F462849

General Info

Members Datasets Scaffolds Average Seq Length
553 346 1106 114

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10402898|Ga0099795_104028982
Length 127
Sequence MQAGPVAGIHSGALAKAPITYFNGRPDYDLAAALTKVSPQVQAKAKATAQDFEAVFLNSMFSQMTSGLNGEGPFGNTPGTGVWRSMLTEQFSKSFAKAGGVGISNDVYRTLILQQASRTSQTQGKQA

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
152 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
164 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
183 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
186 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
187 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
313 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
314 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
315 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
316 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
319 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
322 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
323 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
324 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
325 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
328 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
329 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
334 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
337 2643221651 Afipia sp. Root123D2 Isolate Unclassified
338 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
339 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
340 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
341 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
342 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
343 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
344 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
345 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
346 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.03
Nodule 1.27
Rhizoplane 7.96
Rhizosphere 72.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10402898 3300007788 Bacteria 622
2 JGI25404J52841_10015633 3300003659 Bacteria 1646
3 JGI25404J52841_10036052 3300003659 Bacteria 1053
4 Ga0065712_10421206 3300005290 Bacteria 712
5 Ga0065707_11030489 3300005295 Bacteria 532
6 Ga0070676_10189965 3300005328 Bacteria 1340
7 Ga0070690_101359056 3300005330 Bacteria 570
8 Ga0068869_100050550 3300005334 Bacteria 3013
9 Ga0068869_100414944 3300005334 Bacteria 1110
10 Ga0068869_100658404 3300005334 Bacteria 890
11 Ga0068868_100043625 3300005338 Bacteria 3503
12 Ga0068868_100349231 3300005338 Bacteria 1266
13 Ga0070661_100164671 3300005344 Bacteria 1681
14 Ga0070668_100108529 3300005347 Bacteria 2207
15 Ga0070668_101266193 3300005347 Bacteria 670
16 Ga0070675_101080399 3300005354 Bacteria 737
17 Ga0070671_100356558 3300005355 Bacteria 1249
18 Ga0070673_100186114 3300005364 Bacteria 1780
19 Ga0070688_100593803 3300005365 Bacteria 847
20 Ga0070659_101273395 3300005366 Bacteria 651
21 Ga0070667_100532648 3300005367 Bacteria 1078
22 Ga0070703_10524122 3300005406 Bacteria 537
23 Ga0070709_10127763 3300005434 Bacteria 1731
24 Ga0070709_10862983 3300005434 Bacteria 714
25 Ga0070714_100048723 3300005435 Bacteria 3604
26 Ga0070713_101077088 3300005436 Bacteria 776
27 Ga0070713_102268055 3300005436 Bacteria 526
28 Ga0070710_10023043 3300005437 Bacteria 3266
29 Ga0070710_10054541 3300005437 Bacteria 2256
30 Ga0070710_11028035 3300005437 Bacteria 602
31 Ga0070711_100180136 3300005439 Bacteria 1617
32 Ga0070711_100224975 3300005439 Bacteria 1460
33 Ga0070711_100812033 3300005439 Bacteria 794
34 Ga0070700_100420752 3300005441 Bacteria 1009
35 Ga0070694_100450067 3300005444 Bacteria 1016
36 Ga0070663_100027547 3300005455 Bacteria 3860
37 Ga0070663_101192423 3300005455 Bacteria 669
38 Ga0070678_100113092 3300005456 Bacteria 2127
39 Ga0070678_100262343 3300005456 Bacteria 1453
40 Ga0070662_100383237 3300005457 Bacteria 1158
41 Ga0068867_100328884 3300005459 Bacteria 1269
42 Ga0068867_100758037 3300005459 Bacteria 862
43 Ga0068867_101861213 3300005459 Bacteria 567
44 Ga0070706_100803552 3300005467 Bacteria 871
45 Ga0070698_100201034 3300005471 Bacteria 1928
46 Ga0070699_101753302 3300005518 Bacteria 569
47 Ga0070679_100985606 3300005530 Bacteria 787
48 Ga0070684_100079296 3300005535 Bacteria 2902
49 Ga0070697_100907847 3300005536 Bacteria 782
50 Ga0068853_100130695 3300005539 Bacteria 2247
51 Ga0068853_100940276 3300005539 Bacteria 831
52 Ga0070672_101173013 3300005543 Bacteria 684
53 Ga0070695_100784048 3300005545 Bacteria 762
54 Ga0070696_100547616 3300005546 Bacteria 927
55 Ga0070693_100174652 3300005547 Bacteria 1379
56 Ga0070665_100052564 3300005548 Bacteria 4085
57 Ga0070665_100087698 3300005548 Bacteria 3117
58 Ga0070665_100134784 3300005548 Bacteria 2471
59 Ga0070665_100218246 3300005548 Bacteria 1907
60 Ga0070665_100248494 3300005548 Bacteria 1779
61 Ga0070665_100745462 3300005548 Bacteria 992
62 Ga0070665_100801999 3300005548 Bacteria 955
63 Ga0070704_100650543 3300005549 Bacteria 930
64 Ga0068855_100463023 3300005563 Bacteria 1382
65 Ga0068857_100104388 3300005577 Bacteria 2544
66 Ga0068857_100540803 3300005577 Bacteria 1097
67 Ga0068856_100083630 3300005614 Bacteria 3169
68 Ga0070702_100071763 3300005615 Bacteria 2047
69 Ga0070702_100590869 3300005615 Bacteria 831
