F462894
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 281 | 545 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0533095|Ga0466961_0533095_172_669 |
| Length | 165 |
| Sequence | MTSTTHHETSIVADPDVPLVRIVREFDAPVEKVFRAHTDPDLLVRWLGPRDLTMTIDHFDCRTGGSYRYVHSRDGQDGREEYGFHGSFHEVRPHELIVQTFTFEGFPDGVALEKLVLEDLGDGRTRLTATSLVDSFEGRDAFVASGMETGVVQGYERLDEVLARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 2 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 3 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 4 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 5 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 6 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 7 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 8 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 67 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 120 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 123 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 126 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 127 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 128 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 129 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 131 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 136 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 138 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 139 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 140 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 143 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 144 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 145 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 146 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 147 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 148 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 149 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 155 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 156 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 157 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 160 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 161 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 162 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 163 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 164 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 165 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 166 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 167 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 170 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 171 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 172 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 176 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 177 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 178 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 179 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 225 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 228 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 231 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 256 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 257 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 258 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 259 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 269 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 279 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.19 |
| Metatranscriptomes | 0.54 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.98 |
| Nodule | 0 |
| Rhizoplane | 5.79 |
| Rhizosphere | 87.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1012115 | 3300000549 | Bacteria | 1021 |
| 2 | Ga0070658_10323692 | 3300005327 | Bacteria | 1317 |
| 3 | Ga0070658_10329785 | 3300005327 | Bacteria | 1304 |
| 4 | Ga0070658_11581360 | 3300005327 | Bacteria | 568 |
| 5 | Ga0070676_10622763 | 3300005328 | Bacteria | 780 |
| 6 | Ga0070683_100575991 | 3300005329 | Bacteria | 1077 |
| 7 | Ga0070690_100431176 | 3300005330 | Bacteria | 974 |
| 8 | Ga0070670_100023142 | 3300005331 | Bacteria | 5348 |
| 9 | Ga0070677_10777013 | 3300005333 | Unclassified | 545 |
| 10 | Ga0070680_100279966 | 3300005336 | Bacteria | 1413 |
| 11 | Ga0070680_100908646 | 3300005336 | Bacteria | 760 |
| 12 | Ga0068868_100803523 | 3300005338 | Bacteria | 849 |
| 13 | Ga0070687_100534054 | 3300005343 | Bacteria | 795 |
| 14 | Ga0070661_100836364 | 3300005344 | Bacteria | 757 |
| 15 | Ga0070668_100489661 | 3300005347 | Bacteria | 1063 |
| 16 | Ga0070668_100569135 | 3300005347 | Bacteria | 988 |
| 17 | Ga0070669_100006056 | 3300005353 | Bacteria | 8727 |
| 18 | Ga0070674_100163248 | 3300005356 | Bacteria | 1692 |
| 19 | Ga0070674_100609856 | 3300005356 | Bacteria | 923 |
| 20 | Ga0070659_100296318 | 3300005366 | Bacteria | 1348 |
| 21 | Ga0070709_10060775 | 3300005434 | Bacteria | 2403 |
| 22 | Ga0070714_100703545 | 3300005435 | Bacteria | 975 |
| 23 | Ga0070701_10016962 | 3300005438 | Bacteria | 3397 |
| 24 | Ga0070705_100615189 | 3300005440 | Bacteria | 842 |
| 25 | Ga0070700_100319136 | 3300005441 | Bacteria | 1141 |
| 26 | Ga0070694_100076508 | 3300005444 | Bacteria | 2317 |
| 27 | Ga0070708_100067657 | 3300005445 | Bacteria | 3209 |
| 28 | Ga0070708_100422178 | 3300005445 | Bacteria | 1258 |
| 29 | Ga0070663_100292206 | 3300005455 | Bacteria | 1302 |
| 30 | Ga0070663_101001344 | 3300005455 | Bacteria | 727 |
| 31 | Ga0070678_100268701 | 3300005456 | Bacteria | 1437 |
| 32 | Ga0070678_100516849 | 3300005456 | Bacteria | 1056 |
| 33 | Ga0070662_100102755 | 3300005457 | Bacteria | 2166 |
| 34 | Ga0070681_10699929 | 3300005458 | Bacteria | 929 |
| 35 | Ga0068867_100192663 | 3300005459 | Bacteria | 1627 |
| 36 | Ga0070706_100040845 | 3300005467 | Bacteria | 4282 |
| 37 | Ga0070706_100109636 | 3300005467 | Bacteria | 2569 |
| 38 | Ga0070706_100301669 | 3300005467 | Bacteria | 1494 |
| 39 | Ga0070706_101514841 | 3300005467 | Bacteria | 613 |
| 40 | Ga0070707_100000368 | 3300005468 | Bacteria | 44585 |
| 41 | Ga0070707_100063112 | 3300005468 | Bacteria | 3555 |
| 42 | Ga0070707_100089106 | 3300005468 | Bacteria | 2985 |
| 43 | Ga0070699_100743244 | 3300005518 | Bacteria | 897 |
| 44 | Ga0070699_101065417 | 3300005518 | Bacteria | 742 |
| 45 | Ga0070684_101265998 | 3300005535 | Bacteria | 694 |
| 46 | Ga0070672_100632378 | 3300005543 | Bacteria | 934 |
| 47 | Ga0070672_101148633 | 3300005543 | Bacteria | 691 |
| 48 | Ga0070696_100281068 | 3300005546 | Bacteria | 1269 |
| 49 | Ga0070693_100072170 | 3300005547 | Bacteria | 2036 |
| 50 | Ga0070665_100435049 | 3300005548 | Bacteria | 1321 |
| 51 | Ga0068857_100050641 | 3300005577 | Bacteria | 3684 |
| 52 | Ga0068854_100498254 | 3300005578 | Bacteria | 1025 |
| 53 | Ga0068854_101286979 | 3300005578 | Bacteria | 658 |
| 54 | Ga0068856_100146167 | 3300005614 | Bacteria | 2372 |
| 55 | Ga0070702_100000708 | 3300005615 | Bacteria | 12590 |
| 56 | Ga0070702_101533048 | 3300005615 | Unclassified | 549 |
| 57 | Ga0068852_101605067 | 3300005616 | Bacteria | 673 |
| 58 | Ga0068866_10027607 | 3300005718 | Bacteria | 2695 |
| 59 | Ga0068861_100008205 | 3300005719 | Bacteria | 7184 |
| 60 | Ga0068861_100617330 | 3300005719 | Bacteria | 997 |
| 61 | Ga0068851_10537288 | 3300005834 | Bacteria | 705 |
| 62 | Ga0068863_100613736 | 3300005841 | Bacteria | 1077 |
| 63 | Ga0068862_100004865 | 3300005844 | Bacteria | 11308 |
| 64 | Ga0081455_10000854 | 3300005937 | Bacteria | 39254 |
| 65 | Ga0081455_10203414 | 3300005937 | Bacteria | 1481 |
| 66 | Ga0075365_10061995 | 3300006038 | Bacteria | 2499 |
| 67 | Ga0075365_10070251 | 3300006038 | Bacteria | 2355 |
| 68 | Ga0075365_10859986 | 3300006038 | Bacteria | 640 |
| 69 | Ga0075363_100053183 | 3300006048 | Bacteria | 2163 |
| 70 | Ga0075363_100862288 | 3300006048 | Bacteria | 553 |
| 71 | Ga0075364_10011126 | 3300006051 | Bacteria | 5462 |
| 72 | Ga0075364_10022489 | 3300006051 | Bacteria | 3982 |
| 73 | Ga0075364_10091485 | 3300006051 | Bacteria | 2018 |
| 74 | Ga0075364_10964164 | 3300006051 | Bacteria | 580 |
| 75 | Ga0075432_10598061 | 3300006058 | Bacteria | 504 |
| 76 | Ga0070715_10107247 | 3300006163 | Bacteria | 1312 |
| 77 | Ga0070716_100602860 | 3300006173 | Bacteria | 826 |
| 78 | Ga0075362_10069206 | 3300006177 | Bacteria | 1609 |
| 79 | Ga0075362_10388193 | 3300006177 | Bacteria | 703 |
| 80 | Ga0068871_100289936 | 3300006358 | Unclassified | 1434 |
| 81 | Ga0075428_100253069 | 3300006844 | Bacteria | 1898 |
| 82 | Ga0075431_101034763 | 3300006847 | Bacteria | 787 |
| 83 | Ga0075429_100335770 | 3300006880 | Bacteria | 1323 |
| 84 | Ga0068865_100611843 | 3300006881 | Bacteria | 922 |
| 85 | Ga0099794_10085908 | 3300007265 | Bacteria | 1557 |
| 86 | Ga0105244_10065079 | 3300009036 | Bacteria | 1827 |
| 87 | Ga0111539_10455140 | 3300009094 | Bacteria | 1490 |
| 88 | Ga0111539_11110929 | 3300009094 | Bacteria | 919 |
| 89 | Ga0105245_10327890 | 3300009098 | Bacteria | 1510 |
| 90 | Ga0105245_10358983 | 3300009098 | Bacteria | 1446 |
| 91 | Ga0105245_10793550 | 3300009098 | Bacteria | 985 |
| 92 | Ga0105245_11286302 | 3300009098 | Bacteria | 780 |
| 93 | Ga0105245_12046747 | 3300009098 | Bacteria | 626 |
| 94 | Ga0114129_10113217 | 3300009147 | Bacteria | 3741 |
| 95 | Ga0105243_10114155 | 3300009148 | Bacteria | 2266 |
| 96 | Ga0105243_10159647 | 3300009148 | Bacteria | 1943 |
| 97 | Ga0105243_10231306 | 3300009148 | Bacteria | 1640 |
| 98 | Ga0105243_11074929 | 3300009148 | Bacteria | 811 |
| 99 | Ga0105242_10038314 | 3300009176 | Bacteria | 3854 |
| 100 | Ga0105248_11306595 | 3300009177 | Bacteria | 820 |
| 101 | Ga0105248_12022493 | 3300009177 | Bacteria | 655 |
| 102 | Ga0105238_10036584 | 3300009551 | Bacteria | 4991 |
| 103 | Ga0105238_10449057 | 3300009551 | Bacteria | 1286 |
