002810681 160
309 3300005547 Ga0070693_100072170 Ga0070693_1000721702 160
310 3300005615 Ga0070702_100000708 Ga0070702_1000007083 160
311 3300005718 Ga0068866_10027607 Ga0068866_100276073 160
312 3300006038 Ga0075365_10061995 Ga0075365_100619954 160
313 3300006051 Ga0075364_10011126 Ga0075364_100111266 160
314 3300006173 Ga0070716_100602860 Ga0070716_1006028602 160
315 3300009094 Ga0111539_11110929 Ga0111539_111109292 160
316 3300009098 Ga0105245_10358983 Ga0105245_103589832 160
317 3300009148 Ga0105243_10114155 Ga0105243_101141554 160
318 3300009176 Ga0105242_10038314 Ga0105242_100383147 160
319 3300009551 Ga0105238_10036584 Ga0105238_100365845 160
320 3300009551 Ga0105238_10449057 Ga0105238_104490571 160
321 3300009553 Ga0105249_10087274 Ga0105249_100872743 160
322 3300013297 Ga0157378_10040156 Ga0157378_100401561 160
323 3300013308 Ga0157375_10557136 Ga0157375_105571362 160
324 3300017792 Ga0163161_10257341 Ga0163161_102573412 160
325 3300020081 Ga0206354_11624847 Ga0206354_116248472 160
326 3300025898 Ga0207692_10726418 Ga0207692_107264181 160
327 3300025906 Ga0207699_10060774 Ga0207699_100607743 160
328 3300025921 Ga0207652_10561318 Ga0207652_105613181 160
329 3300025924 Ga0207694_10116696 Ga0207694_101166962 160
330 3300025927 Ga0207687_10244178 Ga0207687_102441782 160
331 3300025933 Ga0207706_10390083 Ga0207706_103900832 160
332 3300025934 Ga0207686_10776853 Ga0207686_107768532 160
333 3300025935 Ga0207709_10978203 Ga0207709_109782031 160
334 3300025937 Ga0207669_10281642 Ga0207669_102816422 160
335 3300025938 Ga0207704_11002497 Ga0207704_110024971 160
336 3300025961 Ga0207712_10136472 Ga0207712_101364722 160
337 3300025972 Ga0207668_10066232 Ga0207668_100662321 160
338 3300025981 Ga0207640_11794967 Ga0207640_117949671 160
339 3300026075 Ga0207708_10096404 Ga0207708_100964043 160
340 3300026116 Ga0207674_10884356 Ga0207674_108843562 160
341 3300028794 Ga0307515_10320082 Ga0307515_103200821 160
342 3300028794 Ga0307515_10407782 Ga0307515_104077822 160
343 3300031731 Ga0307405_10135323 Ga0307405_101353233 160
344 3300031824 Ga0307413_10157269 Ga0307413_101572693 160
345 3300031824 Ga0307413_10812092 Ga0307413_108120921 160
346 3300031852 Ga0307410_10058437 Ga0307410_100584372 160
347 3300031901 Ga0307406_10373819 Ga0307406_103738192 160
348 3300031903 Ga0307407_10160237 Ga0307407_101602373 160
349 3300031903 Ga0307407_10172648 Ga0307407_101726482 160
350 3300031995 Ga0307409_100179591 Ga0307409_1001795914 160
351 3300031995 Ga0307409_100385173 Ga0307409_1003851732 160
352 3300031995 Ga0307409_100547380 Ga0307409_1005473802 160
353 3300031995 Ga0307409_100737882 Ga0307409_1007378822 160
354 3300032002 Ga0307416_100003197 Ga0307416_1000031973 160
355 3300032002 Ga0307416_100100785 Ga0307416_1001007852 160
356 3300032002 Ga0307416_100308225 Ga0307416_1003082253 160
357 3300032002 Ga0307416_100479771 Ga0307416_1004797713 160
358 3300032002 Ga0307416_100497885 Ga0307416_1004978851 160
359 3300032002 Ga0307416_100701667 Ga0307416_1007016673 160
360 3300032004 Ga0307414_10333273 Ga0307414_103332733 160
361 3300032005 Ga0307411_10056805 Ga0307411_100568053 160
362 3300032005 Ga0307411_11203638 Ga0307411_112036381 160
363 3300032005 Ga0307411_11289614 Ga0307411_112896141 160