70 Ga0068852_100082137 3300005616 Bacteria 2862
71 Ga0068852_100082162 3300005616 Bacteria 2862
72 Ga0068859_100319140 3300005617 Bacteria 1647
73 Ga0068859_101133482 3300005617 Bacteria 861
74 Ga0068864_100081180 3300005618 Bacteria 2842
75 Ga0068864_100171440 3300005618 Bacteria 1979
76 Ga0068861_101278752 3300005719 Bacteria 712
77 Ga0068851_10637798 3300005834 Bacteria 651
78 Ga0068863_100093927 3300005841 Bacteria 2846
79 Ga0068863_100471671 3300005841 Bacteria 1233
80 Ga0068863_102039845 3300005841 Bacteria 584
81 Ga0068863_102471487 3300005841 Bacteria 529
82 Ga0068858_100084146 3300005842 Bacteria 2959
83 Ga0068858_100084897 3300005842 Bacteria 2945
84 Ga0068860_100461839 3300005843 Bacteria 1263
85 Ga0068860_101518556 3300005843 Bacteria 691
86 Ga0068862_100548495 3300005844 Bacteria 1103
87 Ga0068862_101788835 3300005844 Bacteria 623
88 Ga0081455_10084969 3300005937 Bacteria 2582
89 Ga0081455_10107507 3300005937 Bacteria 2224
90 Ga0081540_1008103 3300005983 Bacteria 7381
91 Ga0081540_1023408 3300005983 Bacteria 3613
92 Ga0081540_1034235 3300005983 Bacteria 2744
93 Ga0081540_1079811 3300005983 Bacteria 1478
94 Ga0081540_1089967 3300005983 Bacteria 1353
95 Ga0081539_10027924 3300005985 Bacteria 3561
96 Ga0081539_10150519 3300005985 Bacteria 1120
97 Ga0070717_10378729 3300006028 Bacteria 1268
98 Ga0070717_10645658 3300006028 Bacteria 960
99 Ga0075365_10032990 3300006038 Bacteria 3333
100 Ga0075365_10387877 3300006038 Bacteria 985
101 Ga0075368_10014000 3300006042 Bacteria 2954
102 Ga0075368_10190305 3300006042 Bacteria 866
103 Ga0075363_100083181 3300006048 Bacteria 1753
104 Ga0075363_100229813 3300006048 Bacteria 1065
105 Ga0075364_10156654 3300006051 Bacteria 1536
106 Ga0070716_100038792 3300006173 Bacteria 2639
107 Ga0070716_100225444 3300006173 Bacteria 1262
108 Ga0070716_100692000 3300006173 Bacteria 778
109 Ga0070712_100475966 3300006175 Bacteria 1043
110 Ga0070712_100542242 3300006175 Bacteria 979
111 Ga0070712_101316212 3300006175 Bacteria 630
112 Ga0075362_10268753 3300006177 Bacteria 841
113 Ga0075362_10453096 3300006177 Bacteria 652
114 Ga0075367_10030569 3300006178 Bacteria 3088
115 Ga0075367_10748905 3300006178 Bacteria 622
116 Ga0075369_10299636 3300006186 Bacteria 750
117 Ga0075366_10069034 3300006195 Bacteria 2103
118 Ga0097621_100292508 3300006237 Bacteria 1436
119 Ga0097621_100492275 3300006237 Bacteria 1110
120 Ga0075370_10041029 3300006353 Bacteria 2612
121 Ga0075370_10092843 3300006353 Bacteria 1742
122 Ga0075370_10189553 3300006353 Bacteria 1211
123 Ga0075370_10639136 3300006353 Bacteria 646
124 Ga0068871_101271680 3300006358 Bacteria 691
125 Ga0075428_100293190 3300006844 Bacteria 1749
126 Ga0075431_100946525 3300006847 Bacteria 830
127 Ga0075434_101068850 3300006871 Bacteria 820
128 Ga0068865_100015863 3300006881 Bacteria 4809
129 Ga0068865_100193794 3300006881 Bacteria 1573
130 Ga0068865_102083207 3300006881 Bacteria 516
131 Ga0097620_100319145 3300006931 Bacteria 1647
132 Ga0097620_101133607 3300006931 Bacteria 861
133 Ga0075435_100107260 3300007076 Bacteria 2319
134 Ga0099795_10004600 3300007788 Bacteria 3578
135 Ga0105240_11014175 3300009093 Bacteria 887
136 Ga0105247_10036791 3300009101 Bacteria 2984
137 Ga0105247_10083772 3300009101 Bacteria 2014
138 Ga0105247_10162633 3300009101 Bacteria 1479
139 Ga0105247_10209592 3300009101 Bacteria 1314
140 Ga0105247_10984259 3300009101 Bacteria 657
141 Ga0105243_10264399 3300009148 Bacteria 1542
142 Ga0105243_10878434 3300009148 Bacteria 890
143 Ga0105243_11876885 3300009148 Bacteria 632
144 Ga0105243_12442443 3300009148 Bacteria 561
145 Ga0105241_10015897 3300009174 Bacteria 5513
146 Ga0105241_10299328 3300009174 Bacteria 1380
147 Ga0105241_10853122 3300009174 Bacteria 843
148 Ga0105242_11173684 3300009176 Bacteria 786
149 Ga0105242_12511705 3300009176 Bacteria 563
150 Ga0105242_12847842 3300009176 Bacteria 534
151 Ga0105248_10652925 3300009177 Bacteria 1187
152 Ga0105248_11104550 3300009177 Bacteria 896
153 Ga0105237_10022581 3300009545 Bacteria 6453
154 Ga0105237_10057863 3300009545 Bacteria 3879
155 Ga0105237_10127309 3300009545 Bacteria 2541
156 Ga0105237_12215167 3300009545 Bacteria 559
157 Ga0105238_10039519 3300009551 Bacteria 4785
158 Ga0105238_10711849 3300009551 Bacteria 1016
159 Ga0105238_11372346 3300009551 Bacteria 734
160 Ga0105249_10438570 3300009553 Bacteria 1343
161 Ga0105249_11323712 3300009553 Bacteria 792
162 Ga0105249_12337693 3300009553 Bacteria 607
163 Ga0099796_10047222 3300010159 Bacteria 1481
164 Ga0099796_10094555 3300010159 Bacteria 1116
165 Ga0105239_10046043 3300010375 Bacteria 4779
166 Ga0105239_10123482 3300010375 Bacteria 2877
167 Ga0105239_10165073 3300010375 Bacteria 2476
168 Ga0105239_10550981 3300010375 Bacteria 1313
169 Ga0105239_10609095 3300010375 Bacteria 1246
170 Ga0105246_10013180 3300011119 Bacteria 5177
171 Ga0105246_10023635 3300011119 Bacteria 3979
172 Ga0105246_10211994 3300011119 Bacteria 1512
173 Ga0105246_10426089 3300011119 Bacteria 1109
174 Ga0105246_11212268 3300011119 Bacteria 695
175 Ga0157325_1013889 3300012485 Bacteria 639
176 Ga0157369_11414985 3300013105 Bacteria 708
177 Ga0157374_10015024 3300013296 Bacteria 6787
178 Ga0157374_10560289 3300013296 Bacteria 1151
179 Ga0157378_10046962 3300013297 Bacteria 3839
180 Ga0163162_10069493 3300013306 Bacteria 3574
181 Ga0163162_10077388 3300013306 Bacteria 3390