| 104 | Ga0105238_10541185 | 3300009551 | Bacteria | 1168 |
| 105 | Ga0105249_10000970 | 3300009553 | Bacteria | 25417 |
| 106 | Ga0105249_10087274 | 3300009553 | Bacteria | 2911 |
| 107 | Ga0105239_10700725 | 3300010375 | Bacteria | 1158 |
| 108 | Ga0157369_10328917 | 3300013105 | Bacteria | 1588 |
| 109 | Ga0157378_10036310 | 3300013297 | Bacteria | 4361 |
| 110 | Ga0157378_10040156 | 3300013297 | Bacteria | 4149 |
| 111 | Ga0163162_10134816 | 3300013306 | Bacteria | 2580 |
| 112 | Ga0163162_11378844 | 3300013306 | Bacteria | 802 |
| 113 | Ga0157375_10020155 | 3300013308 | Bacteria | 6086 |
| 114 | Ga0157375_10557136 | 3300013308 | Bacteria | 1307 |
| 115 | Ga0157375_10813296 | 3300013308 | Bacteria | 1083 |
| 116 | Ga0157375_11467249 | 3300013308 | Bacteria | 804 |
| 117 | Ga0163163_11508589 | 3300014325 | Bacteria | 733 |
| 118 | Ga0157380_10007789 | 3300014326 | Bacteria | 7622 |
| 119 | Ga0157380_10682854 | 3300014326 | Bacteria | 1029 |
| 120 | Ga0157380_11122588 | 3300014326 | Bacteria | 826 |
| 121 | Ga0163161_10129344 | 3300017792 | Bacteria | 1903 |
| 122 | Ga0163161_10207021 | 3300017792 | Bacteria | 1514 |
| 123 | Ga0163161_10257341 | 3300017792 | Bacteria | 1362 |
| 124 | Ga0206356_10679917 | 3300020070 | Bacteria | 793 |
| 125 | Ga0206354_11624847 | 3300020081 | Bacteria | 1074 |
| 126 | Ga0224712_10392076 | 3300022467 | Bacteria | 661 |
| 127 | Ga0207692_10726418 | 3300025898 | Unclassified | 646 |
| 128 | Ga0207699_10060774 | 3300025906 | Bacteria | 2271 |
| 129 | Ga0207643_10008413 | 3300025908 | Bacteria | 5536 |
| 130 | Ga0207684_10014005 | 3300025910 | Bacteria | 6928 |
| 131 | Ga0207684_10160581 | 3300025910 | Bacteria | 1935 |
| 132 | Ga0207652_10561318 | 3300025921 | Bacteria | 1025 |
| 133 | Ga0207646_10002107 | 3300025922 | Bacteria | 23851 |
| 134 | Ga0207646_10075799 | 3300025922 | Bacteria | 3005 |
| 135 | Ga0207646_10343710 | 3300025922 | Bacteria | 1348 |
| 136 | Ga0207646_10655669 | 3300025922 | Bacteria | 940 |
| 137 | Ga0207681_10022282 | 3300025923 | Bacteria | 4039 |
| 138 | Ga0207694_10116696 | 3300025924 | Bacteria | 2127 |
| 139 | Ga0207650_10028167 | 3300025925 | Bacteria | 4026 |
| 140 | Ga0207659_10314976 | 3300025926 | Bacteria | 1289 |
| 141 | Ga0207659_10720487 | 3300025926 | Bacteria | 855 |
| 142 | Ga0207687_10244178 | 3300025927 | Bacteria | 1424 |
| 143 | Ga0207700_10631843 | 3300025928 | Bacteria | 954 |
| 144 | Ga0207644_10109037 | 3300025931 | Bacteria | 2091 |
| 145 | Ga0207690_10663928 | 3300025932 | Bacteria | 855 |
| 146 | Ga0207706_10015247 | 3300025933 | Bacteria | 6950 |
| 147 | Ga0207706_10390083 | 3300025933 | Bacteria | 1208 |
| 148 | Ga0207686_10776853 | 3300025934 | Bacteria | 766 |
| 149 | Ga0207709_10221112 | 3300025935 | Bacteria | 1366 |
| 150 | Ga0207709_10729532 | 3300025935 | Bacteria | 795 |
| 151 | Ga0207709_10978203 | 3300025935 | Bacteria | 691 |
| 152 | Ga0207669_10128973 | 3300025937 | Unclassified | 1734 |
| 153 | Ga0207669_10281642 | 3300025937 | Bacteria | 1254 |
| 154 | Ga0207704_10280968 | 3300025938 | Unclassified | 1265 |
| 155 | Ga0207704_11002497 | 3300025938 | Bacteria | 706 |
| 156 | Ga0207691_10164451 | 3300025940 | Bacteria | 1945 |
| 157 | Ga0207691_10408449 | 3300025940 | Bacteria | 1158 |
| 158 | Ga0207712_10136472 | 3300025961 | Bacteria | 1877 |
| 159 | Ga0207712_10168457 | 3300025961 | Bacteria | 1710 |
| 160 | Ga0207668_10066232 | 3300025972 | Bacteria | 2560 |
| 161 | Ga0207668_10557396 | 3300025972 | Bacteria | 993 |
| 162 | Ga0207640_11794967 | 3300025981 | Bacteria | 554 |
| 163 | Ga0207708_10096404 | 3300026075 | Bacteria | 2285 |
| 164 | Ga0207702_10186458 | 3300026078 | Bacteria | 1914 |
| 165 | Ga0207648_10020719 | 3300026089 | Bacteria | 5918 |
| 166 | Ga0207674_10030941 | 3300026116 | Bacteria | 5625 |
| 167 | Ga0207674_10884356 | 3300026116 | Bacteria | 861 |
| 168 | Ga0207675_100019825 | 3300026118 | Bacteria | 6276 |
| 169 | Ga0207675_100308357 | 3300026118 | Bacteria | 1543 |
| 170 | Ga0207683_10294734 | 3300026121 | Bacteria | 1484 |
| 171 | Ga0207698_10729708 | 3300026142 | Bacteria | 988 |
| 172 | Ga0207698_10922172 | 3300026142 | Bacteria | 881 |
| 173 | Ga0207428_10202655 | 3300027907 | Bacteria | 1492 |
| 174 | Ga0268265_10666527 | 3300028380 | Bacteria | 1001 |
| 175 | Ga0307515_10320082 | 3300028794 | Bacteria | 1218 |
| 176 | Ga0307515_10405510 | 3300028794 | Bacteria | 987 |
| 177 | Ga0307515_10407782 | 3300028794 | Bacteria | 983 |
| 178 | Ga0307513_10001518 | 3300031456 | Bacteria | 33342 |
| 179 | Ga0307408_100172872 | 3300031548 | Bacteria | 1726 |
| 180 | Ga0307408_100274585 | 3300031548 | Bacteria | 1401 |
| 181 | Ga0307408_100337679 | 3300031548 | Bacteria | 1274 |
| 182 | Ga0307408_100583740 | 3300031548 | Bacteria | 991 |
| 183 | Ga0307508_10172561 | 3300031616 | Bacteria | 1766 |
| 184 | Ga0316576_10061380 | 3300031727 | Bacteria | 2755 |
| 185 | Ga0307405_10013580 | 3300031731 | Bacteria | 4349 |
| 186 | Ga0307405_10135323 | 3300031731 | Bacteria | 1710 |
| 187 | Ga0307405_10362087 | 3300031731 | Bacteria | 1123 |
| 188 | Ga0307405_10563245 | 3300031731 | Bacteria | 924 |
| 189 | Ga0307413_10157269 | 3300031824 | Bacteria | 1592 |
| 190 | Ga0307413_10444782 | 3300031824 | Bacteria | 1027 |
| 191 | Ga0307413_10812092 | 3300031824 | Bacteria | 787 |
| 192 | Ga0307410_10058437 | 3300031852 | Bacteria | 2629 |
| 193 | Ga0307410_10076800 | 3300031852 | Bacteria | 2332 |
| 194 | Ga0307410_10145640 | 3300031852 | Bacteria | 1757 |
| 195 | Ga0307410_10178650 | 3300031852 | Bacteria | 1605 |
| 196 | Ga0307410_10354054 | 3300031852 | Bacteria | 1174 |
| 197 | Ga0307410_10427897 | 3300031852 | Bacteria | 1075 |
| 198 | Ga0307410_10445461 | 3300031852 | Bacteria | 1055 |
| 199 | Ga0307410_10767446 | 3300031852 | Bacteria | 818 |
| 200 | Ga0307406_10267398 | 3300031901 | Bacteria | 1297 |
| 201 | Ga0307406_10291989 | 3300031901 | Bacteria | 1248 |
| 202 | Ga0307406_10373819 | 3300031901 | Bacteria | 1121 |
| 203 | Ga0307406_10692560 | 3300031901 | Bacteria | 850 |
| 204 | Ga0307406_10705506 | 3300031901 | Bacteria | 843 |
| 205 | Ga0307406_10732397 | 3300031901 | Bacteria | 828 |
| 206 | Ga0307407_10047195 | 3300031903 | Bacteria | 2442 |
| 207 | Ga0307407_10128678 | 3300031903 | Bacteria | 1616 |
| 208 | Ga0307407_10160237 | 3300031903 | Bacteria | 1472 |
| 209 | Ga0307407_10172648 | 3300031903 | Bacteria | 1425 |
| 210 | Ga0307407_10735020 | 3300031903 | Bacteria | 746 |
| 211 | Ga0307412_10065506 | 3300031911 | Bacteria | 2459 |
| 212 | Ga0307412_10764919 | 3300031911 | Bacteria | 835 |
| 213 | Ga0307412_11240780 | 3300031911 | Bacteria | 669 |
| 214 | Ga0307409_100036827 | 3300031995 | Bacteria | 3600 |
| 215 | Ga0307409_100179591 | 3300031995 | Bacteria | 1872 |
| 216 | Ga0307409_100181839 | 3300031995 | Bacteria | 1862 |
| 217 | Ga0307409_100240214 | 3300031995 | Bacteria | 1648 |
| 218 | Ga0307409_100385173 | 3300031995 | Bacteria | 1334 |
| 219 | Ga0307409_100458516 | 3300031995 | Bacteria | 1232 |
| 220 | Ga0307409_100547380 | 3300031995 | Bacteria | 1135 |
| 221 | Ga0307409_100737882 | 3300031995 | Bacteria | 987 |
| 222 | Ga0307409_100968271 | 3300031995 | Bacteria | 867 |
| 223 | Ga0307409_101177122 | 3300031995 | Bacteria | 789 |
| 224 | Ga0307409_101535960 | 3300031995 | Bacteria | 693 |
| 225 | Ga0307409_101773125 | 3300031995 | Bacteria | 646 |
| 226 | Ga0307416_100003197 | 3300032002 | Bacteria | 9599 |
| 227 | Ga0307416_100092040 | 3300032002 | Bacteria | 2607 |
| 228 | Ga0307416_100100785 | 3300032002 | Bacteria | 2513 |
| 229 | Ga0307416_100123286 | 3300032002 | Bacteria | 2315 |
| 230 | Ga0307416_100140270 | 3300032002 | Bacteria | 2195 |
| 231 | Ga0307416_100178411 | 3300032002 | Bacteria | 1988 |
| 232 | Ga0307416_100253424 | 3300032002 | Bacteria | 1715 |
| 233 | Ga0307416_100308225 | 3300032002 | Bacteria | 1578 |
| 234 | Ga0307416_100479771 | 3300032002 | Bacteria | 1303 |
| 235 | Ga0307416_100497885 | 3300032002 | Bacteria | 1282 |
| 236 | Ga0307416_100701667 | 3300032002 | Bacteria | 1101 |
| 237 | Ga0307416_101016776 | 3300032002 | Bacteria | 932 |
| 238 | Ga0307416_101062947 | 3300032002 | Bacteria | 913 |
| 239 | Ga0307416_101855085 | 3300032002 | Bacteria | 706 |
| 240 | Ga0307414_10060528 | 3300032004 | Bacteria | 2678 |
| 241 | Ga0307414_10333273 | 3300032004 | Bacteria | 1296 |
| 242 | Ga0307414_10434788 | 3300032004 | Bacteria | 1147 |
| 243 | Ga0307414_10473386 | 3300032004 | Bacteria | 1103 |
| 244 | Ga0307414_11158294 | 3300032004 | Bacteria | 715 |
| 245 | Ga0307411_10056805 | 3300032005 | Bacteria | 2582 |
| 246 | Ga0307411_10123563 | 3300032005 | Bacteria | 1878 |
| 247 | Ga0307411_10420902 | 3300032005 | Bacteria | 1110 |
| 248 | Ga0307411_10522803 | 3300032005 | Bacteria | 1007 |
| 249 | Ga0307411_11203638 | 3300032005 | Bacteria | 687 |
| 250 | Ga0307411_11289614 | 3300032005 | Bacteria | 665 |
| 251 | Ga0307415_100005224 | 3300032126 | Bacteria | 6866 |
| 252 | Ga0307415_100265345 | 3300032126 | Bacteria | 1403 |
| 253 | Ga0307415_100395372 | 3300032126 | Bacteria | 1178 |
| 254 | Ga0307415_100445078 | 3300032126 | Bacteria | 1118 |
| 255 | Ga0307415_100560223 | 3300032126 | Bacteria | 1010 |
| 256 | Ga0307415_100660825 | 3300032126 | Bacteria | 938 |
| 257 | Ga0307415_100667254 | 3300032126 | Bacteria | 934 |
| 258 | Ga0307415_100671458 | 3300032126 | Bacteria | 931 |
| 259 | Ga0307415_100867709 | 3300032126 | Bacteria | 829 |
| 260 | Ga0307415_101398833 | 3300032126 | Bacteria | 666 |
| 261 | Ga0373926_0001692 | 3300035083 | Bacteria | 6830 |
| 262 | Ga0373943_0444405 | 3300035170 | Bacteria | 753 |
| 263 | Ga0316574_0014859 | 3300035398 | Bacteria | 4508 |
| 264 | Ga0316574_0208763 | 3300035398 | Bacteria | 1253 |
| 265 | Ga0373935_0000278 | 3300035692 | Bacteria | 25233 |