364 3300032126 Ga0307415_100005224 Ga0307415_1000052244 160
365 3300032126 Ga0307415_100265345 Ga0307415_1002653452 160
366 3300032126 Ga0307415_101398833 Ga0307415_1013988332 160
367 3300035083 Ga0373926_0001692 Ga0373926_0001692_5011_5493 160
368 3300035692 Ga0373935_0000278 Ga0373935_0000278_1437_1919 160
369 3300035725 Ga0373947_0000136 Ga0373947_0000136_22041_22523 160
370 3300036401 Ga0373937_0665064 Ga0373937_0665064_480_965 160
371 3300037312 Ga0395899_0167397 Ga0395899_0167397_589_1074 160
372 3300037466 Ga0395898_0037858 Ga0395898_0037858_2166_2651 160
373 3300038443 Ga0395901_0104103 Ga0395901_0104103_1399_1884 160
374 3300041441 Ga0451787_549090 Ga0451787_549090_33_515 160
375 3300041443 Ga0451789_1142045 Ga0451789_1142045_15_497 160
376 3300041452 Ga0451793_0962940 Ga0451793_0962940_897_1379 160
377 3300041456 Ga0451795_1166415 Ga0451795_1166415_122_604 160
378 3300041459 Ga0451800_1364876 Ga0451800_1364876_99_581 160
379 3300041498 Ga0451841_1386162 Ga0451841_1386162_31_513 160
380 3300041509 Ga0451843_0459762 Ga0451843_0459762_90_572 160
381 3300044684 Ga0466966_0063019 Ga0466966_0063019_1767_2249 160
382 3300044693 Ga0466961_0095403 Ga0466961_0095403_686_1174 160
383 3300044694 Ga0466963_0263200 Ga0466963_0263200_638_1123 160
384 3300044719 Ga0466971_0226158 Ga0466971_0226158_267_767 160
385 3300044901 Ga0466960_0142913 Ga0466960_0142913_352_834 160
386 3300044901 Ga0466960_0500593 Ga0466960_0500593_179_679 160
387 3300045049 Ga0466959_0090991 Ga0466959_0090991_1681_2163 160
388 3300045976 Ga0466967_0004977 Ga0466967_0004977_5249_5734 160
389 3300045976 Ga0466967_1205748 Ga0466967_1205748_61_546 160
390 3300046459 Ga0495629_0015161 Ga0495629_0015161_2588_3082 160
391 3300046518 Ga0495631_0222977 Ga0495631_0222977_77_559 160
392 3300046539 Ga0495621_0348645 Ga0495621_0348645_38_520 160
393 3300046689 Ga0495613_0011252 Ga0495613_0011252_2104_2598 160
394 3300048903 Ga0496100_0805052 Ga0496100_0805052_233_718 160
395 3300048912 Ga0496109_0394343 Ga0496109_0394343_305_790 160
396 3300048913 Ga0496110_0850095 Ga0496110_0850095_178_663 160
397 3300048914 Ga0496111_0547442 Ga0496111_0547442_51_536 160
398 3300049578 Ga0501042_0689780 Ga0501042_0689780_189_671 160
399 3300049652 Ga0501202_071065 Ga0501202_071065_13_495 160
400 3300049743 Ga0501081_0449938 Ga0501081_0449938_414_896 160
401 3300049824 Ga0501045_0157872 Ga0501045_0157872_1177_1659 160
402 3300049824 Ga0501045_0319334 Ga0501045_0319334_382_864 160
403 3300049824 Ga0501045_0561058 Ga0501045_0561058_10_501 160
404 3300050491 nmdc:mga00v17_9656_c1 nmdc:mga00v17_9656_c1_840_1325 160
405 3300061734 Ga0530510_0218986 Ga0530510_0218986_231_716 160
406 iso_pu_bacteria 2990088156 2990088217 160
407 3300005327 Ga0070658_10329785 Ga0070658_103297851 161
408 3300005338 Ga0068868_100803523 Ga0068868_1008035232 161
409 3300005343 Ga0070687_100534054 Ga0070687_1005340542 161
410 3300005366 Ga0070659_100296318 Ga0070659_1002963182 161
411 3300005441 Ga0070700_100319136 Ga0070700_1003191362 161
412 3300005455 Ga0070663_100292206 Ga0070663_1002922062 161
413 3300005543 Ga0070672_100632378 Ga0070672_1006323782 161
414 3300005578 Ga0068854_101286979 Ga0068854_1012869791 161
415 3300005841 Ga0068863_100613736 Ga0068863_1006137362 161