182 Ga0157375_10229624 3300013308 Bacteria 2015
183 Ga0157375_10508586 3300013308 Bacteria 1368
184 Ga0163163_10072107 3300014325 Bacteria 3442
185 Ga0163163_10696483 3300014325 Bacteria 1079
186 Ga0163163_11800146 3300014325 Bacteria 673
187 Ga0182008_10450108 3300014497 Bacteria 700
188 Ga0157379_10060619 3300014968 Bacteria 3383
189 Ga0157379_10117931 3300014968 Bacteria 2388
190 Ga0157379_10908301 3300014968 Bacteria 836
191 Ga0157379_11065273 3300014968 Bacteria 773
192 Ga0182007_10060652 3300015262 Bacteria 1240
193 Ga0163161_10541100 3300017792 Bacteria 953
194 Ga0209758_1148667 3300025297 Bacteria 598
195 Ga0207697_10158943 3300025315 Bacteria 985
196 Ga0207656_10359781 3300025321 Bacteria 727
197 Ga0207692_10007759 3300025898 Bacteria 4411
198 Ga0207692_10087879 3300025898 Bacteria 1678
199 Ga0207642_10861646 3300025899 Bacteria 579
200 Ga0207710_10047085 3300025900 Bacteria 1926
201 Ga0207710_10103074 3300025900 Bacteria 1348
202 Ga0207688_10022646 3300025901 Bacteria 3439
203 Ga0207688_10803108 3300025901 Bacteria 596
204 Ga0207680_10302967 3300025903 Bacteria 1114
205 Ga0207647_10191499 3300025904 Bacteria 1185
206 Ga0207685_10016818 3300025905 Bacteria 2349
207 Ga0207699_10134421 3300025906 Bacteria 1618
208 Ga0207645_10089854 3300025907 Bacteria 1975
209 Ga0207654_10017061 3300025911 Bacteria 3790
210 Ga0207707_10561760 3300025912 Bacteria 969
211 Ga0207671_10021468 3300025914 Bacteria 4900
212 Ga0207671_10105706 3300025914 Bacteria 2136
213 Ga0207671_10131495 3300025914 Bacteria 1921
214 Ga0207693_10026107 3300025915 Bacteria 4625
215 Ga0207663_10016972 3300025916 Bacteria 4047
216 Ga0207663_10103400 3300025916 Bacteria 1918
217 Ga0207663_11544355 3300025916 Bacteria 534
218 Ga0207657_10048928 3300025919 Bacteria 3688
219 Ga0207694_10222029 3300025924 Bacteria 1542
220 Ga0207694_10351365 3300025924 Bacteria 1220
221 Ga0207687_10437047 3300025927 Bacteria 1083
222 Ga0207687_10556264 3300025927 Bacteria 963
223 Ga0207700_10467541 3300025928 Bacteria 1113
224 Ga0207664_10061473 3300025929 Bacteria 2997
225 Ga0207690_10282922 3300025932 Bacteria 1292
226 Ga0207709_10708906 3300025935 Bacteria 806
227 Ga0207669_10483642 3300025937 Bacteria 987
228 Ga0207665_10006600 3300025939 Bacteria 7695
229 Ga0207665_10037926 3300025939 Bacteria 3207
230 Ga0207665_10141847 3300025939 Bacteria 1714
231 Ga0207689_10023055 3300025942 Bacteria 5227
232 Ga0207689_10562450 3300025942 Bacteria 958
233 Ga0207679_10574515 3300025945 Bacteria 1014
234 Ga0207667_10427277 3300025949 Bacteria 1348
235 Ga0207651_10326890 3300025960 Bacteria 1284
236 Ga0207712_11255606 3300025961 Bacteria 662
237 Ga0207668_10006793 3300025972 Bacteria 6776
238 Ga0207668_10018111 3300025972 Bacteria 4425
239 Ga0207640_11422587 3300025981 Bacteria 622
240 Ga0207677_10544974 3300026023 Bacteria 1010
241 Ga0207677_11311854 3300026023 Bacteria 665
242 Ga0207703_10420689 3300026035 Bacteria 1243
243 Ga0207639_10433371 3300026041 Bacteria 1191
244 Ga0207678_10019922 3300026067 Bacteria 5896
245 Ga0207678_10059413 3300026067 Bacteria 3289
246 Ga0207702_10654606 3300026078 Bacteria 1033
247 Ga0207648_10960814 3300026089 Bacteria 799
248 Ga0207676_10078239 3300026095 Bacteria 2678
249 Ga0207676_10306891 3300026095 Bacteria 1451
250 Ga0207674_10218330 3300026116 Bacteria 1855
251 Ga0207675_100022591 3300026118 Bacteria 5856
252 Ga0207675_100108952 3300026118 Bacteria 2613
253 Ga0207675_101036255 3300026118 Bacteria 839
254 Ga0207683_10229554 3300026121 Bacteria 1692
255 Ga0207683_10277452 3300026121 Bacteria 1531
256 Ga0207683_11113910 3300026121 Bacteria 732
257 Ga0268266_10018788 3300028379 Bacteria 5889
258 Ga0268266_10176311 3300028379 Bacteria 1943
259 Ga0268266_10220748 3300028379 Bacteria 1742
260 Ga0268266_10843711 3300028379 Bacteria 885
261 Ga0268265_10953412 3300028380 Bacteria 845
262 Ga0268265_10972123 3300028380 Bacteria 837
263 Ga0268265_11470257 3300028380 Bacteria 684
264 Ga0268264_10966773 3300028381 Bacteria 857
265 Ga0307517_10000049 3300028786 Bacteria 160368
266 Ga0307511_10251616 3300030521 Bacteria 848
267 Ga0265330_10032541 3300031235 Bacteria 2336
268 Ga0265332_10300787 3300031238 Bacteria 662
269 Ga0307513_10281979 3300031456 Bacteria 1438
270 Ga0307509_10355449 3300031507 Bacteria 1186
271 Ga0307509_10644551 3300031507 Bacteria 728
272 Ga0265314_10161721 3300031711 Bacteria 1361
273 Ga0307516_10155389 3300031730 Bacteria 2043
274 Ga0307516_10215453 3300031730 Bacteria 1632
275 Ga0307516_10436026 3300031730 Bacteria 967
276 Ga0307413_10302990 3300031824 Bacteria 1213
277 Ga0307413_11872409 3300031824 Bacteria 538
278 Ga0307410_11048239 3300031852 Bacteria 705
279 Ga0307407_10585463 3300031903 Bacteria 829
280 Ga0307409_100591362 3300031995 Bacteria 1095
281 Ga0307416_101337331 3300032002 Bacteria 822
282 Ga0307414_10507391 3300032004 Bacteria 1068
283 Ga0307411_10048851 3300032005 Bacteria 2745
284 Ga0307411_10926972 3300032005 Bacteria 775
285 Ga0307415_101755595 3300032126 Bacteria 599
286 Ga0307507_10028511 3300033179 Bacteria 5948
287 Ga0307507_10459591 3300033179 Bacteria 700
288 Ga0307510_10019125 3300033180 Bacteria 8035
289 Ga0373926_0065391 3300035083 Bacteria 1330
290 Ga0373929_0222301 3300035085 Bacteria 537
291 Ga0373939_0542243 3300035114 Bacteria 502
292 Ga0373945_0022646 3300035116 Bacteria 2166