| 266 | Ga0373947_0000136 | 3300035725 | Bacteria | 37955 |
| 267 | Ga0373947_0732181 | 3300035725 | Bacteria | 675 |
| 268 | Ga0373937_0665064 | 3300036401 | Bacteria | 987 |
| 269 | Ga0395899_0167397 | 3300037312 | Bacteria | 1550 |
| 270 | Ga0395898_0037858 | 3300037466 | Bacteria | 4782 |
| 271 | Ga0436364_1325333 | 3300037853 | Bacteria | 1004 |
| 272 | Ga0395901_0104103 | 3300038443 | Bacteria | 2978 |
| 273 | Ga0395901_0473794 | 3300038443 | Bacteria | 1278 |
| 274 | Ga0436361_0652110 | 3300039447 | Bacteria | 2789 |
| 275 | Ga0436363_1155040 | 3300039450 | Bacteria | 1113 |
| 276 | Ga0436362_0137809 | 3300039453 | Bacteria | 1035 |
| 277 | Ga0439461_0043562 | 3300041410 | Bacteria | 976 |
| 278 | Ga0451787_549090 | 3300041441 | Bacteria | 1136 |
| 279 | Ga0451789_1142045 | 3300041443 | Bacteria | 735 |
| 280 | Ga0451793_0224190 | 3300041452 | Bacteria | 724 |
| 281 | Ga0451793_0962940 | 3300041452 | Bacteria | 1970 |
| 282 | Ga0451795_1166415 | 3300041456 | Bacteria | 762 |
| 283 | Ga0451800_0207950 | 3300041459 | Bacteria | 742 |
| 284 | Ga0451800_1364876 | 3300041459 | Bacteria | 853 |
| 285 | Ga0451837_1040030 | 3300041494 | Bacteria | 927 |
| 286 | Ga0451841_1386162 | 3300041498 | Bacteria | 755 |
| 287 | Ga0451851_0366045 | 3300041507 | Bacteria | 993 |
| 288 | Ga0451843_0459762 | 3300041509 | Bacteria | 993 |
| 289 | Ga0451853_1602591 | 3300041512 | Bacteria | 691 |
| 290 | Ga0439445_0055606 | 3300042004 | Bacteria | 1075 |
| 291 | Ga0439448_0057739 | 3300042005 | Bacteria | 1279 |
| 292 | Ga0439450_022778 | 3300042008 | Bacteria | 1355 |
| 293 | Ga0439452_050179 | 3300042010 | Bacteria | 958 |
| 294 | Ga0439455_0057625 | 3300042012 | Bacteria | 1025 |
| 295 | Ga0439463_015096 | 3300042016 | Bacteria | 1909 |
| 296 | Ga0439463_079215 | 3300042016 | Bacteria | 844 |
| 297 | Ga0450922_004121 | 3300042124 | Bacteria | 1336 |
| 298 | Ga0450923_035399 | 3300042125 | Bacteria | 1033 |
| 299 | Ga0450908_028099 | 3300042184 | Bacteria | 980 |
| 300 | Ga0466969_0004631 | 3300044656 | Bacteria | 7327 |
| 301 | Ga0466969_0112689 | 3300044656 | Bacteria | 1272 |
| 302 | Ga0466965_0317054 | 3300044683 | Bacteria | 849 |
| 303 | Ga0466966_0063019 | 3300044684 | Bacteria | 2337 |
| 304 | Ga0466966_0152840 | 3300044684 | Bacteria | 1407 |
| 305 | Ga0466961_0039817 | 3300044693 | Bacteria | 3012 |
| 306 | Ga0466961_0095403 | 3300044693 | Bacteria | 1876 |
| 307 | Ga0466961_0163385 | 3300044693 | Bacteria | 1387 |
| 308 | Ga0466961_0533095 | 3300044693 | Bacteria | 708 |
| 309 | Ga0466963_0263200 | 3300044694 | Bacteria | 1211 |
| 310 | Ga0466971_0226158 | 3300044719 | Bacteria | 888 |
| 311 | Ga0466957_0256653 | 3300044842 | Bacteria | 1164 |
| 312 | Ga0466960_0077785 | 3300044901 | Bacteria | 1665 |
| 313 | Ga0466960_0117983 | 3300044901 | Bacteria | 1387 |
| 314 | Ga0466960_0142913 | 3300044901 | Bacteria | 1272 |
| 315 | Ga0466960_0210291 | 3300044901 | Bacteria | 1066 |
| 316 | Ga0466960_0283384 | 3300044901 | Bacteria | 929 |
| 317 | Ga0466960_0342548 | 3300044901 | Bacteria | 851 |
| 318 | Ga0466960_0500593 | 3300044901 | Bacteria | 712 |
| 319 | Ga0466959_0075447 | 3300045049 | Bacteria | 2436 |
| 320 | Ga0466959_0090991 | 3300045049 | Bacteria | 2191 |
| 321 | Ga0466958_0076736 | 3300045836 | Bacteria | 2052 |
| 322 | Ga0466958_0080626 | 3300045836 | Bacteria | 2002 |
| 323 | Ga0466958_0126741 | 3300045836 | Bacteria | 1601 |
| 324 | Ga0466967_0004977 | 3300045976 | Bacteria | 9095 |
| 325 | Ga0466967_1205748 | 3300045976 | Bacteria | 754 |
| 326 | Ga0495603_0002275 | 3300046455 | Bacteria | 11277 |
| 327 | Ga0495603_0082633 | 3300046455 | Bacteria | 1881 |
| 328 | Ga0495590_0000112 | 3300046457 | Bacteria | 49282 |
| 329 | Ga0495629_0015161 | 3300046459 | Bacteria | 5540 |
| 330 | Ga0495629_0358022 | 3300046459 | Bacteria | 995 |
| 331 | Ga0495638_0086541 | 3300046460 | Bacteria | 1894 |
| 332 | Ga0495580_0010772 | 3300046472 | Bacteria | 7102 |
| 333 | Ga0495582_0255634 | 3300046473 | Bacteria | 1005 |
| 334 | Ga0495605_0015478 | 3300046474 | Bacteria | 4147 |
| 335 | Ga0495639_0069738 | 3300046475 | Bacteria | 1622 |
| 336 | Ga0495585_0126130 | 3300046492 | Bacteria | 1350 |
| 337 | Ga0495594_0059235 | 3300046499 | Bacteria | 2117 |
| 338 | Ga0495607_0053087 | 3300046501 | Bacteria | 2344 |
| 339 | Ga0495606_0004553 | 3300046507 | Bacteria | 13778 |
| 340 | Ga0495620_0005950 | 3300046515 | Bacteria | 6758 |
| 341 | Ga0495620_0217455 | 3300046515 | Bacteria | 732 |
| 342 | Ga0495630_0160473 | 3300046517 | Bacteria | 1712 |
| 343 | Ga0495631_0148127 | 3300046518 | Bacteria | 1007 |
| 344 | Ga0495631_0222977 | 3300046518 | Bacteria | 805 |
| 345 | Ga0495648_0035820 | 3300046524 | Bacteria | 3212 |
| 346 | Ga0495586_0203512 | 3300046535 | Bacteria | 1123 |
| 347 | Ga0495621_0348645 | 3300046539 | Bacteria | 621 |
| 348 | Ga0495597_0073708 | 3300046542 | Bacteria | 1467 |
| 349 | Ga0495667_0818660 | 3300046559 | Bacteria | 574 |
| 350 | Ga0495668_0039199 | 3300046616 | Bacteria | 2645 |
| 351 | Ga0495625_0011064 | 3300046660 | Bacteria | 7394 |
| 352 | Ga0495588_0058569 | 3300046674 | Bacteria | 1991 |
| 353 | Ga0495613_0011252 | 3300046689 | Bacteria | 6648 |
| 354 | Ga0495670_0057930 | 3300046691 | Bacteria | 1945 |
| 355 | Ga0495671_0228084 | 3300046692 | Bacteria | 901 |
| 356 | Ga0495649_0074825 | 3300046694 | Bacteria | 1814 |
| 357 | Ga0495589_0012642 | 3300046794 | Bacteria | 4366 |
| 358 | Ga0495589_0181471 | 3300046794 | Bacteria | 998 |
| 359 | Ga0495600_0087006 | 3300046809 | Bacteria | 2039 |
| 360 | Ga0495660_0091018 | 3300046810 | Bacteria | 1585 |
| 361 | Ga0495581_0192400 | 3300047315 | Bacteria | 1193 |
| 362 | Ga0495581_0374820 | 3300047315 | Bacteria | 830 |
| 363 | Ga0495604_0747066 | 3300047317 | Bacteria | 619 |
| 364 | Ga0495636_0003098 | 3300047318 | Bacteria | 6452 |
| 365 | Ga0495636_0189082 | 3300047318 | Bacteria | 937 |
| 366 | Ga0495636_0264750 | 3300047318 | Bacteria | 798 |
| 367 | Ga0495672_0052841 | 3300047320 | Bacteria | 2384 |
| 368 | Ga0495680_0394326 | 3300047322 | Bacteria | 957 |
| 369 | Ga0495683_0020245 | 3300047323 | Bacteria | 3433 |
| 370 | Ga0495687_007595 | 3300047443 | Bacteria | 6352 |
| 371 | Ga0495675_0073946 | 3300047444 | Bacteria | 2148 |
| 372 | Ga0495685_003755 | 3300047447 | Bacteria | 4863 |
| 373 | Ga0495685_026502 | 3300047447 | Bacteria | 1994 |
| 374 | Ga0495626_0018072 | 3300048091 | Bacteria | 3549 |
| 375 | Ga0496100_0805052 | 3300048903 | Bacteria | 736 |
| 376 | Ga0496102_0056141 | 3300048905 | Bacteria | 3592 |
| 377 | Ga0496102_1053103 | 3300048905 | Bacteria | 733 |
| 378 | Ga0496103_0012286 | 3300048906 | Bacteria | 5082 |
| 379 | Ga0496104_0864873 | 3300048907 | Unclassified | 809 |
| 380 | Ga0496104_0912106 | 3300048907 | Bacteria | 783 |
| 381 | Ga0496105_0207796 | 3300048908 | Bacteria | 1597 |
| 382 | Ga0496105_0884542 | 3300048908 | Bacteria | 674 |
| 383 | Ga0496107_0556766 | 3300048910 | Bacteria | 849 |
| 384 | Ga0496108_0267270 | 3300048911 | Bacteria | 1489 |
| 385 | Ga0496109_0023286 | 3300048912 | Bacteria | 5495 |
| 386 | Ga0496109_0030226 | 3300048912 | Bacteria | 4856 |
| 387 | Ga0496109_0055416 | 3300048912 | Bacteria | 3617 |
| 388 | Ga0496109_0394343 | 3300048912 | Bacteria | 1308 |
| 389 | Ga0496110_0850095 | 3300048913 | Bacteria | 818 |
| 390 | Ga0496110_1113405 | 3300048913 | Bacteria | 698 |
| 391 | Ga0496111_0375733 | 3300048914 | Bacteria | 1051 |
| 392 | Ga0496111_0547442 | 3300048914 | Bacteria | 850 |
| 393 | Ga0496111_0853267 | 3300048914 | Bacteria | 657 |
| 394 | Ga0496112_0059405 | 3300048915 | Bacteria | 3767 |
| 395 | Ga0496112_0478546 | 3300048915 | Bacteria | 1182 |
| 396 | Ga0496114_0118084 | 3300048917 | Bacteria | 2279 |
| 397 | Ga0496114_0524931 | 3300048917 | Bacteria | 1047 |
| 398 | Ga0496114_1558138 | 3300048917 | Unclassified | 549 |
| 399 | Ga0496115_0619421 | 3300048918 | Bacteria | 859 |
| 400 | Ga0496119_0467158 | 3300048922 | Bacteria | 592 |
| 401 | Ga0501031_0050716 | 3300049568 | Bacteria | 2703 |
| 402 | Ga0501031_0059409 | 3300049568 | Bacteria | 2492 |
| 403 | Ga0501031_0103102 | 3300049568 | Bacteria | 1862 |
| 404 | Ga0501031_0112138 | 3300049568 | Bacteria | 1781 |
| 405 | Ga0501031_0261428 | 3300049568 | Bacteria | 1124 |
| 406 | Ga0501031_0720943 | 3300049568 | Unclassified | 640 |
| 407 | Ga0501033_0200420 | 3300049570 | Bacteria | 1426 |
| 408 | Ga0501033_0208721 | 3300049570 | Bacteria | 1393 |
| 409 | Ga0501034_0226810 | 3300049571 | Bacteria | 1819 |
| 410 | Ga0501036_0055433 | 3300049572 | Bacteria | 3358 |
| 411 | Ga0501036_0086257 | 3300049572 | Bacteria | 2654 |
| 412 | Ga0501036_0141445 | 3300049572 | Bacteria | 2030 |
| 413 | Ga0501036_0150204 | 3300049572 | Bacteria | 1965 |
| 414 | Ga0501036_0239418 | 3300049572 | Bacteria | 1522 |
| 415 | Ga0501038_0026164 | 3300049574 | Bacteria | 5198 |
| 416 | Ga0501038_0096659 | 3300049574 | Bacteria | 2465 |
| 417 | Ga0501038_0378476 | 3300049574 | Bacteria | 1098 |
| 418 | Ga0501039_0022657 | 3300049575 | Bacteria | 4820 |
| 419 | Ga0501039_0051810 | 3300049575 | Bacteria | 3175 |
| 420 | Ga0501040_0000429 | 3300049576 | Bacteria | 24927 |
| 421 | Ga0501040_0081071 | 3300049576 | Bacteria | 2248 |
| 422 | Ga0501040_0170325 | 3300049576 | Bacteria | 1542 |
| 423 | Ga0501040_0633312 | 3300049576 | Bacteria | 773 |
| 424 | Ga0501040_1042007 | 3300049576 | Bacteria | 593 |
| 425 | Ga0501041_0106882 | 3300049577 | Bacteria | 1734 |
| 426 | Ga0501041_0177306 | 3300049577 | Bacteria | 1334 |
| 427 | Ga0501041_0568275 | 3300049577 | Bacteria | 723 |
| 428 | Ga0501041_0570396 | 3300049577 | Bacteria | 722 |
| 429 | Ga0501042_0042064 | 3300049578 | Bacteria | 3251 |
| 430 | Ga0501042_0099354 | 3300049578 | Bacteria | 2092 |
| 431 | Ga0501042_0311360 | 3300049578 | Bacteria | 1137 |