416 3300005937 Ga0081455_10203414 Ga0081455_102034142 161
417 3300006051 Ga0075364_10022489 Ga0075364_100224893 161
418 3300006358 Ga0068871_100289936 Ga0068871_1002899362 161
419 3300009098 Ga0105245_10793550 Ga0105245_107935501 161
420 3300009148 Ga0105243_10231306 Ga0105243_102313063 161
421 3300009551 Ga0105238_10541185 Ga0105238_105411852 161
422 3300014326 Ga0157380_10682854 Ga0157380_106828542 161
423 3300017792 Ga0163161_10207021 Ga0163161_102070213 161
424 3300020070 Ga0206356_10679917 Ga0206356_106799171 161
425 3300025926 Ga0207659_10720487 Ga0207659_107204872 161
426 3300025928 Ga0207700_10631843 Ga0207700_106318431 161
427 3300025932 Ga0207690_10663928 Ga0207690_106639282 161
428 3300025938 Ga0207704_10280968 Ga0207704_102809681 161
429 3300026118 Ga0207675_100308357 Ga0207675_1003083573 161
430 3300026142 Ga0207698_10922172 Ga0207698_109221722 161
431 3300031548 Ga0307408_100172872 Ga0307408_1001728722 161
432 3300031548 Ga0307408_100337679 Ga0307408_1003376792 161
433 3300031548 Ga0307408_100583740 Ga0307408_1005837401 161
434 3300031731 Ga0307405_10013580 Ga0307405_100135804 161
435 3300031731 Ga0307405_10362087 Ga0307405_103620872 161
436 3300031731 Ga0307405_10563245 Ga0307405_105632451 161
437 3300031852 Ga0307410_10076800 Ga0307410_100768002 161
438 3300031852 Ga0307410_10178650 Ga0307410_101786502 161
439 3300031852 Ga0307410_10354054 Ga0307410_103540542 161
440 3300031852 Ga0307410_10427897 Ga0307410_104278972 161
441 3300031852 Ga0307410_10445461 Ga0307410_104454612 161
442 3300031901 Ga0307406_10267398 Ga0307406_102673981 161
443 3300031901 Ga0307406_10291989 Ga0307406_102919891 161
444 3300031901 Ga0307406_10692560 Ga0307406_106925602 161
445 3300031901 Ga0307406_10732397 Ga0307406_107323972 161
446 3300031903 Ga0307407_10047195 Ga0307407_100471952 161
447 3300031903 Ga0307407_10128678 Ga0307407_101286783 161
448 3300031911 Ga0307412_10065506 Ga0307412_100655063 161
449 3300031911 Ga0307412_10764919 Ga0307412_107649191 161
450 3300031911 Ga0307412_11240780 Ga0307412_112407801 161
451 3300031995 Ga0307409_100036827 Ga0307409_1000368272 161
452 3300031995 Ga0307409_100181839 Ga0307409_1001818393 161
453 3300031995 Ga0307409_100240214 Ga0307409_1002402143 161
454 3300031995 Ga0307409_100458516 Ga0307409_1004585163 161
455 3300031995 Ga0307409_100968271 Ga0307409_1009682712 161
456 3300031995 Ga0307409_101535960 Ga0307409_1015359601 161
457 3300031995 Ga0307409_101773125 Ga0307409_1017731251 161
458 3300032002 Ga0307416_100092040 Ga0307416_1000920402 161
459 3300032002 Ga0307416_100123286 Ga0307416_1001232861 161
460 3300032002 Ga0307416_100140270 Ga0307416_1001402702 161
461 3300032002 Ga0307416_100178411 Ga0307416_1001784113 161
462 3300032002 Ga0307416_101062947 Ga0307416_1010629472 161
463 3300032002 Ga0307416_101855085 Ga0307416_1018550852 161
464 3300032004 Ga0307414_10060528 Ga0307414_100605282 161
465 3300032004 Ga0307414_10473386 Ga0307414_104733862 161
466 3300032005 Ga0307411_10522803 Ga0307411_105228032 161
467 3300032126 Ga0307415_100395372 Ga0307415_1003953723 161
468 3300032126 Ga0307415_100445078 Ga0307415_1004450782 161
469 3300032126 Ga0307415_100660825 Ga0307415_1006608251 161
470 3300032126 Ga0307415_100671458 Ga0307415_1006714582 161