293 Ga0373957_0182306 3300035120 Bacteria 871
294 Ga0373960_0113028 3300035121 Bacteria 893
295 Ga0373943_0097717 3300035170 Bacteria 1530
296 Ga0373962_0271829 3300035242 Bacteria 594
297 Ga0373931_0019229 3300035691 Bacteria 3407
298 Ga0373935_0908009 3300035692 Bacteria 652
299 Ga0373935_1293990 3300035692 Bacteria 544
300 Ga0373927_0025338 3300035695 Bacteria 3877
301 Ga0373927_0267003 3300035695 Bacteria 1125
302 Ga0373947_0012691 3300035725 Bacteria 4830
303 Ga0373947_0052397 3300035725 Bacteria 2458
304 Ga0373937_0137155 3300036401 Bacteria 2288
305 Ga0373925_0055439 3300037068 Bacteria 2967
306 Ga0373925_0180335 3300037068 Bacteria 1671
307 Ga0373925_0304569 3300037068 Bacteria 1287
308 Ga0373925_1039985 3300037068 Bacteria 674
309 Ga0439465_0390234 3300041413 Bacteria 529
310 Ga0451798_0054717 3300041458 Bacteria 837
311 Ga0451802_0016731 3300041460 Bacteria 1037
312 Ga0451807_2433274 3300041486 Bacteria 1695
313 Ga0451833_0549399 3300041491 Bacteria 677
314 Ga0451837_0965192 3300041494 Bacteria 568
315 Ga0451845_0351543 3300041501 Bacteria 602
316 Ga0451849_0416983 3300041505 Bacteria 513
317 Ga0451843_1602963 3300041509 Bacteria 1212
318 Ga0439458_0015540 3300042157 Bacteria 1726
319 Ga0495592_0062970 3300046454 Bacteria 2721
320 Ga0495603_0221870 3300046455 Bacteria 1090
321 Ga0495629_0000672 3300046459 Bacteria 27723
322 Ga0495641_0069362 3300046461 Bacteria 1584
323 Ga0495580_0379071 3300046472 Bacteria 955
324 Ga0495580_0892867 3300046472 Bacteria 572
325 Ga0495582_0000336 3300046473 Bacteria 25701
326 Ga0495639_0003517 3300046475 Bacteria 6762
327 Ga0495639_0061154 3300046475 Bacteria 1726
328 Ga0495662_0039941 3300046476 Bacteria 2266
329 Ga0495664_0101556 3300046477 Bacteria 1733
330 Ga0495664_0213173 3300046477 Bacteria 1170
331 Ga0495584_0144028 3300046491 Bacteria 1210
332 Ga0495585_0071968 3300046492 Bacteria 1884
333 Ga0495594_0024895 3300046499 Bacteria 3216
334 Ga0495594_0239278 3300046499 Bacteria 1035
335 Ga0495594_0392737 3300046499 Bacteria 789
336 Ga0495606_0552513 3300046507 Bacteria 573
337 Ga0495616_0114189 3300046513 Bacteria 1252
338 Ga0495628_0098144 3300046516 Bacteria 2263
339 Ga0495628_0568245 3300046516 Bacteria 813
340 Ga0495630_0030718 3300046517 Bacteria 3998
341 Ga0495631_0260842 3300046518 Bacteria 738
342 Ga0495632_0178695 3300046519 Bacteria 973
343 Ga0495637_0088952 3300046520 Bacteria 1221
344 Ga0495644_0286228 3300046523 Bacteria 643
345 Ga0495648_0006790 3300046524 Bacteria 9255
346 Ga0495648_0011875 3300046524 Bacteria 6534
347 Ga0495666_0028613 3300046526 Bacteria 2742
348 Ga0495665_0044788 3300046531 Bacteria 2350
349 Ga0495586_0607738 3300046535 Bacteria 632
350 Ga0495609_0167392 3300046538 Bacteria 929
351 Ga0495622_0045288 3300046557 Bacteria 2044
352 Ga0495622_0226322 3300046557 Bacteria 827
353 Ga0495633_0065136 3300046558 Bacteria 1703
354 Ga0495634_0005588 3300046642 Bacteria 9645
355 Ga0495625_0175918 3300046660 Bacteria 1426
356 Ga0495625_0464912 3300046660 Bacteria 779
357 Ga0495635_0034069 3300046663 Bacteria 3533
358 Ga0495659_0009416 3300046664 Bacteria 3116
359 Ga0495661_0166024 3300046665 Bacteria 1181
360 Ga0495588_0098559 3300046674 Bacteria 1535
361 Ga0495657_0195365 3300046675 Bacteria 1235
362 Ga0495646_0015081 3300046680 Bacteria 4909
363 Ga0495647_0018445 3300046681 Bacteria 2484
364 Ga0495658_0058293 3300046683 Bacteria 2209
365 Ga0495613_0458932 3300046689 Bacteria 862
366 Ga0495624_0007359 3300046690 Bacteria 7730
367 Ga0495671_0253469 3300046692 Bacteria 849
368 Ga0495649_0376548 3300046694 Bacteria 715
369 Ga0495581_0001509 3300047315 Bacteria 12960
370 Ga0495636_0186715 3300047318 Bacteria 942
371 Ga0495674_0000800 3300047319 Bacteria 29899
372 Ga0495674_0316278 3300047319 Bacteria 1273
373 Ga0495672_0009215 3300047320 Bacteria 7184
374 Ga0495672_0069078 3300047320 Bacteria 2006
375 Ga0495676_0136756 3300047321 Bacteria 1761
376 Ga0495680_0115380 3300047322 Bacteria 1987
377 Ga0495680_0224174 3300047322 Bacteria 1341
378 Ga0495677_0324633 3300047445 Bacteria 606
379 Ga0495685_024433 3300047447 Bacteria 2080
380 Ga0495686_0063075 3300047472 Bacteria 2297
381 Ga0495686_0243513 3300047472 Bacteria 1013
382 Ga0495686_0401230 3300047472 Bacteria 736
383 Ga0495593_0007327 3300047673 Bacteria 6463
384 Ga0496100_0142834 3300048903 Bacteria 1699
385 Ga0496100_0208461 3300048903 Bacteria 1428
386 Ga0496101_0011526 3300048904 Bacteria 5870
387 Ga0496101_0152401 3300048904 Bacteria 1769
388 Ga0496102_0033859 3300048905 Bacteria 4593
389 Ga0496102_0052386 3300048905 Bacteria 3718
390 Ga0496102_0375282 3300048905 Bacteria 1338
391 Ga0496102_1506163 3300048905 Bacteria 591
392 Ga0496103_0110465 3300048906 Bacteria 1746
393 Ga0496104_0003279 3300048907 Bacteria 13962
394 Ga0496104_1486197 3300048907 Bacteria 580
395 Ga0496105_0031909 3300048908 Bacteria 4320
396 Ga0496106_0070412 3300048909 Bacteria 2671
397 Ga0496106_0134652 3300048909 Bacteria 1940
398 Ga0496106_0148587 3300048909 Bacteria 1847
399 Ga0496106_0905386 3300048909 Bacteria 696
400 Ga0496107_0012368 3300048910 Bacteria 5957
401 Ga0496107_0152058 3300048910 Bacteria 1712
402 Ga0496108_0085246 3300048911 Bacteria 2681
403 Ga0496108_0133357 3300048911 Bacteria 2135
404 Ga0496108_0266482 3300048911 Bacteria 1491
405 Ga0496109_0101941 3300048912 Bacteria 2664