| 432 | Ga0501042_0689780 | 3300049578 | Bacteria | 743 |
| 433 | Ga0501043_0465306 | 3300049579 | Bacteria | 948 |
| 434 | Ga0501046_0057695 | 3300049580 | Bacteria | 3045 |
| 435 | Ga0501046_0165066 | 3300049580 | Bacteria | 1664 |
| 436 | Ga0501046_0389516 | 3300049580 | Bacteria | 1008 |
| 437 | Ga0501048_0040709 | 3300049582 | Bacteria | 3328 |
| 438 | Ga0501048_0271530 | 3300049582 | Bacteria | 1205 |
| 439 | Ga0501048_0301713 | 3300049582 | Bacteria | 1139 |
| 440 | Ga0501048_0431646 | 3300049582 | Bacteria | 943 |
| 441 | Ga0501048_0654832 | 3300049582 | Bacteria | 754 |
| 442 | Ga0501068_0158315 | 3300049584 | Bacteria | 1426 |
| 443 | Ga0501068_0231984 | 3300049584 | Bacteria | 1174 |
| 444 | Ga0501068_0235234 | 3300049584 | Bacteria | 1165 |
| 445 | Ga0501068_0754039 | 3300049584 | Bacteria | 637 |
| 446 | Ga0501069_0366341 | 3300049585 | Bacteria | 850 |
| 447 | Ga0501070_0615180 | 3300049586 | Bacteria | 865 |
| 448 | Ga0501070_1029977 | 3300049586 | Bacteria | 637 |
| 449 | Ga0501071_0008764 | 3300049587 | Bacteria | 6699 |
| 450 | Ga0501071_0021303 | 3300049587 | Bacteria | 4512 |
| 451 | Ga0501071_0021699 | 3300049587 | Bacteria | 4476 |
| 452 | Ga0501071_0320125 | 3300049587 | Bacteria | 1178 |
| 453 | Ga0501071_0354881 | 3300049587 | Bacteria | 1116 |
| 454 | Ga0501071_0455213 | 3300049587 | Bacteria | 980 |
| 455 | Ga0501071_0523315 | 3300049587 | Bacteria | 910 |
| 456 | Ga0501072_0021389 | 3300049588 | Bacteria | 5016 |
| 457 | Ga0501072_0146444 | 3300049588 | Bacteria | 1883 |
| 458 | Ga0501072_0281294 | 3300049588 | Bacteria | 1323 |
| 459 | Ga0501072_1094664 | 3300049588 | Bacteria | 620 |
| 460 | Ga0501072_1384853 | 3300049588 | Bacteria | 544 |
| 461 | Ga0501073_0365137 | 3300049589 | Bacteria | 997 |
| 462 | Ga0501073_0555275 | 3300049589 | Bacteria | 793 |
| 463 | Ga0501074_0079596 | 3300049590 | Bacteria | 2351 |
| 464 | Ga0501074_0122251 | 3300049590 | Bacteria | 1862 |
| 465 | Ga0501074_0256989 | 3300049590 | Bacteria | 1242 |
| 466 | Ga0501074_0386026 | 3300049590 | Bacteria | 993 |
| 467 | Ga0501074_0859705 | 3300049590 | Bacteria | 639 |
| 468 | Ga0501075_0006078 | 3300049591 | Bacteria | 8287 |
| 469 | Ga0501075_0138055 | 3300049591 | Bacteria | 1857 |
| 470 | Ga0501075_0148403 | 3300049591 | Bacteria | 1787 |
| 471 | Ga0501075_0427728 | 3300049591 | Bacteria | 1010 |
| 472 | Ga0501075_0732751 | 3300049591 | Bacteria | 753 |
| 473 | Ga0501076_0034231 | 3300049592 | Bacteria | 3970 |
| 474 | Ga0501076_0068687 | 3300049592 | Bacteria | 2830 |
| 475 | Ga0501076_0180211 | 3300049592 | Bacteria | 1722 |
| 476 | Ga0501076_0183271 | 3300049592 | Bacteria | 1707 |
| 477 | Ga0501076_0371691 | 3300049592 | Bacteria | 1175 |
| 478 | Ga0501076_0385712 | 3300049592 | Bacteria | 1151 |
| 479 | Ga0501077_0013071 | 3300049593 | Bacteria | 5202 |
| 480 | Ga0501077_0114897 | 3300049593 | Bacteria | 1706 |
| 481 | Ga0501202_071065 | 3300049652 | Bacteria | 802 |
| 482 | Ga0501206_048647 | 3300049653 | Unclassified | 670 |
| 483 | Ga0501235_041728 | 3300049669 | Bacteria | 1050 |
| 484 | Ga0501243_043345 | 3300049675 | Unclassified | 796 |
| 485 | Ga0501259_031684 | 3300049688 | Bacteria | 1001 |
| 486 | Ga0501079_0008126 | 3300049741 | Bacteria | 7951 |
| 487 | Ga0501079_0039712 | 3300049741 | Bacteria | 3630 |
| 488 | Ga0501079_0073851 | 3300049741 | Bacteria | 2636 |
| 489 | Ga0501079_0141407 | 3300049741 | Bacteria | 1875 |
| 490 | Ga0501079_0370696 | 3300049741 | Bacteria | 1122 |
| 491 | Ga0501079_1228796 | 3300049741 | Bacteria | 590 |
| 492 | Ga0501080_0425015 | 3300049742 | Bacteria | 1193 |
| 493 | Ga0501080_0707742 | 3300049742 | Bacteria | 888 |
| 494 | Ga0501081_0001404 | 3300049743 | Bacteria | 14703 |
| 495 | Ga0501081_0037648 | 3300049743 | Bacteria | 3301 |
| 496 | Ga0501081_0254533 | 3300049743 | Bacteria | 1282 |
| 497 | Ga0501081_0449938 | 3300049743 | Bacteria | 957 |
| 498 | Ga0501081_0494872 | 3300049743 | Bacteria | 911 |
| 499 | Ga0501083_0016786 | 3300049744 | Bacteria | 5114 |
| 500 | Ga0501083_0350070 | 3300049744 | Bacteria | 960 |
| 501 | Ga0501083_0610988 | 3300049744 | Bacteria | 709 |
| 502 | Ga0501035_0234982 | 3300049822 | Bacteria | 1561 |
| 503 | Ga0501035_0277611 | 3300049822 | Bacteria | 1417 |
| 504 | Ga0501035_0510845 | 3300049822 | Bacteria | 988 |
| 505 | Ga0501035_0838615 | 3300049822 | Bacteria | 732 |
| 506 | Ga0501045_0006422 | 3300049824 | Bacteria | 8142 |
| 507 | Ga0501045_0007208 | 3300049824 | Bacteria | 7716 |
| 508 | Ga0501045_0035562 | 3300049824 | Bacteria | 3617 |
| 509 | Ga0501045_0157872 | 3300049824 | Bacteria | 1688 |
| 510 | Ga0501045_0319334 | 3300049824 | Bacteria | 1156 |
| 511 | Ga0501045_0561058 | 3300049824 | Bacteria | 847 |
| 512 | Ga0501045_0789614 | 3300049824 | Bacteria | 699 |
| 513 | nmdc:mga03683_117605_c1 | 3300050489 | Bacteria | 1179 |
| 514 | nmdc:mga03683_79908_c1 | 3300050489 | Bacteria | 1410 |
| 515 | nmdc:mga03n38_184285_c1 | 3300050490 | Bacteria | 1071 |
| 516 | nmdc:mga00v17_141498_c1 | 3300050491 | Bacteria | 1543 |
| 517 | nmdc:mga00v17_213613_c1 | 3300050491 | Bacteria | 1248 |
| 518 | nmdc:mga00v17_9656_c1 | 3300050491 | Bacteria | 5233 |
| 519 | nmdc:mga0yw44_160355_c1 | 3300050492 | Bacteria | 1472 |
| 520 | nmdc:mga0yw44_203728_c1 | 3300050492 | Unclassified | 1307 |
| 521 | nmdc:mga06z11_524334_c1 | 3300050494 | Bacteria | 718 |
| 522 | nmdc:mga05p37_1630028_c1 | 3300050507 | Bacteria | 634 |
| 523 | nmdc:mga06r32_1113227_c1 | 3300050510 | Bacteria | 738 |
| 524 | nmdc:mga08y16_371075_c1 | 3300050511 | Bacteria | 1468 |
| 525 | nmdc:mga08x19_1145068_c1 | 3300050514 | Bacteria | 552 |
| 526 | Ga0500635_0039400 | 3300053080 | Bacteria | 1571 |
| 527 | Ga0495595_0429408 | 3300053084 | Bacteria | 671 |
| 528 | Ga0495619_0120372 | 3300053085 | Bacteria | 1800 |
| 529 | Ga0500616_0030836 | 3300053153 | Bacteria | 2941 |
| 530 | Ga0501084_0005527 | 3300054114 | Bacteria | 10376 |
| 531 | Ga0501084_0034334 | 3300054114 | Bacteria | 4241 |
| 532 | Ga0501084_0107045 | 3300054114 | Bacteria | 2349 |
| 533 | Ga0501084_0503513 | 3300054114 | Bacteria | 1024 |
| 534 | Ga0501084_0609646 | 3300054114 | Bacteria | 922 |
| 535 | Ga0501084_0905483 | 3300054114 | Bacteria | 742 |
| 536 | Ga0501082_0118867 | 3300060353 | Bacteria | 2290 |
| 537 | Ga0501082_0272324 | 3300060353 | Bacteria | 1473 |
| 538 | Ga0501082_0325337 | 3300060353 | Bacteria | 1339 |
| 539 | Ga0501082_0397283 | 3300060353 | Bacteria | 1203 |
| 540 | Ga0530510_0021411 | 3300061734 | Bacteria | 4600 |
| 541 | Ga0530510_0083707 | 3300061734 | Bacteria | 2323 |
| 542 | Ga0530510_0124708 | 3300061734 | Bacteria | 1892 |
| 543 | Ga0530510_0218986 | 3300061734 | Bacteria | 1415 |
| 544 | Ga0530510_0375734 | 3300061734 | Bacteria | 1069 |
| 545 | Ga0530510_0731152 | 3300061734 | Bacteria | 754 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044684 | Ga0466966_0152840 | Ga0466966_0152840_990_1388 | 132 |
| 2 | 3300050494 | nmdc:mga06z11_524334_c1 | nmdc:mga06z11_524334_c1_144_599 | 134 |
| 3 | 3300006177 | Ga0075362_10388193 | Ga0075362_103881932 | 138 |
| 4 | 3300049576 | Ga0501040_0000429 | Ga0501040_0000429_9131_9613 | 139 |
| 5 | 3300049582 | Ga0501048_0040709 | Ga0501048_0040709_25_507 | 139 |
| 6 | 3300049586 | Ga0501070_1029977 | Ga0501070_1029977_21_503 | 139 |
| 7 | 3300049587 | Ga0501071_0008764 | Ga0501071_0008764_5851_6333 | 139 |
| 8 | 3300049590 | Ga0501074_0122251 | Ga0501074_0122251_115_597 | 139 |
| 9 | 3300049591 | Ga0501075_0006078 | Ga0501075_0006078_7414_7896 | 139 |
| 10 | 3300049592 | Ga0501076_0068687 | Ga0501076_0068687_20_502 | 139 |
| 11 | 3300049593 | Ga0501077_0013071 | Ga0501077_0013071_414_896 | 139 |
| 12 | 3300049741 | Ga0501079_0008126 | Ga0501079_0008126_7412_7894 | 139 |
| 13 | 3300049743 | Ga0501081_0001404 | Ga0501081_0001404_513_995 | 139 |
| 14 | 3300049744 | Ga0501083_0016786 | Ga0501083_0016786_4368_4850 | 139 |
| 15 | 3300049822 | Ga0501035_0277611 | Ga0501035_0277611_817_1299 | 139 |
| 16 | 3300049824 | Ga0501045_0006422 | Ga0501045_0006422_31_513 | 139 |
| 17 | 3300054114 | Ga0501084_0005527 | Ga0501084_0005527_9573_10055 | 139 |
| 18 | 3300031548 | Ga0307408_100274585 | Ga0307408_1002745852 | 140 |
| 19 | 3300049574 | Ga0501038_0026164 | Ga0501038_0026164_4577_5059 | 141 |
| 20 | 3300005614 | Ga0068856_100146167 | Ga0068856_1001461672 | 142 |
| 21 | 3300013105 | Ga0157369_10328917 | Ga0157369_103289173 | 142 |
| 22 | 3300026078 | Ga0207702_10186458 | Ga0207702_101864582 | 142 |
| 23 | 3300049576 | Ga0501040_0633312 | Ga0501040_0633312_19_501 | 142 |
| 24 | 3300049675 | Ga0501243_043345 | Ga0501243_043345_76_558 | 143 |
| 25 | 3300050489 | nmdc:mga03683_79908_c1 | nmdc:mga03683_79908_c1_968_1399 | 143 |
| 26 | 3300006048 | Ga0075363_100053183 | Ga0075363_1000531834 | 144 |
| 27 | 3300042016 | Ga0439463_079215 | Ga0439463_079215_145_606 | 144 |
| 28 | 3300048912 | Ga0496109_0055416 | Ga0496109_0055416_2989_3450 | 144 |
| 29 | 3300050490 | nmdc:mga03n38_184285_c1 | nmdc:mga03n38_184285_c1_471_926 | 144 |
| 30 | 3300046457 | Ga0495590_0000112 | Ga0495590_0000112_37202_37684 | 145 |
| 31 | 3300048913 | Ga0496110_1113405 | Ga0496110_1113405_168_653 | 149 |
| 32 | 3300049584 | Ga0501068_0158315 | Ga0501068_0158315_382_870 | 149 |
| 33 | 3300049585 | Ga0501069_0366341 | Ga0501069_0366341_197_685 | 149 |
| 34 | 3300049589 | Ga0501073_0555275 | Ga0501073_0555275_156_644 | 149 |
| 35 | 3300054114 | Ga0501084_0503513 | Ga0501084_0503513_472_960 | 149 |
| 36 | 3300005347 | Ga0070668_100489661 | Ga0070668_1004896611 | 152 |
| 37 | 3300005548 | Ga0070665_100435049 | Ga0070665_1004350492 | 152 |
| 38 | 3300006038 | Ga0075365_10070251 | Ga0075365_100702512 | 152 |
| 39 | 3300006048 | Ga0075363_100862288 | Ga0075363_1008622881 | 152 |