471 3300032126 Ga0307415_100867709 Ga0307415_1008677092 161
472 3300035170 Ga0373943_0444405 Ga0373943_0444405_225_710 161
473 3300035398 Ga0316574_0014859 Ga0316574_0014859_1262_1747 161
474 3300039450 Ga0436363_1155040 Ga0436363_1155040_485_976 161
475 3300042010 Ga0439452_050179 Ga0439452_050179_187_678 161
476 3300044656 Ga0466969_0112689 Ga0466969_0112689_539_1024 161
477 3300044683 Ga0466965_0317054 Ga0466965_0317054_220_708 161
478 3300044693 Ga0466961_0039817 Ga0466961_0039817_2227_2712 161
479 3300044693 Ga0466961_0163385 Ga0466961_0163385_639_1124 161
480 3300044693 Ga0466961_0533095 Ga0466961_0533095_172_669 161
481 3300044842 Ga0466957_0256653 Ga0466957_0256653_420_908 161
482 3300044901 Ga0466960_0210291 Ga0466960_0210291_379_876 161
483 3300045049 Ga0466959_0075447 Ga0466959_0075447_27_512 161
484 3300045836 Ga0466958_0076736 Ga0466958_0076736_408_893 161
485 3300045836 Ga0466958_0080626 Ga0466958_0080626_1333_1818 161
486 3300046455 Ga0495603_0002275 Ga0495603_0002275_10549_11058 161
487 3300046455 Ga0495603_0082633 Ga0495603_0082633_953_1462 161
488 3300046459 Ga0495629_0358022 Ga0495629_0358022_19_504 161
489 3300046473 Ga0495582_0255634 Ga0495582_0255634_308_817 161
490 3300046475 Ga0495639_0069738 Ga0495639_0069738_460_969 161
491 3300046499 Ga0495594_0059235 Ga0495594_0059235_613_1122 161
492 3300046515 Ga0495620_0217455 Ga0495620_0217455_16_501 161
493 3300046518 Ga0495631_0148127 Ga0495631_0148127_216_725 161
494 3300046674 Ga0495588_0058569 Ga0495588_0058569_1262_1771 161
495 3300046691 Ga0495670_0057930 Ga0495670_0057930_604_1113 161
496 3300046692 Ga0495671_0228084 Ga0495671_0228084_150_659 161
497 3300046794 Ga0495589_0181471 Ga0495589_0181471_256_765 161
498 3300046809 Ga0495600_0087006 Ga0495600_0087006_542_1075 161
499 3300047315 Ga0495581_0192400 Ga0495581_0192400_313_822 161
500 3300047318 Ga0495636_0003098 Ga0495636_0003098_3499_4008 161
501 3300047318 Ga0495636_0189082 Ga0495636_0189082_93_578 161
502 3300047444 Ga0495675_0073946 Ga0495675_0073946_1056_1589 161
503 3300047447 Ga0495685_003755 Ga0495685_003755_2652_3161 161
504 3300048905 Ga0496102_1053103 Ga0496102_1053103_175_684 161
505 3300049586 Ga0501070_0615180 Ga0501070_0615180_259_744 161
506 3300049592 Ga0501076_0371691 Ga0501076_0371691_79_564 161
507 3300050491 nmdc:mga00v17_141498_c1 nmdc:mga00v17_141498_c1_390_875 161
508 3300005336 Ga0070680_100279966 Ga0070680_1002799662 162
509 3300031456 Ga0307513_10001518 Ga0307513_100015183 162
510 3300046460 Ga0495638_0086541 Ga0495638_0086541_942_1430 162
511 3300049568 Ga0501031_0050716 Ga0501031_0050716_1920_2417 162
512 3300049568 Ga0501031_0103102 Ga0501031_0103102_317_805 162
513 3300049577 Ga0501041_0568275 Ga0501041_0568275_164_661 162
514 3300049582 Ga0501048_0431646 Ga0501048_0431646_192_689 162
515 3300049587 Ga0501071_0320125 Ga0501071_0320125_257_754 162
516 3300049591 Ga0501075_0732751 Ga0501075_0732751_25_513 162
517 3300053153 Ga0500616_0030836 Ga0500616_0030836_1924_2412 162
518 3300054114 Ga0501084_0609646 Ga0501084_0609646_109_606 162
519 iso_pu_bacteria 2582581314 2585311743 162
520 3300005440 Ga0070705_100615189 Ga0070705_1006151891 163
521 3300009177 Ga0105248_11306595 Ga0105248_113065951 163