406 Ga0496109_0336007 3300048912 Bacteria 1426
407 Ga0496109_1088456 3300048912 Bacteria 736
408 Ga0496110_0036404 3300048913 Bacteria 4273
409 Ga0496110_0207473 3300048913 Bacteria 1781
410 Ga0496110_0288821 3300048913 Bacteria 1493
411 Ga0496110_1543000 3300048913 Bacteria 574
412 Ga0496111_0074157 3300048914 Bacteria 2478
413 Ga0496111_0397188 3300048914 Bacteria 1019
414 Ga0496111_0704123 3300048914 Bacteria 734
415 Ga0496112_0038622 3300048915 Bacteria 4662
416 Ga0496112_0129440 3300048915 Bacteria 2495
417 Ga0496113_0064504 3300048916 Bacteria 2769
418 Ga0496113_0168475 3300048916 Bacteria 1734
419 Ga0496114_0071957 3300048917 Bacteria 2907
420 Ga0496114_0366449 3300048917 Bacteria 1275
421 Ga0496114_0420465 3300048917 Bacteria 1184
422 Ga0496114_1160869 3300048917 Bacteria 658
423 Ga0496115_0017412 3300048918 Bacteria 5494
424 Ga0496115_0602750 3300048918 Bacteria 873
425 Ga0496116_0230180 3300048919 Bacteria 941
426 Ga0496117_0006861 3300048920 Bacteria 11313
427 Ga0496118_0017623 3300048921 Bacteria 6488
428 Ga0496118_0317988 3300048921 Bacteria 846
429 Ga0496118_0503603 3300048921 Bacteria 601
430 Ga0496121_0000300 3300048924 Bacteria 102506
431 Ga0496121_0081089 3300048924 Bacteria 2569
432 Ga0496121_0326404 3300048924 Bacteria 1031
433 Ga0496121_0465666 3300048924 Bacteria 811
434 Ga0496122_0027420 3300048925 Bacteria 4870
435 Ga0496124_0007174 3300048927 Bacteria 11912
436 Ga0496124_0019200 3300048927 Bacteria 6373
437 Ga0496125_0000063 3300048928 Bacteria 250260
438 Ga0496125_0000829 3300048928 Bacteria 49885
439 Ga0496125_0030098 3300048928 Bacteria 4863
440 Ga0496125_0396208 3300048928 Bacteria 808
441 Ga0496126_0068709 3300048929 Bacteria 3162
442 Ga0496126_0081730 3300048929 Bacteria 2855
443 Ga0496126_0280225 3300048929 Bacteria 1381
444 Ga0496126_0312304 3300048929 Bacteria 1294
445 Ga0495682_0121177 3300049460 Bacteria 936
446 Ga0501031_0179745 3300049568 Bacteria 1382
447 Ga0501031_0188267 3300049568 Bacteria 1348
448 Ga0501032_0011114 3300049569 Bacteria 6470
449 Ga0501033_0001919 3300049570 Bacteria 18099
450 Ga0501034_0030138 3300049571 Bacteria 5514
451 Ga0501034_0617747 3300049571 Bacteria 988
452 Ga0501036_0001524 3300049572 Bacteria 17885
453 Ga0501036_0133123 3300049572 Bacteria 2098
454 Ga0501036_0627997 3300049572 Bacteria 890
455 Ga0501037_0007979 3300049573 Bacteria 7760
456 Ga0501038_0001910 3300049574 Bacteria 19276
457 Ga0501038_0316467 3300049574 Bacteria 1222
458 Ga0501038_0916966 3300049574 Bacteria 646
459 Ga0501039_0000315 3300049575 Bacteria 34129
460 Ga0501041_1023722 3300049577 Bacteria 531
461 Ga0501042_0174039 3300049578 Bacteria 1553
462 Ga0501043_0004682 3300049579 Bacteria 11092
463 Ga0501043_0910151 3300049579 Bacteria 630
464 Ga0501046_0012679 3300049580 Bacteria 7168
465 Ga0501046_1162185 3300049580 Bacteria 531
466 Ga0501047_0024641 3300049581 Bacteria 5775
467 Ga0501047_0152567 3300049581 Bacteria 2185
468 Ga0501048_0014612 3300049582 Bacteria 5812
469 Ga0501067_0007332 3300049583 Bacteria 6127
470 Ga0501068_0044887 3300049584 Bacteria 2662
471 Ga0501068_0939189 3300049584 Bacteria 570
472 Ga0501069_0053537 3300049585 Bacteria 2247
473 Ga0501069_0303893 3300049585 Bacteria 936
474 Ga0501070_0001468 3300049586 Bacteria 21129
475 Ga0501071_0474489 3300049587 Bacteria 958
476 Ga0501072_0486893 3300049588 Bacteria 976
477 Ga0501073_0449976 3300049589 Bacteria 890
478 Ga0501073_1031201 3300049589 Bacteria 566
479 Ga0501074_0090509 3300049590 Bacteria 2191
480 Ga0501075_0831797 3300049591 Bacteria 702
481 Ga0501076_0089788 3300049592 Bacteria 2471
482 Ga0501077_0366783 3300049593 Bacteria 920
483 Ga0501079_0136602 3300049741 Bacteria 1909
484 Ga0501080_0017798 3300049742 Bacteria 6577
485 Ga0501081_0318998 3300049743 Bacteria 1142
486 Ga0501083_0330208 3300049744 Bacteria 992
487 Ga0501083_0731996 3300049744 Bacteria 643
488 Ga0501035_0001430 3300049822 Bacteria 24450
489 Ga0501035_0221921 3300049822 Bacteria 1613
490 Ga0501044_0010858 3300049823 Bacteria 9881
491 Ga0501044_0149420 3300049823 Bacteria 2319
492 Ga0501045_0318251 3300049824 Bacteria 1158
493 Ga0501045_0614016 3300049824 Bacteria 805
494 nmdc:mga03683_98044_c1 3300050489 Bacteria 1285
495 nmdc:mga03n38_656815_c1 3300050490 Bacteria 601
496 nmdc:mga00v17_148774_c1 3300050491 Bacteria 1504
497 nmdc:mga0yw44_169547_c1 3300050492 Bacteria 1433
498 nmdc:mga0yw44_301364_c1 3300050492 Bacteria 1074
499 nmdc:mga0yw44_4296_c1 3300050492 Bacteria 6503
500 nmdc:mga0yw44_65009_c1 3300050492 Bacteria 2247
501 nmdc:mga0k408_217855_c1 3300050493 Bacteria 1140
502 nmdc:mga06z11_588609_c1 3300050494 Bacteria 677
503 nmdc:mga04h51_5632_c1 3300050495 Bacteria 3203
504 nmdc:mga07m45_13087_c1 3300050496 Bacteria 1359
505 nmdc:mga07m45_420714_c1 3300050496 Bacteria 775
506 nmdc:mga07m45_66526_c1 3300050496 Bacteria 2048
507 nmdc:mga05p37_522894_c1 3300050507 Bacteria 1357
508 nmdc:mga0qj67_1560431_c1 3300050509 Bacteria 507
509 nmdc:mga08y16_355895_c1 3300050511 Bacteria 1503
510 nmdc:mga0sz30_82081_c1 3300050516 Bacteria 1396
511 Ga0500635_0127148 3300053080 Bacteria 958
512 Ga0495655_0283369 3300053083 Bacteria 565
513 Ga0495619_0220756 3300053085 Bacteria 1313
514 Ga0500643_035136 3300053087 Bacteria 1505
515 Ga0500581_113244 3300053089 Bacteria 1319
516 Ga0500651_0370230 3300053093 Bacteria 810
517 Ga0500566_0272645 3300053094 Bacteria 811