| 40 | 3300006051 | Ga0075364_10091485 | Ga0075364_100914853 | 152 |
| 41 | 3300006177 | Ga0075362_10069206 | Ga0075362_100692062 | 152 |
| 42 | 3300009177 | Ga0105248_12022493 | Ga0105248_120224931 | 152 |
| 43 | 3300013306 | Ga0163162_11378844 | Ga0163162_113788442 | 152 |
| 44 | 3300013308 | Ga0157375_11467249 | Ga0157375_114672491 | 152 |
| 45 | 3300014325 | Ga0163163_11508589 | Ga0163163_115085892 | 152 |
| 46 | 3300014326 | Ga0157380_11122588 | Ga0157380_111225881 | 152 |
| 47 | 3300031852 | Ga0307410_10767446 | Ga0307410_107674461 | 152 |
| 48 | 3300032005 | Ga0307411_10420902 | Ga0307411_104209022 | 152 |
| 49 | 3300032126 | Ga0307415_100667254 | Ga0307415_1006672542 | 152 |
| 50 | 3300041410 | Ga0439461_0043562 | Ga0439461_0043562_368_826 | 152 |
| 51 | 3300041459 | Ga0451800_0207950 | Ga0451800_0207950_16_474 | 152 |
| 52 | 3300041507 | Ga0451851_0366045 | Ga0451851_0366045_275_733 | 152 |
| 53 | 3300042008 | Ga0439450_022778 | Ga0439450_022778_310_768 | 152 |
| 54 | 3300042012 | Ga0439455_0057625 | Ga0439455_0057625_145_603 | 152 |
| 55 | 3300042016 | Ga0439463_015096 | Ga0439463_015096_982_1440 | 152 |
| 56 | 3300042124 | Ga0450922_004121 | Ga0450922_004121_742_1200 | 152 |
| 57 | 3300042125 | Ga0450923_035399 | Ga0450923_035399_52_510 | 152 |
| 58 | 3300042184 | Ga0450908_028099 | Ga0450908_028099_190_648 | 152 |
| 59 | 3300048908 | Ga0496105_0207796 | Ga0496105_0207796_1126_1584 | 152 |
| 60 | 3300048914 | Ga0496111_0375733 | Ga0496111_0375733_372_830 | 152 |
| 61 | 3300048917 | Ga0496114_0118084 | Ga0496114_0118084_1442_1900 | 152 |
| 62 | 3300049582 | Ga0501048_0654832 | Ga0501048_0654832_103_561 | 152 |
| 63 | 3300050489 | nmdc:mga03683_117605_c1 | nmdc:mga03683_117605_c1_65_523 | 152 |
| 64 | 3300050491 | nmdc:mga00v17_213613_c1 | nmdc:mga00v17_213613_c1_321_779 | 152 |
| 65 | 3300050492 | nmdc:mga0yw44_203728_c1 | nmdc:mga0yw44_203728_c1_76_534 | 152 |
| 66 | iso_pu_bacteria | 2857737099 | 2857737895 | 152 |
| 67 | 3300042005 | Ga0439448_0057739 | Ga0439448_0057739_97_558 | 153 |
| 68 | 3300049568 | Ga0501031_0720943 | Ga0501031_0720943_12_509 | 153 |
| 69 | 3300049822 | Ga0501035_0838615 | Ga0501035_0838615_72_569 | 153 |
| 70 | 3300009036 | Ga0105244_10065079 | Ga0105244_100650792 | 154 |
| 71 | 3300013297 | Ga0157378_10036310 | Ga0157378_100363104 | 154 |
| 72 | 3300046472 | Ga0495580_0010772 | Ga0495580_0010772_6097_6567 | 154 |
| 73 | 3300047320 | Ga0495672_0052841 | Ga0495672_0052841_1817_2284 | 154 |
| 74 | 3300048905 | Ga0496102_0056141 | Ga0496102_0056141_2572_3042 | 154 |
| 75 | 3300048906 | Ga0496103_0012286 | Ga0496103_0012286_3861_4331 | 154 |
| 76 | 3300048915 | Ga0496112_0059405 | Ga0496112_0059405_2357_2827 | 154 |
| 77 | 3300049568 | Ga0501031_0112138 | Ga0501031_0112138_162_626 | 154 |
| 78 | 3300049572 | Ga0501036_0055433 | Ga0501036_0055433_1725_2189 | 154 |
| 79 | 3300049577 | Ga0501041_0570396 | Ga0501041_0570396_60_524 | 154 |
| 80 | 3300049578 | Ga0501042_0099354 | Ga0501042_0099354_1523_1987 | 154 |
| 81 | 3300049580 | Ga0501046_0165066 | Ga0501046_0165066_1101_1565 | 154 |
| 82 | 3300049582 | Ga0501048_0271530 | Ga0501048_0271530_722_1186 | 154 |
| 83 | 3300049587 | Ga0501071_0021699 | Ga0501071_0021699_3037_3501 | 154 |
| 84 | 3300049588 | Ga0501072_0021389 | Ga0501072_0021389_1353_1817 | 154 |
| 85 | 3300049590 | Ga0501074_0256989 | Ga0501074_0256989_378_842 | 154 |
| 86 | 3300049592 | Ga0501076_0180211 | Ga0501076_0180211_1042_1506 | 154 |
| 87 | 3300049741 | Ga0501079_0073851 | Ga0501079_0073851_752_1216 | 154 |
| 88 | 3300049742 | Ga0501080_0425015 | Ga0501080_0425015_645_1109 | 154 |
| 89 | 3300049824 | Ga0501045_0035562 | Ga0501045_0035562_2708_3172 | 154 |
| 90 | 3300060353 | Ga0501082_0118867 | Ga0501082_0118867_1210_1674 | 154 |
| 91 | 3300061734 | Ga0530510_0124708 | Ga0530510_0124708_583_1047 | 154 |
| 92 | 3300009098 | Ga0105245_11286302 | Ga0105245_112863021 | 155 |
| 93 | 3300005327 | Ga0070658_11581360 | Ga0070658_115813601 | 156 |
| 94 | 3300005616 | Ga0068852_101605067 | Ga0068852_1016050671 | 156 |
| 95 | 3300005834 | Ga0068851_10537288 | Ga0068851_105372881 | 156 |
| 96 | 3300005937 | Ga0081455_10000854 | Ga0081455_1000085422 | 156 |
| 97 | 3300006051 | Ga0075364_10964164 | Ga0075364_109641641 | 156 |
| 98 | 3300009098 | Ga0105245_10327890 | Ga0105245_103278902 | 156 |
| 99 | 3300013308 | Ga0157375_10813296 | Ga0157375_108132962 | 156 |
| 100 | 3300026142 | Ga0207698_10729708 | Ga0207698_107297082 | 156 |
| 101 | 3300005331 | Ga0070670_100023142 | Ga0070670_1000231423 | 157 |
| 102 | 3300005333 | Ga0070677_10777013 | Ga0070677_107770131 | 157 |
| 103 | 3300005347 | Ga0070668_100569135 | Ga0070668_1005691351 | 157 |
| 104 | 3300005353 | Ga0070669_100006056 | Ga0070669_1000060568 | 157 |
| 105 | 3300005356 | Ga0070674_100609856 | Ga0070674_1006098561 | 157 |
| 106 | 3300005438 | Ga0070701_10016962 | Ga0070701_100169624 | 157 |
| 107 | 3300005444 | Ga0070694_100076508 | Ga0070694_1000765082 | 157 |
| 108 | 3300005456 | Ga0070678_100268701 | Ga0070678_1002687012 | 157 |
| 109 | 3300005457 | Ga0070662_100102755 | Ga0070662_1001027552 | 157 |
| 110 | 3300005459 | Ga0068867_100192663 | Ga0068867_1001926632 | 157 |
| 111 | 3300005577 | Ga0068857_100050641 | Ga0068857_1000506413 | 157 |
| 112 | 3300005615 | Ga0070702_101533048 | Ga0070702_1015330481 | 157 |
| 113 | 3300005719 | Ga0068861_100008205 | Ga0068861_1000082054 | 157 |
| 114 | 3300005844 | Ga0068862_100004865 | Ga0068862_1000048654 | 157 |
| 115 | 3300006058 | Ga0075432_10598061 | Ga0075432_105980611 | 157 |
| 116 | 3300006844 | Ga0075428_100253069 | Ga0075428_1002530692 | 157 |
| 117 | 3300006847 | Ga0075431_101034763 | Ga0075431_1010347631 | 157 |
| 118 | 3300006880 | Ga0075429_100335770 | Ga0075429_1003357702 | 157 |
| 119 | 3300006881 | Ga0068865_100611843 | Ga0068865_1006118431 | 157 |
| 120 | 3300009094 | Ga0111539_10455140 | Ga0111539_104551403 | 157 |
| 121 | 3300009098 | Ga0105245_12046747 | Ga0105245_120467471 | 157 |
| 122 | 3300009148 | Ga0105243_10159647 | Ga0105243_101596472 | 157 |
| 123 | 3300009553 | Ga0105249_10000970 | Ga0105249_100009708 | 157 |
| 124 | 3300013306 | Ga0163162_10134816 | Ga0163162_101348164 | 157 |
| 125 | 3300013308 | Ga0157375_10020155 | Ga0157375_100201556 | 157 |
| 126 | 3300014326 | Ga0157380_10007789 | Ga0157380_100077893 | 157 |
| 127 | 3300017792 | Ga0163161_10129344 | Ga0163161_101293441 | 157 |
| 128 | 3300025908 | Ga0207643_10008413 | Ga0207643_100084136 | 157 |
| 129 | 3300025923 | Ga0207681_10022282 | Ga0207681_100222824 | 157 |
| 130 | 3300025925 | Ga0207650_10028167 | Ga0207650_100281674 | 157 |
| 131 | 3300025926 | Ga0207659_10314976 | Ga0207659_103149761 | 157 |
| 132 | 3300025933 | Ga0207706_10015247 | Ga0207706_100152474 | 157 |
| 133 | 3300025935 | Ga0207709_10221112 | Ga0207709_102211122 | 157 |
| 134 | 3300025937 | Ga0207669_10128973 | Ga0207669_101289732 | 157 |
| 135 | 3300025940 | Ga0207691_10164451 | Ga0207691_101644513 | 157 |
| 136 | 3300025940 | Ga0207691_10408449 | Ga0207691_104084491 | 157 |
| 137 | 3300025961 | Ga0207712_10168457 | Ga0207712_101684573 | 157 |
| 138 | 3300025972 | Ga0207668_10557396 | Ga0207668_105573962 | 157 |
| 139 | 3300026089 | Ga0207648_10020719 | Ga0207648_100207195 | 157 |
| 140 | 3300026116 | Ga0207674_10030941 | Ga0207674_100309414 | 157 |
| 141 | 3300026118 | Ga0207675_100019825 | Ga0207675_1000198254 | 157 |
| 142 | 3300026121 | Ga0207683_10294734 | Ga0207683_102947342 | 157 |
| 143 | 3300027907 | Ga0207428_10202655 | Ga0207428_102026552 | 157 |
| 144 | 3300028380 | Ga0268265_10666527 | Ga0268265_106665272 | 157 |
| 145 | 3300032004 | Ga0307414_11158294 | Ga0307414_111582941 | 157 |
| 146 | 3300041512 | Ga0451853_1602591 | Ga0451853_1602591_159_638 | 157 |
| 147 | 3300047315 | Ga0495581_0374820 | Ga0495581_0374820_290_769 | 157 |
| 148 | 3300047318 | Ga0495636_0264750 | Ga0495636_0264750_177_656 | 157 |
| 149 | 3300047322 | Ga0495680_0394326 | Ga0495680_0394326_187_666 | 157 |
| 150 | 3300048907 | Ga0496104_0864873 | Ga0496104_0864873_124_603 | 157 |
| 151 | 3300048912 | Ga0496109_0023286 | Ga0496109_0023286_1424_1903 | 157 |
| 152 | 3300048917 | Ga0496114_0524931 | Ga0496114_0524931_291_788 | 157 |
| 153 | 3300048917 | Ga0496114_1558138 | Ga0496114_1558138_46_525 | 157 |
| 154 | 3300048918 | Ga0496115_0619421 | Ga0496115_0619421_141_638 | 157 |
| 155 | 3300049572 | Ga0501036_0086257 | Ga0501036_0086257_41_520 | 157 |
| 156 | 3300049572 | Ga0501036_0239418 | Ga0501036_0239418_763_1245 | 157 |
| 157 | 3300049577 | Ga0501041_0177306 | Ga0501041_0177306_711_1190 | 157 |
| 158 | 3300049584 | Ga0501068_0754039 | Ga0501068_0754039_141_614 | 157 |
| 159 | 3300049587 | Ga0501071_0523315 | Ga0501071_0523315_153_632 | 157 |
| 160 | 3300049588 | Ga0501072_0281294 | Ga0501072_0281294_395_874 | 157 |
| 161 | 3300049590 | Ga0501074_0859705 | Ga0501074_0859705_82_561 | 157 |
| 162 | 3300049653 | Ga0501206_048647 | Ga0501206_048647_35_514 | 157 |
| 163 | 3300049669 | Ga0501235_041728 | Ga0501235_041728_388_870 | 157 |
| 164 | 3300049688 | Ga0501259_031684 | Ga0501259_031684_111_593 | 157 |
| 165 | 3300049742 | Ga0501080_0707742 | Ga0501080_0707742_102_584 | 157 |
| 166 | 3300049822 | Ga0501035_0510845 | Ga0501035_0510845_200_682 | 157 |
| 167 | 3300050510 | nmdc:mga06r32_1113227_c1 | nmdc:mga06r32_1113227_c1_75_554 | 157 |
| 168 | 3300050511 | nmdc:mga08y16_371075_c1 | nmdc:mga08y16_371075_c1_458_940 | 157 |
| 169 | 3300053084 | Ga0495595_0429408 | Ga0495595_0429408_70_549 | 157 |
| 170 | 3300053085 | Ga0495619_0120372 | Ga0495619_0120372_379_858 | 157 |
| 171 | 3300054114 | Ga0501084_0905483 | Ga0501084_0905483_118_597 | 157 |
| 172 | 3300060353 | Ga0501082_0397283 | Ga0501082_0397283_235_708 | 157 |
| 173 | 3300061734 | Ga0530510_0731152 | Ga0530510_0731152_217_699 | 157 |