522 3300047320 Ga0495672_0052841 Ga0495672_0052841_1314_1820 163
523 3300048907 Ga0496104_0912106 Ga0496104_0912106_148_639 163
524 3300048908 Ga0496105_0884542 Ga0496105_0884542_61_597 163
525 3300048910 Ga0496107_0556766 Ga0496107_0556766_284_820 163
526 3300048911 Ga0496108_0267270 Ga0496108_0267270_33_569 163
527 3300048912 Ga0496109_0030226 Ga0496109_0030226_1009_1545 163
528 3300048914 Ga0496111_0853267 Ga0496111_0853267_50_586 163
529 3300048915 Ga0496112_0478546 Ga0496112_0478546_409_900 163
530 iso_pu_bacteria 2643221678 2644441706 164
531 3300005578 Ga0068854_100498254 Ga0068854_1004982542 165
532 3300010375 Ga0105239_10700725 Ga0105239_107007251 165
533 3300025935 Ga0207709_10729532 Ga0207709_107295321 165
534 3300028794 Ga0307515_10405510 Ga0307515_104055102 165
535 3300031616 Ga0307508_10172561 Ga0307508_101725612 165
536 3300046474 Ga0495605_0015478 Ga0495605_0015478_704_1246 165
537 3300046492 Ga0495585_0126130 Ga0495585_0126130_418_960 165
538 3300046501 Ga0495607_0053087 Ga0495607_0053087_381_923 165
539 3300046507 Ga0495606_0004553 Ga0495606_0004553_12113_12655 165
540 3300046515 Ga0495620_0005950 Ga0495620_0005950_2104_2646 165
541 3300046524 Ga0495648_0035820 Ga0495648_0035820_481_1023 165
542 3300046542 Ga0495597_0073708 Ga0495597_0073708_167_709 165
543 3300046616 Ga0495668_0039199 Ga0495668_0039199_1863_2405 165
544 3300046660 Ga0495625_0011064 Ga0495625_0011064_4794_5336 165
545 3300046694 Ga0495649_0074825 Ga0495649_0074825_675_1217 165
546 3300046794 Ga0495589_0012642 Ga0495589_0012642_983_1525 165
547 3300046810 Ga0495660_0091018 Ga0495660_0091018_740_1282 165
548 3300047323 Ga0495683_0020245 Ga0495683_0020245_186_728 165
549 3300047443 Ga0495687_007595 Ga0495687_007595_1295_1837 165
550 3300047447 Ga0495685_026502 Ga0495685_026502_470_1012 165
551 3300048091 Ga0495626_0018072 Ga0495626_0018072_1826_2368 165
552 3300048922 Ga0496119_0467158 Ga0496119_0467158_34_576 165
553 3300000549 LJQas_1012115 LJQas_10121152 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

27

163

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9706 8 162
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9183 8 162
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9176 8 160
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9161 19 158
3pu2-assembly1.cif.gz_A crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9151 8 160
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9458 8 162 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9115 8 162 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8996 19 158 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8938 8 160 3.30.530.20
3pu2H00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8763 8 160 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1I6ZK19-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9961 3 159
AF-A0A4V2SSL7-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9919 7 160
AF-A0A316F6K1-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9906 6 162
AF-A0A1V4EGR7-F1-model_v4 Polyketide cyclase 0.9878 8 163
AF-A0A177YLP1-F1-model_v4 Polyketide cyclase 0.9858 7 158

Feature Viewer

pLDDT pTM Quality
92.39 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map