518 Ga0500641_0022766 3300053096 Bacteria 2403
519 Ga0500595_002536 3300053119 Bacteria 8969
520 Ga0500595_034756 3300053119 Bacteria 1665
521 Ga0500595_101849 3300053119 Bacteria 822
522 Ga0500617_251514 3300053124 Bacteria 598
523 Ga0500559_0089657 3300053136 Bacteria 1406
524 Ga0500568_0009301 3300053139 Bacteria 4679
525 Ga0500577_0000307 3300053142 Bacteria 12613
526 Ga0500577_0154911 3300053142 Bacteria 973
527 Ga0500585_254812 3300053144 Bacteria 555
528 Ga0500589_205498 3300053147 Bacteria 753
529 Ga0500590_311913 3300053148 Bacteria 585
530 Ga0500603_246504 3300053150 Bacteria 574
531 Ga0500616_0293304 3300053153 Bacteria 678
532 Ga0500627_0244226 3300053158 Bacteria 796
533 Ga0500638_082486 3300053162 Bacteria 1525
534 Ga0500639_198774 3300053163 Bacteria 864
535 Ga0500636_0016159 3300053177 Bacteria 4401
536 Ga0500611_011645 3300053727 Bacteria 1462
537 Ga0500611_149496 3300053727 Bacteria 640
538 Ga0500645_050293 3300053730 Bacteria 1217
539 Ga0500645_103432 3300053730 Bacteria 802
540 Ga0500552_089604 3300053733 Bacteria 574
541 Ga0500596_002515 3300053735 Bacteria 3616
542 Ga0501082_0147622 3300060353 Bacteria 2042
543 2513695423 2513237101 Bacteria 7952346
544 2644287691 2643221651 Bacteria 4798932
545 2723843813 2721755755 Bacteria 8322773
546 2874612205 2874604998 Bacteria 7834745
547 2876814638 2876808645 Bacteria 8824342
548 2879114718 2879110137 Bacteria 8907982
549 2889041986 2889033259 Bacteria 9099371
550 2922366147 2922361189 Bacteria 7436256
551 8006964974 8006964411 Bacteria 8966052
552 8006991627 8006984368 Bacteria 9651211
553 8006994334 8006994254 Bacteria 8309700
554 Ga0099795_10402898
555 JGI25404J52841_10015633
556 JGI25404J52841_10036052
557 Ga0065712_10421206
558 Ga0065707_11030489
559 Ga0070676_10189965
560 Ga0070690_101359056
561 Ga0068869_100050550
562 Ga0068869_100414944
563 Ga0068869_100658404
564 Ga0068868_100043625
565 Ga0068868_100349231
566 Ga0070661_100164671
567 Ga0070668_100108529
568 Ga0070668_101266193
569 Ga0070675_101080399
570 Ga0070671_100356558
571 Ga0070673_100186114
572 Ga0070688_100593803
573 Ga0070659_101273395
574 Ga0070667_100532648
575 Ga0070703_10524122
576 Ga0070709_10127763
577 Ga0070709_10862983
578 Ga0070714_100048723
579 Ga0070713_101077088
580 Ga0070713_102268055
581 Ga0070710_10023043
582 Ga0070710_10054541
583 Ga0070710_11028035
584 Ga0070711_100180136
585 Ga0070711_100224975
586 Ga0070711_100812033
587 Ga0070700_100420752
588 Ga0070694_100450067
589 Ga0070663_100027547
590 Ga0070663_101192423
591 Ga0070678_100113092
592 Ga0070678_100262343
593 Ga0070662_100383237
594 Ga0068867_100328884
595 Ga0068867_100758037
596 Ga0068867_101861213
597 Ga0070706_100803552
598 Ga0070698_100201034
599 Ga0070699_101753302
600 Ga0070679_100985606
601 Ga0070684_100079296
602 Ga0070697_100907847
603 Ga0068853_100130695
604 Ga0068853_100940276
605 Ga0070672_101173013
606 Ga0070695_100784048
607 Ga0070696_100547616
608 Ga0070693_100174652
609 Ga0070665_100052564
610 Ga0070665_100087698
611 Ga0070665_100134784
612 Ga0070665_100218246
613 Ga0070665_100248494
614 Ga0070665_100745462
615 Ga0070665_100801999
616 Ga0070704_100650543
617 Ga0068855_100463023
618 Ga0068857_100104388
619 Ga0068857_100540803
620 Ga0068856_100083630
621 Ga0070702_100071763
622 Ga0070702_100590869
623 Ga0068852_100082137
624 Ga0068852_100082162
625 Ga0068859_100319140
626 Ga0068859_101133482
627 Ga0068864_100081180
628 Ga0068864_100171440
629 Ga0068861_101278752
630 Ga0068851_10637798
631 Ga0068863_100093927
632 Ga0068863_100471671
633 Ga0068863_102039845
634 Ga0068863_102471487
635 Ga0068858_100084146
636 Ga0068858_100084897
637 Ga0068860_100461839
638 Ga0068860_101518556
639 Ga0068862_100548495
640 Ga0068862_101788835
641 Ga0081455_10084969
642 Ga0081455_10107507
643 Ga0081540_1008103
644 Ga0081540_1023408
645 Ga0081540_1034235
646 Ga0081540_1079811
647 Ga0081540_1089967
648 Ga0081539_10027924
649 Ga0081539_10150519
650 Ga0070717_10378729
651 Ga0070717_10645658
652 Ga0075365_10032990
653 Ga0075365_10387877
654 Ga0075368_10014000
655 Ga0075368_10190305
656 Ga0075363_100083181
657 Ga0075363_100229813
658 Ga0075364_10156654
659 Ga0070716_100038792
660 Ga0070716_100225444
661 Ga0070716_100692000
662 Ga0070712_100475966
663 Ga0070712_100542242
664 Ga0070712_101316212
665 Ga0075362_10268753
666 Ga0075362_10453096
667 Ga0075367_10030569
668 Ga0075367_10748905
669 Ga0075369_10299636
670 Ga0075366_10069034
671 Ga0097621_100292508
672 Ga0097621_100492275
673 Ga0075370_10041029
674 Ga0075370_10092843
675 Ga0075370_10189553
676 Ga0075370_10639136
677 Ga0068871_101271680
678 Ga0075428_100293190
679 Ga0075431_100946525
680 Ga0075434_101068850
681 Ga0068865_100015863
682 Ga0068865_100193794
683 Ga0068865_102083207
684 Ga0097620_100319145
685 Ga0097620_101133607
686 Ga0075435_100107260
687 Ga0099795_10004600
688 Ga0105240_11014175
689 Ga0105247_10036791
690 Ga0105247_10083772
691 Ga0105247_10162633
692 Ga0105247_10209592
693 Ga0105247_10984259
694 Ga0105243_10264399
695 Ga0105243_10878434
696 Ga0105243_11876885
697 Ga0105243_12442443
698 Ga0105241_10015897
699 Ga0105241_10299328
700 Ga0105241_10853122
701 Ga0105242_11173684
702 Ga0105242_12511705
703 Ga0105242_12847842
704 Ga0105248_10652925
705 Ga0105248_11104550
706 Ga0105237_10022581
707 Ga0105237_10057863
708 Ga0105237_10127309