| 174 | iso_pu_bacteria | 2622736605 | 2623499411 | 157 |
| 175 | iso_pu_bacteria | 2932431166 | 2932432790 | 157 |
| 176 | 3300005328 | Ga0070676_10622763 | Ga0070676_106227631 | 158 |
| 177 | 3300005435 | Ga0070714_100703545 | Ga0070714_1007035452 | 158 |
| 178 | 3300005468 | Ga0070707_100089106 | Ga0070707_1000891062 | 158 |
| 179 | 3300005719 | Ga0068861_100617330 | Ga0068861_1006173302 | 158 |
| 180 | 3300006038 | Ga0075365_10859986 | Ga0075365_108599862 | 158 |
| 181 | 3300006163 | Ga0070715_10107247 | Ga0070715_101072471 | 158 |
| 182 | 3300009148 | Ga0105243_11074929 | Ga0105243_110749291 | 158 |
| 183 | 3300025922 | Ga0207646_10075799 | Ga0207646_100757992 | 158 |
| 184 | 3300025931 | Ga0207644_10109037 | Ga0207644_101090374 | 158 |
| 185 | 3300031824 | Ga0307413_10444782 | Ga0307413_104447821 | 158 |
| 186 | 3300031852 | Ga0307410_10145640 | Ga0307410_101456402 | 158 |
| 187 | 3300031901 | Ga0307406_10705506 | Ga0307406_107055062 | 158 |
| 188 | 3300031903 | Ga0307407_10735020 | Ga0307407_107350202 | 158 |
| 189 | 3300032004 | Ga0307414_10434788 | Ga0307414_104347882 | 158 |
| 190 | 3300032005 | Ga0307411_10123563 | Ga0307411_101235632 | 158 |
| 191 | 3300032126 | Ga0307415_100560223 | Ga0307415_1005602232 | 158 |
| 192 | 3300035725 | Ga0373947_0732181 | Ga0373947_0732181_79_558 | 158 |
| 193 | 3300037853 | Ga0436364_1325333 | Ga0436364_1325333_147_623 | 158 |
| 194 | 3300039447 | Ga0436361_0652110 | Ga0436361_0652110_2016_2498 | 158 |
| 195 | 3300041452 | Ga0451793_0224190 | Ga0451793_0224190_186_668 | 158 |
| 196 | 3300041494 | Ga0451837_1040030 | Ga0451837_1040030_415_894 | 158 |
| 197 | 3300042004 | Ga0439445_0055606 | Ga0439445_0055606_562_1047 | 158 |
| 198 | 3300044656 | Ga0466969_0004631 | Ga0466969_0004631_4888_5370 | 158 |
| 199 | 3300044901 | Ga0466960_0077785 | Ga0466960_0077785_759_1238 | 158 |
| 200 | 3300044901 | Ga0466960_0342548 | Ga0466960_0342548_119_598 | 158 |
| 201 | 3300046517 | Ga0495630_0160473 | Ga0495630_0160473_949_1428 | 158 |
| 202 | 3300046535 | Ga0495586_0203512 | Ga0495586_0203512_103_582 | 158 |
| 203 | 3300046559 | Ga0495667_0818660 | Ga0495667_0818660_66_548 | 158 |
| 204 | 3300047317 | Ga0495604_0747066 | Ga0495604_0747066_113_595 | 158 |
| 205 | 3300049587 | Ga0501071_0455213 | Ga0501071_0455213_471_950 | 158 |
| 206 | 3300049588 | Ga0501072_1384853 | Ga0501072_1384853_42_521 | 158 |
| 207 | 3300049591 | Ga0501075_0427728 | Ga0501075_0427728_219_698 | 158 |
| 208 | 3300049741 | Ga0501079_1228796 | Ga0501079_1228796_83_562 | 158 |
| 209 | 3300049743 | Ga0501081_0494872 | Ga0501081_0494872_58_537 | 158 |
| 210 | 3300050514 | nmdc:mga08x19_1145068_c1 | nmdc:mga08x19_1145068_c1_12_494 | 158 |
| 211 | 3300053080 | Ga0500635_0039400 | Ga0500635_0039400_237_716 | 158 |
| 212 | 3300061734 | Ga0530510_0083707 | Ga0530510_0083707_1710_2189 | 158 |
| 213 | iso_pu_bacteria | 2839986021 | 2839988895 | 158 |
| 214 | 3300005330 | Ga0070690_100431176 | Ga0070690_1004311762 | 159 |
| 215 | 3300005445 | Ga0070708_100067657 | Ga0070708_1000676572 | 159 |
| 216 | 3300005445 | Ga0070708_100422178 | Ga0070708_1004221782 | 159 |
| 217 | 3300005467 | Ga0070706_100040845 | Ga0070706_1000408453 | 159 |
| 218 | 3300005467 | Ga0070706_100109636 | Ga0070706_1001096363 | 159 |
| 219 | 3300005467 | Ga0070706_100301669 | Ga0070706_1003016692 | 159 |
| 220 | 3300005467 | Ga0070706_101514841 | Ga0070706_1015148411 | 159 |
| 221 | 3300005468 | Ga0070707_100000368 | Ga0070707_10000036823 | 159 |
| 222 | 3300005468 | Ga0070707_100063112 | Ga0070707_1000631122 | 159 |
| 223 | 3300005518 | Ga0070699_100743244 | Ga0070699_1007432442 | 159 |
| 224 | 3300005518 | Ga0070699_101065417 | Ga0070699_1010654171 | 159 |
| 225 | 3300007265 | Ga0099794_10085908 | Ga0099794_100859082 | 159 |
| 226 | 3300009147 | Ga0114129_10113217 | Ga0114129_101132172 | 159 |
| 227 | 3300022467 | Ga0224712_10392076 | Ga0224712_103920762 | 159 |
| 228 | 3300025910 | Ga0207684_10014005 | Ga0207684_100140058 | 159 |
| 229 | 3300025910 | Ga0207684_10160581 | Ga0207684_101605814 | 159 |
| 230 | 3300025922 | Ga0207646_10002107 | Ga0207646_1000210710 | 159 |
| 231 | 3300025922 | Ga0207646_10343710 | Ga0207646_103437103 | 159 |
| 232 | 3300025922 | Ga0207646_10655669 | Ga0207646_106556692 | 159 |
| 233 | 3300031727 | Ga0316576_10061380 | Ga0316576_100613802 | 159 |
| 234 | 3300031995 | Ga0307409_101177122 | Ga0307409_1011771222 | 159 |
| 235 | 3300032002 | Ga0307416_100253424 | Ga0307416_1002534243 | 159 |
| 236 | 3300032002 | Ga0307416_101016776 | Ga0307416_1010167762 | 159 |
| 237 | 3300035398 | Ga0316574_0208763 | Ga0316574_0208763_108_587 | 159 |
| 238 | 3300038443 | Ga0395901_0473794 | Ga0395901_0473794_773_1261 | 159 |
| 239 | 3300039453 | Ga0436362_0137809 | Ga0436362_0137809_450_929 | 159 |
| 240 | 3300044901 | Ga0466960_0117983 | Ga0466960_0117983_456_941 | 159 |
| 241 | 3300044901 | Ga0466960_0283384 | Ga0466960_0283384_172_657 | 159 |
| 242 | 3300045836 | Ga0466958_0126741 | Ga0466958_0126741_127_609 | 159 |
| 243 | 3300049568 | Ga0501031_0059409 | Ga0501031_0059409_746_1225 | 159 |
| 244 | 3300049568 | Ga0501031_0261428 | Ga0501031_0261428_56_535 | 159 |
| 245 | 3300049570 | Ga0501033_0200420 | Ga0501033_0200420_804_1283 | 159 |
| 246 | 3300049570 | Ga0501033_0208721 | Ga0501033_0208721_228_707 | 159 |
| 247 | 3300049571 | Ga0501034_0226810 | Ga0501034_0226810_854_1333 | 159 |
| 248 | 3300049572 | Ga0501036_0141445 | Ga0501036_0141445_978_1457 | 159 |
| 249 | 3300049572 | Ga0501036_0150204 | Ga0501036_0150204_156_635 | 159 |
| 250 | 3300049574 | Ga0501038_0096659 | Ga0501038_0096659_1305_1784 | 159 |
| 251 | 3300049574 | Ga0501038_0378476 | Ga0501038_0378476_65_544 | 159 |
| 252 | 3300049575 | Ga0501039_0022657 | Ga0501039_0022657_3627_4106 | 159 |
| 253 | 3300049575 | Ga0501039_0051810 | Ga0501039_0051810_413_892 | 159 |
| 254 | 3300049576 | Ga0501040_0081071 | Ga0501040_0081071_744_1223 | 159 |
| 255 | 3300049576 | Ga0501040_0170325 | Ga0501040_0170325_633_1112 | 159 |
| 256 | 3300049576 | Ga0501040_1042007 | Ga0501040_1042007_67_546 | 159 |
| 257 | 3300049577 | Ga0501041_0106882 | Ga0501041_0106882_679_1158 | 159 |
| 258 | 3300049578 | Ga0501042_0042064 | Ga0501042_0042064_1590_2069 | 159 |
| 259 | 3300049578 | Ga0501042_0311360 | Ga0501042_0311360_84_563 | 159 |
| 260 | 3300049579 | Ga0501043_0465306 | Ga0501043_0465306_80_559 | 159 |
| 261 | 3300049580 | Ga0501046_0057695 | Ga0501046_0057695_158_637 | 159 |
| 262 | 3300049580 | Ga0501046_0389516 | Ga0501046_0389516_101_580 | 159 |
| 263 | 3300049582 | Ga0501048_0301713 | Ga0501048_0301713_97_576 | 159 |
| 264 | 3300049584 | Ga0501068_0231984 | Ga0501068_0231984_232_711 | 159 |
| 265 | 3300049584 | Ga0501068_0235234 | Ga0501068_0235234_229_708 | 159 |
| 266 | 3300049587 | Ga0501071_0021303 | Ga0501071_0021303_1148_1627 | 159 |
| 267 | 3300049587 | Ga0501071_0354881 | Ga0501071_0354881_253_732 | 159 |
| 268 | 3300049588 | Ga0501072_0146444 | Ga0501072_0146444_387_866 | 159 |
| 269 | 3300049588 | Ga0501072_1094664 | Ga0501072_1094664_107_586 | 159 |
| 270 | 3300049589 | Ga0501073_0365137 | Ga0501073_0365137_255_734 | 159 |
| 271 | 3300049590 | Ga0501074_0079596 | Ga0501074_0079596_503_982 | 159 |
| 272 | 3300049590 | Ga0501074_0386026 | Ga0501074_0386026_49_528 | 159 |
| 273 | 3300049591 | Ga0501075_0138055 | Ga0501075_0138055_1161_1640 | 159 |
| 274 | 3300049591 | Ga0501075_0148403 | Ga0501075_0148403_773_1252 | 159 |
| 275 | 3300049592 | Ga0501076_0034231 | Ga0501076_0034231_3247_3726 | 159 |
| 276 | 3300049592 | Ga0501076_0183271 | Ga0501076_0183271_94_573 | 159 |
| 277 | 3300049592 | Ga0501076_0385712 | Ga0501076_0385712_96_575 | 159 |
| 278 | 3300049593 | Ga0501077_0114897 | Ga0501077_0114897_803_1282 | 159 |
| 279 | 3300049741 | Ga0501079_0039712 | Ga0501079_0039712_2032_2511 | 159 |
| 280 | 3300049741 | Ga0501079_0141407 | Ga0501079_0141407_967_1446 | 159 |
| 281 | 3300049741 | Ga0501079_0370696 | Ga0501079_0370696_90_569 | 159 |
| 282 | 3300049743 | Ga0501081_0037648 | Ga0501081_0037648_1930_2409 | 159 |
| 283 | 3300049743 | Ga0501081_0254533 | Ga0501081_0254533_245_724 | 159 |
| 284 | 3300049744 | Ga0501083_0350070 | Ga0501083_0350070_307_786 | 159 |
| 285 | 3300049744 | Ga0501083_0610988 | Ga0501083_0610988_69_548 | 159 |
| 286 | 3300049822 | Ga0501035_0234982 | Ga0501035_0234982_524_1003 | 159 |
| 287 | 3300049824 | Ga0501045_0007208 | Ga0501045_0007208_590_1069 | 159 |
| 288 | 3300049824 | Ga0501045_0789614 | Ga0501045_0789614_138_617 | 159 |
| 289 | 3300050492 | nmdc:mga0yw44_160355_c1 | nmdc:mga0yw44_160355_c1_11_490 | 159 |
| 290 | 3300050507 | nmdc:mga05p37_1630028_c1 | nmdc:mga05p37_1630028_c1_34_513 | 159 |
| 291 | 3300054114 | Ga0501084_0034334 | Ga0501084_0034334_446_925 | 159 |
| 292 | 3300054114 | Ga0501084_0107045 | Ga0501084_0107045_1164_1643 | 159 |
| 293 | 3300060353 | Ga0501082_0272324 | Ga0501082_0272324_158_637 | 159 |
| 294 | 3300060353 | Ga0501082_0325337 | Ga0501082_0325337_76_555 | 159 |
| 295 | 3300061734 | Ga0530510_0021411 | Ga0530510_0021411_2591_3070 | 159 |
| 296 | 3300061734 | Ga0530510_0375734 | Ga0530510_0375734_408_887 | 159 |
| 297 | 3300005327 | Ga0070658_10323692 | Ga0070658_103236922 | 160 |
| 298 | 3300005329 | Ga0070683_100575991 | Ga0070683_1005759912 | 160 |
| 299 | 3300005336 | Ga0070680_100908646 | Ga0070680_1009086461 | 160 |
| 300 | 3300005344 | Ga0070661_100836364 | Ga0070661_1008363641 | 160 |
| 301 | 3300005356 | Ga0070674_100163248 | Ga0070674_1001632482 | 160 |
| 302 | 3300005434 | Ga0070709_10060775 | Ga0070709_100607754 | 160 |
| 303 | 3300005455 | Ga0070663_101001344 | Ga0070663_1010013441 | 160 |
| 304 | 3300005456 | Ga0070678_100516849 | Ga0070678_1005168492 | 160 |
| 305 | 3300005458 | Ga0070681_10699929 | Ga0070681_106999291 | 160 |