709 Ga0105237_12215167
710 Ga0105238_10039519
711 Ga0105238_10711849
712 Ga0105238_11372346
713 Ga0105249_10438570
714 Ga0105249_11323712
715 Ga0105249_12337693
716 Ga0099796_10047222
717 Ga0099796_10094555
718 Ga0105239_10046043
719 Ga0105239_10123482
720 Ga0105239_10165073
721 Ga0105239_10550981
722 Ga0105239_10609095
723 Ga0105246_10013180
724 Ga0105246_10023635
725 Ga0105246_10211994
726 Ga0105246_10426089
727 Ga0105246_11212268
728 Ga0157325_1013889
729 Ga0157369_11414985
730 Ga0157374_10015024
731 Ga0157374_10560289
732 Ga0157378_10046962
733 Ga0163162_10069493
734 Ga0163162_10077388
735 Ga0157375_10229624
736 Ga0157375_10508586
737 Ga0163163_10072107
738 Ga0163163_10696483
739 Ga0163163_11800146
740 Ga0182008_10450108
741 Ga0157379_10060619
742 Ga0157379_10117931
743 Ga0157379_10908301
744 Ga0157379_11065273
745 Ga0182007_10060652
746 Ga0163161_10541100
747 Ga0209758_1148667
748 Ga0207697_10158943
749 Ga0207656_10359781
750 Ga0207692_10007759
751 Ga0207692_10087879
752 Ga0207642_10861646
753 Ga0207710_10047085
754 Ga0207710_10103074
755 Ga0207688_10022646
756 Ga0207688_10803108
757 Ga0207680_10302967
758 Ga0207647_10191499
759 Ga0207685_10016818
760 Ga0207699_10134421
761 Ga0207645_10089854
762 Ga0207654_10017061
763 Ga0207707_10561760
764 Ga0207671_10021468
765 Ga0207671_10105706
766 Ga0207671_10131495
767 Ga0207693_10026107
768 Ga0207663_10016972
769 Ga0207663_10103400
770 Ga0207663_11544355
771 Ga0207657_10048928
772 Ga0207694_10222029
773 Ga0207694_10351365
774 Ga0207687_10437047
775 Ga0207687_10556264
776 Ga0207700_10467541
777 Ga0207664_10061473
778 Ga0207690_10282922
779 Ga0207709_10708906
780 Ga0207669_10483642
781 Ga0207665_10006600
782 Ga0207665_10037926
783 Ga0207665_10141847
784 Ga0207689_10023055
785 Ga0207689_10562450
786 Ga0207679_10574515
787 Ga0207667_10427277
788 Ga0207651_10326890
789 Ga0207712_11255606
790 Ga0207668_10006793
791 Ga0207668_10018111
792 Ga0207640_11422587
793 Ga0207677_10544974
794 Ga0207677_11311854
795 Ga0207703_10420689
796 Ga0207639_10433371
797 Ga0207678_10019922
798 Ga0207678_10059413
799 Ga0207702_10654606
800 Ga0207648_10960814
801 Ga0207676_10078239
802 Ga0207676_10306891
803 Ga0207674_10218330
804 Ga0207675_100022591
805 Ga0207675_100108952
806 Ga0207675_101036255
807 Ga0207683_10229554
808 Ga0207683_10277452
809 Ga0207683_11113910
810 Ga0268266_10018788
811 Ga0268266_10176311
812 Ga0268266_10220748
813 Ga0268266_10843711
814 Ga0268265_10953412
815 Ga0268265_10972123
816 Ga0268265_11470257
817 Ga0268264_10966773
818 Ga0307517_10000049
819 Ga0307511_10251616
820 Ga0265330_10032541
821 Ga0265332_10300787
822 Ga0307513_10281979
823 Ga0307509_10355449
824 Ga0307509_10644551
825 Ga0265314_10161721
826 Ga0307516_10155389
827 Ga0307516_10215453
828 Ga0307516_10436026
829 Ga0307413_10302990
830 Ga0307413_11872409
831 Ga0307410_11048239
832 Ga0307407_10585463
833 Ga0307409_100591362
834 Ga0307416_101337331
835 Ga0307414_10507391
836 Ga0307411_10048851
837 Ga0307411_10926972
838 Ga0307415_101755595
839 Ga0307507_10028511
840 Ga0307507_10459591
841 Ga0307510_10019125
842 Ga0373926_0065391
843 Ga0373929_0222301
844 Ga0373939_0542243
845 Ga0373945_0022646
846 Ga0373957_0182306
847 Ga0373960_0113028
848 Ga0373943_0097717
849 Ga0373962_0271829
850 Ga0373931_0019229
851 Ga0373935_0908009
852 Ga0373935_1293990
853 Ga0373927_0025338
854 Ga0373927_0267003
855 Ga0373947_0012691
856 Ga0373947_0052397
857 Ga0373937_0137155
858 Ga0373925_0055439
859 Ga0373925_0180335
860 Ga0373925_0304569
861 Ga0373925_1039985
862 Ga0439465_0390234
863 Ga0451798_0054717
864 Ga0451802_0016731
865 Ga0451807_2433274
866 Ga0451833_0549399
867 Ga0451837_0965192
868 Ga0451845_0351543
869 Ga0451849_0416983
870 Ga0451843_1602963
871 Ga0439458_0015540
872 Ga0495592_0062970
873 Ga0495603_0221870
874 Ga0495629_0000672
875 Ga0495641_0069362
876 Ga0495580_0379071
877 Ga0495580_0892867
878 Ga0495582_0000336
879 Ga0495639_0003517
880 Ga0495639_0061154
881 Ga0495662_0039941
882 Ga0495664_0101556
883 Ga0495664_0213173
884 Ga0495584_0144028
885 Ga0495585_0071968
886 Ga0495594_0024895
887 Ga0495594_0239278
888 Ga0495594_0392737
889 Ga0495606_0552513
890 Ga0495616_0114189
891 Ga0495628_0098144
892 Ga0495628_0568245
893 Ga0495630_0030718
894 Ga0495631_0260842
895 Ga0495632_0178695
896 Ga0495637_0088952
897 Ga0495644_0286228
898 Ga0495648_0006790
899 Ga0495648_0011875
900 Ga0495666_0028613
901 Ga0495665_0044788
902 Ga0495586_0607738
903 Ga0495609_0167392
904 Ga0495622_0045288
905 Ga0495622_0226322
906 Ga0495633_0065136
907 Ga0495634_0005588
908 Ga0495625_0175918
909 Ga0495625_0464912
910 Ga0495635_0034069
911 Ga0495659_0009416
912 Ga0495661_0166024
913 Ga0495588_0098559
914 Ga0495657_0195365
915 Ga0495646_0015081
916 Ga0495647_0018445
917 Ga0495658_0058293
918 Ga0495613_0458932
919 Ga0495624_0007359
920 Ga0495671_0253469
921 Ga0495649_0376548
922 Ga0495581_0001509
923 Ga0495636_0186715
924 Ga0495674_0000800
925 Ga0495674_0316278
926 Ga0495672_0009215
927 Ga0495672_0069078
928 Ga0495676_0136756
929 Ga0495680_0115380
930 Ga0495680_0224174
931 Ga0495677_0324633
932 Ga0495685_024433
933 Ga0495686_0063075
934 Ga0495686_0243513
935 Ga0495686_0401230
936 Ga0495593_0007327
937 Ga0496100_0142834
938 Ga0496100_0208461
939 Ga0496101_0011526
940 Ga0496101_0152401
941 Ga0496102_0033859
942 Ga0496102_0052386
943 Ga0496102_0375282
944 Ga0496102_1506163
945 Ga0496103_0110465
946 Ga0496104_0003279
947 Ga0496104_1486197
948 Ga0496105_0031909
949 Ga0496106_0070412
950 Ga0496106_0134652
951 Ga0496106_0148587
952 Ga0496106_0905386
953 Ga0496107_0012368
954 Ga0496107_0152058
955 Ga0496108_0085246
956 Ga0496108_0133357
957 Ga0496108_0266482
958 Ga0496109_0101941
959 Ga0496109_0336007
960 Ga0496109_1088456
961 Ga0496110_0036404
962 Ga0496110_0207473
963 Ga0496110_0288821
964 Ga0496110_1543000
965 Ga0496111_0074157
966 Ga0496111_0397188
967 Ga0496111_0704123
968 Ga0496112_0038622
969 Ga0496112_0129440
970 Ga0496113_0064504
971 Ga0496113_0168475
972 Ga0496114_0071957
973 Ga0496114_0366449
974 Ga0496114_0420465
975 Ga0496114_1160869
976 Ga0496115_0017412
977 Ga0496115_0602750
978 Ga0496116_0230180
979 Ga0496117_0006861
980 Ga0496118_0017623
981 Ga0496118_0317988
982 Ga0496118_0503603
983 Ga0496121_0000300
984 Ga0496121_0081089
985 Ga0496121_0326404
986 Ga0496121_0465666
987 Ga0496122_0027420
988 Ga0496124_0007174
989 Ga0496124_0019200
990 Ga0496125_0000063
991 Ga0496125_0000829
992 Ga0496125_0030098
993 Ga0496125_0396208
994 Ga0496126_0068709
995 Ga0496126_0081730
996 Ga0496126_0280225
997 Ga0496126_0312304
998 Ga0495682_0121177
999 Ga0501031_0179745
1000 Ga0501031_0188267
1001 Ga0501032_0011114
1002 Ga0501033_0001919
1003 Ga0501034_0030138
1004 Ga0501034_0617747
1005 Ga0501036_0001524
1006 Ga0501036_0133123
1007 Ga0501036_0627997
1008 Ga0501037_0007979
1009 Ga0501038_0001910
1010 Ga0501038_0316467
1011 Ga0501038_0916966
1012 Ga0501039_0000315
1013 Ga0501041_1023722
1014 Ga0501042_0174039
1015 Ga0501043_0004682
1016 Ga0501043_0910151
1017 Ga0501046_0012679
1018 Ga0501046_1162185
1019 Ga0501047_0024641
1020 Ga0501047_0152567
1021 Ga0501048_0014612
1022 Ga0501067_0007332
1023 Ga0501068_0044887
1024 Ga0501068_0939189
1025 Ga0501069_0053537
1026 Ga0501069_0303893
1027 Ga0501070_0001468
1028 Ga0501071_0474489
1029 Ga0501072_0486893
1030 Ga0501073_0449976
1031 Ga0501073_1031201
1032 Ga0501074_0090509
1033 Ga0501075_0831797
1034 Ga0501076_0089788
1035 Ga0501077_0366783
1036 Ga0501079_0136602
1037 Ga0501080_0017798
1038 Ga0501081_0318998
1039 Ga0501083_0330208
1040 Ga0501083_0731996
1041 Ga0501035_0001430
1042 Ga0501035_0221921
1043 Ga0501044_0010858
1044 Ga0501044_0149420
1045 Ga0501045_0318251
1046 Ga0501045_0614016
1047 nmdc:mga03683_98044_c1
1048 nmdc:mga03n38_656815_c1
1049 nmdc:mga00v17_148774_c1
1050 nmdc:mga0yw44_169547_c1
1051 nmdc:mga0yw44_301364_c1
1052 nmdc:mga0yw44_4296_c1
1053 nmdc:mga0yw44_65009_c1
1054 nmdc:mga0k408_217855_c1
1055 nmdc:mga06z11_588609_c1
1056 nmdc:mga04h51_5632_c1
1057 nmdc:mga07m45_13087_c1
1058 nmdc:mga07m45_420714_c1
1059 nmdc:mga07m45_66526_c1
1060 nmdc:mga05p37_522894_c1
1061 nmdc:mga0qj67_1560431_c1
1062 nmdc:mga08y16_355895_c1
1063 nmdc:mga0sz30_82081_c1
1064 Ga0500635_0127148
1065 Ga0495655_0283369
1066 Ga0495619_0220756
1067 Ga0500643_035136
1068 Ga0500581_113244
1069 Ga0500651_0370230
1070 Ga0500566_0272645
1071 Ga0500641_0022766
1072 Ga0500595_002536
1073 Ga0500595_034756
1074 Ga0500595_101849
1075 Ga0500617_251514
1076 Ga0500559_0089657
1077 Ga0500568_0009301
1078 Ga0500577_0000307
1079 Ga0500577_0154911
1080 Ga0500585_254812
1081 Ga0500589_205498
1082 Ga0500590_311913
1083 Ga0500603_246504
1084 Ga0500616_0293304
1085 Ga0500627_0244226
1086 Ga0500638_082486
1087 Ga0500639_198774
1088 Ga0500636_0016159
1089 Ga0500611_011645
1090 Ga0500611_149496
1091 Ga0500645_050293
1092 Ga0500645_103432
1093 Ga0500552_089604
1094 Ga0500596_002515
1095 Ga0501082_0147622
1096 2513695423
1097 2644287691
1098 2723843813
1099 2874612205
1100 2876814638
1101 2879114718
1102 2889041986
1103 2922366147
1104 8006964974
1105 8006991627
1106 8006994334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10135

Rod-binding

Rod binding protein

59

110

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7boi-assembly1.cif.gz_T bacterial 30s ribosomal subunit assembly complex state f (multibody refinement for body domain of 30s ribosome) 0.4142 32 112
8a3l-assembly1.cif.gz_T structural insights into the binding of bs1 to the ribosome 0.414 32 112
6w7w-assembly1.cif.gz_S 30s-inactive-low-mg2+ class b 0.4103 32 110
8akn-assembly1.cif.gz_U cryo-em structure of the proline-rich antimicrobial peptide drosocin bound to the terminating ribosome 0.4084 32 112
6wdg-assembly1.cif.gz_Y cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (cognate structure vi-b) 0.408 32 112
ID Description Score Start End Superfamily
4hybA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4802 30 111 1.20.1270.10
4f01A02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4721 30 111 1.20.1270.10
4hybA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4591 30 111 1.20.1270.10
4f01A02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4465 30 111 1.20.1270.10
4ezoA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4413 30 111 1.20.1270.10
ID Description Score Start End GO Terms
AF-Q1QNN0-F1-model_v4 Flagellar protein FlgJ N-terminal domain-containing protein 0.6485 15 112
AF-A0A1Q3JVF7-F1-model_v4 Chemotaxis protein chel 0.6446 14 112
AF-A0A0Q6Z2E2-F1-model_v4 Chemotaxis protein chel 0.643 14 112
AF-Q6N2Y7-F1-model_v4 Flagellar protein FlgJ N-terminal domain-containing protein 0.6424 15 110
AF-A0A3A0F5S4-F1-model_v4 Chemotaxis protein chel 0.6421 17 112

Map