| 306 | 3300005535 | Ga0070684_101265998 | Ga0070684_1012659982 | 160 |
| 307 | 3300005543 | Ga0070672_101148633 | Ga0070672_1011486331 | 160 |
| 308 | 3300005546 | Ga0070696_100281068 | Ga0070696_1002810681 | 160 |
| 309 | 3300005547 | Ga0070693_100072170 | Ga0070693_1000721702 | 160 |
| 310 | 3300005615 | Ga0070702_100000708 | Ga0070702_1000007083 | 160 |
| 311 | 3300005718 | Ga0068866_10027607 | Ga0068866_100276073 | 160 |
| 312 | 3300006038 | Ga0075365_10061995 | Ga0075365_100619954 | 160 |
| 313 | 3300006051 | Ga0075364_10011126 | Ga0075364_100111266 | 160 |
| 314 | 3300006173 | Ga0070716_100602860 | Ga0070716_1006028602 | 160 |
| 315 | 3300009094 | Ga0111539_11110929 | Ga0111539_111109292 | 160 |
| 316 | 3300009098 | Ga0105245_10358983 | Ga0105245_103589832 | 160 |
| 317 | 3300009148 | Ga0105243_10114155 | Ga0105243_101141554 | 160 |
| 318 | 3300009176 | Ga0105242_10038314 | Ga0105242_100383147 | 160 |
| 319 | 3300009551 | Ga0105238_10036584 | Ga0105238_100365845 | 160 |
| 320 | 3300009551 | Ga0105238_10449057 | Ga0105238_104490571 | 160 |
| 321 | 3300009553 | Ga0105249_10087274 | Ga0105249_100872743 | 160 |
| 322 | 3300013297 | Ga0157378_10040156 | Ga0157378_100401561 | 160 |
| 323 | 3300013308 | Ga0157375_10557136 | Ga0157375_105571362 | 160 |
| 324 | 3300017792 | Ga0163161_10257341 | Ga0163161_102573412 | 160 |
| 325 | 3300020081 | Ga0206354_11624847 | Ga0206354_116248472 | 160 |
| 326 | 3300025898 | Ga0207692_10726418 | Ga0207692_107264181 | 160 |
| 327 | 3300025906 | Ga0207699_10060774 | Ga0207699_100607743 | 160 |
| 328 | 3300025921 | Ga0207652_10561318 | Ga0207652_105613181 | 160 |
| 329 | 3300025924 | Ga0207694_10116696 | Ga0207694_101166962 | 160 |
| 330 | 3300025927 | Ga0207687_10244178 | Ga0207687_102441782 | 160 |
| 331 | 3300025933 | Ga0207706_10390083 | Ga0207706_103900832 | 160 |
| 332 | 3300025934 | Ga0207686_10776853 | Ga0207686_107768532 | 160 |
| 333 | 3300025935 | Ga0207709_10978203 | Ga0207709_109782031 | 160 |
| 334 | 3300025937 | Ga0207669_10281642 | Ga0207669_102816422 | 160 |
| 335 | 3300025938 | Ga0207704_11002497 | Ga0207704_110024971 | 160 |
| 336 | 3300025961 | Ga0207712_10136472 | Ga0207712_101364722 | 160 |
| 337 | 3300025972 | Ga0207668_10066232 | Ga0207668_100662321 | 160 |
| 338 | 3300025981 | Ga0207640_11794967 | Ga0207640_117949671 | 160 |
| 339 | 3300026075 | Ga0207708_10096404 | Ga0207708_100964043 | 160 |
| 340 | 3300026116 | Ga0207674_10884356 | Ga0207674_108843562 | 160 |
| 341 | 3300028794 | Ga0307515_10320082 | Ga0307515_103200821 | 160 |
| 342 | 3300028794 | Ga0307515_10407782 | Ga0307515_104077822 | 160 |
| 343 | 3300031731 | Ga0307405_10135323 | Ga0307405_101353233 | 160 |
| 344 | 3300031824 | Ga0307413_10157269 | Ga0307413_101572693 | 160 |
| 345 | 3300031824 | Ga0307413_10812092 | Ga0307413_108120921 | 160 |
| 346 | 3300031852 | Ga0307410_10058437 | Ga0307410_100584372 | 160 |
| 347 | 3300031901 | Ga0307406_10373819 | Ga0307406_103738192 | 160 |
| 348 | 3300031903 | Ga0307407_10160237 | Ga0307407_101602373 | 160 |
| 349 | 3300031903 | Ga0307407_10172648 | Ga0307407_101726482 | 160 |
| 350 | 3300031995 | Ga0307409_100179591 | Ga0307409_1001795914 | 160 |
| 351 | 3300031995 | Ga0307409_100385173 | Ga0307409_1003851732 | 160 |
| 352 | 3300031995 | Ga0307409_100547380 | Ga0307409_1005473802 | 160 |
| 353 | 3300031995 | Ga0307409_100737882 | Ga0307409_1007378822 | 160 |
| 354 | 3300032002 | Ga0307416_100003197 | Ga0307416_1000031973 | 160 |
| 355 | 3300032002 | Ga0307416_100100785 | Ga0307416_1001007852 | 160 |
| 356 | 3300032002 | Ga0307416_100308225 | Ga0307416_1003082253 | 160 |
| 357 | 3300032002 | Ga0307416_100479771 | Ga0307416_1004797713 | 160 |
| 358 | 3300032002 | Ga0307416_100497885 | Ga0307416_1004978851 | 160 |
| 359 | 3300032002 | Ga0307416_100701667 | Ga0307416_1007016673 | 160 |
| 360 | 3300032004 | Ga0307414_10333273 | Ga0307414_103332733 | 160 |
| 361 | 3300032005 | Ga0307411_10056805 | Ga0307411_100568053 | 160 |
| 362 | 3300032005 | Ga0307411_11203638 | Ga0307411_112036381 | 160 |
| 363 | 3300032005 | Ga0307411_11289614 | Ga0307411_112896141 | 160 |
| 364 | 3300032126 | Ga0307415_100005224 | Ga0307415_1000052244 | 160 |
| 365 | 3300032126 | Ga0307415_100265345 | Ga0307415_1002653452 | 160 |
| 366 | 3300032126 | Ga0307415_101398833 | Ga0307415_1013988332 | 160 |
| 367 | 3300035083 | Ga0373926_0001692 | Ga0373926_0001692_5011_5493 | 160 |
| 368 | 3300035692 | Ga0373935_0000278 | Ga0373935_0000278_1437_1919 | 160 |
| 369 | 3300035725 | Ga0373947_0000136 | Ga0373947_0000136_22041_22523 | 160 |
| 370 | 3300036401 | Ga0373937_0665064 | Ga0373937_0665064_480_965 | 160 |
| 371 | 3300037312 | Ga0395899_0167397 | Ga0395899_0167397_589_1074 | 160 |
| 372 | 3300037466 | Ga0395898_0037858 | Ga0395898_0037858_2166_2651 | 160 |
| 373 | 3300038443 | Ga0395901_0104103 | Ga0395901_0104103_1399_1884 | 160 |
| 374 | 3300041441 | Ga0451787_549090 | Ga0451787_549090_33_515 | 160 |
| 375 | 3300041443 | Ga0451789_1142045 | Ga0451789_1142045_15_497 | 160 |
| 376 | 3300041452 | Ga0451793_0962940 | Ga0451793_0962940_897_1379 | 160 |
| 377 | 3300041456 | Ga0451795_1166415 | Ga0451795_1166415_122_604 | 160 |
| 378 | 3300041459 | Ga0451800_1364876 | Ga0451800_1364876_99_581 | 160 |
| 379 | 3300041498 | Ga0451841_1386162 | Ga0451841_1386162_31_513 | 160 |
| 380 | 3300041509 | Ga0451843_0459762 | Ga0451843_0459762_90_572 | 160 |
| 381 | 3300044684 | Ga0466966_0063019 | Ga0466966_0063019_1767_2249 | 160 |
| 382 | 3300044693 | Ga0466961_0095403 | Ga0466961_0095403_686_1174 | 160 |
| 383 | 3300044694 | Ga0466963_0263200 | Ga0466963_0263200_638_1123 | 160 |
| 384 | 3300044719 | Ga0466971_0226158 | Ga0466971_0226158_267_767 | 160 |
| 385 | 3300044901 | Ga0466960_0142913 | Ga0466960_0142913_352_834 | 160 |
| 386 | 3300044901 | Ga0466960_0500593 | Ga0466960_0500593_179_679 | 160 |
| 387 | 3300045049 | Ga0466959_0090991 | Ga0466959_0090991_1681_2163 | 160 |
| 388 | 3300045976 | Ga0466967_0004977 | Ga0466967_0004977_5249_5734 | 160 |
| 389 | 3300045976 | Ga0466967_1205748 | Ga0466967_1205748_61_546 | 160 |
| 390 | 3300046459 | Ga0495629_0015161 | Ga0495629_0015161_2588_3082 | 160 |
| 391 | 3300046518 | Ga0495631_0222977 | Ga0495631_0222977_77_559 | 160 |
| 392 | 3300046539 | Ga0495621_0348645 | Ga0495621_0348645_38_520 | 160 |
| 393 | 3300046689 | Ga0495613_0011252 | Ga0495613_0011252_2104_2598 | 160 |
| 394 | 3300048903 | Ga0496100_0805052 | Ga0496100_0805052_233_718 | 160 |
| 395 | 3300048912 | Ga0496109_0394343 | Ga0496109_0394343_305_790 | 160 |
| 396 | 3300048913 | Ga0496110_0850095 | Ga0496110_0850095_178_663 | 160 |
| 397 | 3300048914 | Ga0496111_0547442 | Ga0496111_0547442_51_536 | 160 |
| 398 | 3300049578 | Ga0501042_0689780 | Ga0501042_0689780_189_671 | 160 |
| 399 | 3300049652 | Ga0501202_071065 | Ga0501202_071065_13_495 | 160 |
| 400 | 3300049743 | Ga0501081_0449938 | Ga0501081_0449938_414_896 | 160 |
| 401 | 3300049824 | Ga0501045_0157872 | Ga0501045_0157872_1177_1659 | 160 |
| 402 | 3300049824 | Ga0501045_0319334 | Ga0501045_0319334_382_864 | 160 |
| 403 | 3300049824 | Ga0501045_0561058 | Ga0501045_0561058_10_501 | 160 |
| 404 | 3300050491 | nmdc:mga00v17_9656_c1 | nmdc:mga00v17_9656_c1_840_1325 | 160 |
| 405 | 3300061734 | Ga0530510_0218986 | Ga0530510_0218986_231_716 | 160 |
| 406 | iso_pu_bacteria | 2990088156 | 2990088217 | 160 |
| 407 | 3300005327 | Ga0070658_10329785 | Ga0070658_103297851 | 161 |
| 408 | 3300005338 | Ga0068868_100803523 | Ga0068868_1008035232 | 161 |
| 409 | 3300005343 | Ga0070687_100534054 | Ga0070687_1005340542 | 161 |
| 410 | 3300005366 | Ga0070659_100296318 | Ga0070659_1002963182 | 161 |
| 411 | 3300005441 | Ga0070700_100319136 | Ga0070700_1003191362 | 161 |
| 412 | 3300005455 | Ga0070663_100292206 | Ga0070663_1002922062 | 161 |
| 413 | 3300005543 | Ga0070672_100632378 | Ga0070672_1006323782 | 161 |
| 414 | 3300005578 | Ga0068854_101286979 | Ga0068854_1012869791 | 161 |
| 415 | 3300005841 | Ga0068863_100613736 | Ga0068863_1006137362 | 161 |
| 416 | 3300005937 | Ga0081455_10203414 | Ga0081455_102034142 | 161 |
| 417 | 3300006051 | Ga0075364_10022489 | Ga0075364_100224893 | 161 |
| 418 | 3300006358 | Ga0068871_100289936 | Ga0068871_1002899362 | 161 |
| 419 | 3300009098 | Ga0105245_10793550 | Ga0105245_107935501 | 161 |
| 420 | 3300009148 | Ga0105243_10231306 | Ga0105243_102313063 | 161 |
| 421 | 3300009551 | Ga0105238_10541185 | Ga0105238_105411852 | 161 |
| 422 | 3300014326 | Ga0157380_10682854 | Ga0157380_106828542 | 161 |
| 423 | 3300017792 | Ga0163161_10207021 | Ga0163161_102070213 | 161 |
| 424 | 3300020070 | Ga0206356_10679917 | Ga0206356_106799171 | 161 |
| 425 | 3300025926 | Ga0207659_10720487 | Ga0207659_107204872 | 161 |
| 426 | 3300025928 | Ga0207700_10631843 | Ga0207700_106318431 | 161 |
| 427 | 3300025932 | Ga0207690_10663928 | Ga0207690_106639282 | 161 |
| 428 | 3300025938 | Ga0207704_10280968 | Ga0207704_102809681 | 161 |
| 429 | 3300026118 | Ga0207675_100308357 | Ga0207675_1003083573 | 161 |
| 430 | 3300026142 | Ga0207698_10922172 | Ga0207698_109221722 | 161 |
| 431 | 3300031548 | Ga0307408_100172872 | Ga0307408_1001728722 | 161 |
| 432 | 3300031548 | Ga0307408_100337679 | Ga0307408_1003376792 | 161 |
| 433 | 3300031548 | Ga0307408_100583740 | Ga0307408_1005837401 | 161 |
| 434 | 3300031731 | Ga0307405_10013580 | Ga0307405_100135804 | 161 |
| 435 | 3300031731 | Ga0307405_10362087 | Ga0307405_103620872 | 161 |
| 436 | 3300031731 | Ga0307405_10563245 | Ga0307405_105632451 | 161 |
| 437 | 3300031852 | Ga0307410_10076800 | Ga0307410_100768002 | 161 |
| 438 | 3300031852 | Ga0307410_10178650 | Ga0307410_101786502 | 161 |
| 439 | 3300031852 | Ga0307410_10354054 | Ga0307410_103540542 | 161 |
| 440 | 3300031852 | Ga0307410_10427897 | Ga0307410_104278972 | 161 |
| 441 | 3300031852 | Ga0307410_10445461 | Ga0307410_104454612 | 161 |
| 442 | 3300031901 | Ga0307406_10267398 | Ga0307406_102673981 | 161 |
| 443 | 3300031901 | Ga0307406_10291989 | Ga0307406_102919891 | 161 |
| 444 | 3300031901 | Ga0307406_10692560 | Ga0307406_106925602 | 161 |
| 445 | 3300031901 | Ga0307406_10732397 | Ga0307406_107323972 | 161 |
| 446 | 3300031903 | Ga0307407_10047195 | Ga0307407_100471952 | 161 |
| 447 | 3300031903 | Ga0307407_10128678 | Ga0307407_101286783 | 161 |
| 448 | 3300031911 | Ga0307412_10065506 | Ga0307412_100655063 | 161 |
| 449 | 3300031911 | Ga0307412_10764919 | Ga0307412_107649191 | 161 |
| 450 | 3300031911 | Ga0307412_11240780 | Ga0307412_112407801 | 161 |
| 451 | 3300031995 | Ga0307409_100036827 | Ga0307409_1000368272 | 161 |
| 452 | 3300031995 | Ga0307409_100181839 | Ga0307409_1001818393 | 161 |
| 453 | 3300031995 | Ga0307409_100240214 | Ga0307409_1002402143 | 161 |
| 454 | 3300031995 | Ga0307409_100458516 | Ga0307409_1004585163 | 161 |
| 455 | 3300031995 | Ga0307409_100968271 | Ga0307409_1009682712 | 161 |
| 456 | 3300031995 | Ga0307409_101535960 | Ga0307409_1015359601 | 161 |
| 457 | 3300031995 | Ga0307409_101773125 | Ga0307409_1017731251 | 161 |
| 458 | 3300032002 | Ga0307416_100092040 | Ga0307416_1000920402 | 161 |
| 459 | 3300032002 | Ga0307416_100123286 | Ga0307416_1001232861 | 161 |
| 460 | 3300032002 | Ga0307416_100140270 | Ga0307416_1001402702 | 161 |
| 461 | 3300032002 | Ga0307416_100178411 | Ga0307416_1001784113 | 161 |
| 462 | 3300032002 | Ga0307416_101062947 | Ga0307416_1010629472 | 161 |
| 463 | 3300032002 | Ga0307416_101855085 | Ga0307416_1018550852 | 161 |
| 464 | 3300032004 | Ga0307414_10060528 | Ga0307414_100605282 | 161 |
| 465 | 3300032004 | Ga0307414_10473386 | Ga0307414_104733862 | 161 |
| 466 | 3300032005 | Ga0307411_10522803 | Ga0307411_105228032 | 161 |
| 467 | 3300032126 | Ga0307415_100395372 | Ga0307415_1003953723 | 161 |
| 468 | 3300032126 | Ga0307415_100445078 | Ga0307415_1004450782 | 161 |
| 469 | 3300032126 | Ga0307415_100660825 | Ga0307415_1006608251 | 161 |
| 470 | 3300032126 | Ga0307415_100671458 | Ga0307415_1006714582 | 161 |
| 471 | 3300032126 | Ga0307415_100867709 | Ga0307415_1008677092 | 161 |
| 472 | 3300035170 | Ga0373943_0444405 | Ga0373943_0444405_225_710 | 161 |
| 473 | 3300035398 | Ga0316574_0014859 | Ga0316574_0014859_1262_1747 | 161 |
| 474 | 3300039450 | Ga0436363_1155040 | Ga0436363_1155040_485_976 | 161 |
| 475 | 3300042010 | Ga0439452_050179 | Ga0439452_050179_187_678 | 161 |
| 476 | 3300044656 | Ga0466969_0112689 | Ga0466969_0112689_539_1024 | 161 |
| 477 | 3300044683 | Ga0466965_0317054 | Ga0466965_0317054_220_708 | 161 |
| 478 | 3300044693 | Ga0466961_0039817 | Ga0466961_0039817_2227_2712 | 161 |
| 479 | 3300044693 | Ga0466961_0163385 | Ga0466961_0163385_639_1124 | 161 |
| 480 | 3300044693 | Ga0466961_0533095 | Ga0466961_0533095_172_669 | 161 |
| 481 | 3300044842 | Ga0466957_0256653 | Ga0466957_0256653_420_908 | 161 |
| 482 | 3300044901 | Ga0466960_0210291 | Ga0466960_0210291_379_876 | 161 |
| 483 | 3300045049 | Ga0466959_0075447 | Ga0466959_0075447_27_512 | 161 |
| 484 | 3300045836 | Ga0466958_0076736 | Ga0466958_0076736_408_893 | 161 |
| 485 | 3300045836 | Ga0466958_0080626 | Ga0466958_0080626_1333_1818 | 161 |
| 486 | 3300046455 | Ga0495603_0002275 | Ga0495603_0002275_10549_11058 | 161 |
| 487 | 3300046455 | Ga0495603_0082633 | Ga0495603_0082633_953_1462 | 161 |
| 488 | 3300046459 | Ga0495629_0358022 | Ga0495629_0358022_19_504 | 161 |
| 489 | 3300046473 | Ga0495582_0255634 | Ga0495582_0255634_308_817 | 161 |
| 490 | 3300046475 | Ga0495639_0069738 | Ga0495639_0069738_460_969 | 161 |
| 491 | 3300046499 | Ga0495594_0059235 | Ga0495594_0059235_613_1122 | 161 |
| 492 | 3300046515 | Ga0495620_0217455 | Ga0495620_0217455_16_501 | 161 |
| 493 | 3300046518 | Ga0495631_0148127 | Ga0495631_0148127_216_725 | 161 |
| 494 | 3300046674 | Ga0495588_0058569 | Ga0495588_0058569_1262_1771 | 161 |
| 495 | 3300046691 | Ga0495670_0057930 | Ga0495670_0057930_604_1113 | 161 |
| 496 | 3300046692 | Ga0495671_0228084 | Ga0495671_0228084_150_659 | 161 |
| 497 | 3300046794 | Ga0495589_0181471 | Ga0495589_0181471_256_765 | 161 |
| 498 | 3300046809 | Ga0495600_0087006 | Ga0495600_0087006_542_1075 | 161 |
| 499 | 3300047315 | Ga0495581_0192400 | Ga0495581_0192400_313_822 | 161 |
| 500 | 3300047318 | Ga0495636_0003098 | Ga0495636_0003098_3499_4008 | 161 |
| 501 | 3300047318 | Ga0495636_0189082 | Ga0495636_0189082_93_578 | 161 |
| 502 | 3300047444 | Ga0495675_0073946 | Ga0495675_0073946_1056_1589 | 161 |
| 503 | 3300047447 | Ga0495685_003755 | Ga0495685_003755_2652_3161 | 161 |
| 504 | 3300048905 | Ga0496102_1053103 | Ga0496102_1053103_175_684 | 161 |
| 505 | 3300049586 | Ga0501070_0615180 | Ga0501070_0615180_259_744 | 161 |
| 506 | 3300049592 | Ga0501076_0371691 | Ga0501076_0371691_79_564 | 161 |
| 507 | 3300050491 | nmdc:mga00v17_141498_c1 | nmdc:mga00v17_141498_c1_390_875 | 161 |
| 508 | 3300005336 | Ga0070680_100279966 | Ga0070680_1002799662 | 162 |
| 509 | 3300031456 | Ga0307513_10001518 | Ga0307513_100015183 | 162 |
| 510 | 3300046460 | Ga0495638_0086541 | Ga0495638_0086541_942_1430 | 162 |
| 511 | 3300049568 | Ga0501031_0050716 | Ga0501031_0050716_1920_2417 | 162 |
| 512 | 3300049568 | Ga0501031_0103102 | Ga0501031_0103102_317_805 | 162 |
| 513 | 3300049577 | Ga0501041_0568275 | Ga0501041_0568275_164_661 | 162 |
| 514 | 3300049582 | Ga0501048_0431646 | Ga0501048_0431646_192_689 | 162 |
| 515 | 3300049587 | Ga0501071_0320125 | Ga0501071_0320125_257_754 | 162 |
| 516 | 3300049591 | Ga0501075_0732751 | Ga0501075_0732751_25_513 | 162 |
| 517 | 3300053153 | Ga0500616_0030836 | Ga0500616_0030836_1924_2412 | 162 |
| 518 | 3300054114 | Ga0501084_0609646 | Ga0501084_0609646_109_606 | 162 |
| 519 | iso_pu_bacteria | 2582581314 | 2585311743 | 162 |
| 520 | 3300005440 | Ga0070705_100615189 | Ga0070705_1006151891 | 163 |
| 521 | 3300009177 | Ga0105248_11306595 | Ga0105248_113065951 | 163 |
| 522 | 3300047320 | Ga0495672_0052841 | Ga0495672_0052841_1314_1820 | 163 |
| 523 | 3300048907 | Ga0496104_0912106 | Ga0496104_0912106_148_639 | 163 |
| 524 | 3300048908 | Ga0496105_0884542 | Ga0496105_0884542_61_597 | 163 |
| 525 | 3300048910 | Ga0496107_0556766 | Ga0496107_0556766_284_820 | 163 |
| 526 | 3300048911 | Ga0496108_0267270 | Ga0496108_0267270_33_569 | 163 |
| 527 | 3300048912 | Ga0496109_0030226 | Ga0496109_0030226_1009_1545 | 163 |
| 528 | 3300048914 | Ga0496111_0853267 | Ga0496111_0853267_50_586 | 163 |
| 529 | 3300048915 | Ga0496112_0478546 | Ga0496112_0478546_409_900 | 163 |
| 530 | iso_pu_bacteria | 2643221678 | 2644441706 | 164 |
| 531 | 3300005578 | Ga0068854_100498254 | Ga0068854_1004982542 | 165 |
| 532 | 3300010375 | Ga0105239_10700725 | Ga0105239_107007251 | 165 |
| 533 | 3300025935 | Ga0207709_10729532 | Ga0207709_107295321 | 165 |
| 534 | 3300028794 | Ga0307515_10405510 | Ga0307515_104055102 | 165 |
| 535 | 3300031616 | Ga0307508_10172561 | Ga0307508_101725612 | 165 |
| 536 | 3300046474 | Ga0495605_0015478 | Ga0495605_0015478_704_1246 | 165 |
| 537 | 3300046492 | Ga0495585_0126130 | Ga0495585_0126130_418_960 | 165 |
| 538 | 3300046501 | Ga0495607_0053087 | Ga0495607_0053087_381_923 | 165 |
| 539 | 3300046507 | Ga0495606_0004553 | Ga0495606_0004553_12113_12655 | 165 |
| 540 | 3300046515 | Ga0495620_0005950 | Ga0495620_0005950_2104_2646 | 165 |
| 541 | 3300046524 | Ga0495648_0035820 | Ga0495648_0035820_481_1023 | 165 |
| 542 | 3300046542 | Ga0495597_0073708 | Ga0495597_0073708_167_709 | 165 |
| 543 | 3300046616 | Ga0495668_0039199 | Ga0495668_0039199_1863_2405 | 165 |
| 544 | 3300046660 | Ga0495625_0011064 | Ga0495625_0011064_4794_5336 | 165 |
| 545 | 3300046694 | Ga0495649_0074825 | Ga0495649_0074825_675_1217 | 165 |
| 546 | 3300046794 | Ga0495589_0012642 | Ga0495589_0012642_983_1525 | 165 |
| 547 | 3300046810 | Ga0495660_0091018 | Ga0495660_0091018_740_1282 | 165 |
| 548 | 3300047323 | Ga0495683_0020245 | Ga0495683_0020245_186_728 | 165 |
| 549 | 3300047443 | Ga0495687_007595 | Ga0495687_007595_1295_1837 | 165 |
| 550 | 3300047447 | Ga0495685_026502 | Ga0495685_026502_470_1012 | 165 |
| 551 | 3300048091 | Ga0495626_0018072 | Ga0495626_0018072_1826_2368 | 165 |
| 552 | 3300048922 | Ga0496119_0467158 | Ga0496119_0467158_34_576 | 165 |
| 553 | 3300000549 | LJQas_1012115 | LJQas_10121152 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xuv-assembly2.cif.gz_B-2 | x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. | 0.9706 | 8 | 162 |
| 1xuv-assembly2.cif.gz_B-2 | x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. | 0.9183 | 8 | 162 |
| 3pu2-assembly4.cif.gz_D | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9176 | 8 | 160 |
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9161 | 19 | 158 |
| 3pu2-assembly1.cif.gz_A | crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. | 0.9151 | 8 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9458 | 8 | 162 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9115 | 8 | 162 | 3.30.530.20 |
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8996 | 19 | 158 | 3.30.530.20 |
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8938 | 8 | 160 | 3.30.530.20 |
| 3pu2H00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8763 | 8 | 160 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I6ZK19-F1-model_v4 | Uncharacterized conserved protein YndB, AHSA1/START domain | 0.9961 | 3 | 159 |
|
| AF-A0A4V2SSL7-F1-model_v4 | Uncharacterized protein YndB with AHSA1/START domain | 0.9919 | 7 | 160 |
|
| AF-A0A316F6K1-F1-model_v4 | Uncharacterized protein YndB with AHSA1/START domain | 0.9906 | 6 | 162 |
|
| AF-A0A1V4EGR7-F1-model_v4 | Polyketide cyclase | 0.9878 | 8 | 163 |
|
| AF-A0A177YLP1-F1-model_v4 | Polyketide cyclase | 0.9858 | 7 | 158 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar