F462738

General Info

Members Datasets Scaffolds Average Seq Length
552 286 1104 191

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10779825|Ga0207702_107798251
Length 225
Sequence MTGPVNPLLDVPDVDGPYQPHSGQRWSGFLTEPLRWGTTPSATVGPYLAIGLTWPDGVWAAKEGAEGAVWIRGRVFDGNGDLVPDAMIETWQADPDGRFNTPEDPRGASEYPGFRGFARSETSDPPGEFAVHTLKPGRVPDGEGGLQAPHIDVSVFARGILDRVVTRIYFADEAEANAQDAVLRGLSDEQRRTLVAEKTDDGYRFDVHLQSCTEKGMDETVFFSV

Samples

Sample ID Description Type Environment
1 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
178 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
179 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
180 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
181 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
182 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
279 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
285 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
286 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.36
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.36
Nodule 0
Rhizoplane 9.24
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207702_10779825 3300026078 Bacteria 944
2 JGI25406J46586_10018575 3300003203 Bacteria 2855
3 JGI25406J46586_10040029 3300003203 Bacteria 1665
4 JGI25406J46586_10042827 3300003203 Bacteria 1581
5 JGI25407J50210_10003242 3300003373 Bacteria 3873
6 Ga0070658_10000338 3300005327 Bacteria 40418
7 Ga0070658_10030129 3300005327 Bacteria 4361
8 Ga0070683_100332858 3300005329 Bacteria 1446
9 Ga0070690_101236663 3300005330 Bacteria 596
10 Ga0070670_100178706 3300005331 Bacteria 1842
11 Ga0068869_101002375 3300005334 Bacteria 727
12 Ga0070682_100751986 3300005337 Bacteria 787
13 Ga0068868_100230880 3300005338 Bacteria 1552
14 Ga0068868_100703824 3300005338 Bacteria 904
15 Ga0070660_100266890 3300005339 Bacteria 1398
16 Ga0070691_10108183 3300005341 Bacteria 1388
17 Ga0070687_100175530 3300005343 Bacteria 1279
18 Ga0070661_100399281 3300005344 Bacteria 1087
19 Ga0070692_10455793 3300005345 Bacteria 819
20 Ga0070668_100007909 3300005347 Bacteria 7895
21 Ga0070668_100053199 3300005347 Bacteria 3122
22 Ga0070669_100646224 3300005353 Bacteria 890
23 Ga0070675_100333089 3300005354 Bacteria 1343
24 Ga0070673_100796856 3300005364 Bacteria 872
25 Ga0070659_100824311 3300005366 Bacteria 808
26 Ga0070667_100003752 3300005367 Bacteria 12904
27 Ga0070667_100430975 3300005367 Bacteria 1203
28 Ga0070667_100503986 3300005367 Bacteria 1110
29 Ga0070667_100771226 3300005367 Bacteria 892
30 Ga0070709_10012896 3300005434 Bacteria 4684
31 Ga0070709_10025527 3300005434 Bacteria 3492
32 Ga0070714_100000491 3300005435 Bacteria 28628
33 Ga0070714_100018644 3300005435 Bacteria 5641
34 Ga0070714_100056919 3300005435 Bacteria 3345
35 Ga0070714_100558524 3300005435 Bacteria 1096
36 Ga0070713_100010893 3300005436 Bacteria 6593
37 Ga0070713_100171495 3300005436 Bacteria 1944
38 Ga0070713_101010318 3300005436 Bacteria 802
39 Ga0070710_10007573 3300005437 Bacteria 5260
40 Ga0070710_10069347 3300005437 Bacteria 2028
41 Ga0070711_100106203 3300005439 Bacteria 2052
42 Ga0070711_100719024 3300005439 Bacteria 842
43 Ga0070705_100048093 3300005440 Bacteria 2469
44 Ga0070694_100933435 3300005444 Bacteria 718
45 Ga0070708_100044212 3300005445 Bacteria 3916
46 Ga0070708_100064222 3300005445 Bacteria 3289
47 Ga0070678_100637310 3300005456 Bacteria 955
48 Ga0070662_100088354 3300005457 Bacteria 2323
49 Ga0070681_10706370 3300005458 Bacteria 924
50 Ga0070681_11192402 3300005458 Bacteria 683
51 Ga0068867_100048255 3300005459 Bacteria 3132
52 Ga0068867_100877026 3300005459 Bacteria 806
53 Ga0070707_100020775 3300005468 Bacteria 6198
54 Ga0070707_100047965 3300005468 Bacteria 4090
55 Ga0070698_100090368 3300005471 Bacteria 3046
56 Ga0070679_100167393 3300005530 Bacteria 2171
57 Ga0070679_100458130 3300005530 Bacteria 1220
58 Ga0070684_100417735 3300005535 Bacteria 1238
59 Ga0070684_100661220 3300005535 Bacteria 973
60 Ga0070697_100196637 3300005536 Bacteria 1713
61 Ga0068853_101199189 3300005539 Bacteria 733
62 Ga0070696_100021847 3300005546 Bacteria 4341
63 Ga0070693_100562828 3300005547 Bacteria 818
64 Ga0070665_100003764 3300005548 Bacteria 16053
65 Ga0070665_100200279 3300005548 Bacteria 1997
66 Ga0070665_100516584 3300005548 Bacteria 1206
67 Ga0070704_100715913 3300005549 Bacteria 889
68 Ga0068855_101108854 3300005563 Bacteria 827
69 Ga0068854_100068239 3300005578 Bacteria 2592
70 Ga0068854_100194447 3300005578 Bacteria 1591
71 Ga0068856_100046784 3300005614 Bacteria 4261
72 Ga0068856_100080348 3300005614 Bacteria 3234
73 Ga0068856_100875499 3300005614 Bacteria 917
74 Ga0070702_100047415 3300005615 Bacteria 2440
75 Ga0068864_100046662 3300005618 Bacteria 3718
76 Ga0068864_101165627 3300005618 Bacteria 768
77 Ga0068866_10267359 3300005718 Bacteria 1054
78 Ga0068851_10053167 3300005834 Bacteria 2061
79 Ga0068863_100023974 3300005841 Bacteria 5823
80 Ga0068863_100091306 3300005841 Bacteria 2888
81 Ga0068863_100364541 3300005841 Bacteria 1409
82 Ga0068860_100492502 3300005843 Bacteria 1223
83 Ga0068860_100685287 3300005843 Bacteria 1034
84 Ga0068862_100000591 3300005844 Bacteria 37734
85 Ga0068862_100217293 3300005844 Bacteria 1729
86 Ga0081455_10051524 3300005937 Bacteria 3530
87 Ga0081538_10007786 3300005981 Bacteria 9202
88 Ga0081538_10013357 3300005981 Bacteria 6507
89 Ga0081538_10014327 3300005981 Bacteria 6213
90 Ga0081538_10028529 3300005981 Bacteria 3836
91 Ga0081538_10095670 3300005981 Bacteria 1516
92 Ga0081538_10115594 3300005981 Bacteria 1304
93 Ga0081538_10165424 3300005981 Bacteria 975
94 Ga0081540_1020575 3300005983 Bacteria 3962
95 Ga0081539_10000420 3300005985 Bacteria 90166
96 Ga0081539_10000538 3300005985 Bacteria 78469
97 Ga0081539_10004989 3300005985 Bacteria 14032
98 Ga0081539_10033254 3300005985 Bacteria 3144
99 Ga0070717_10008406 3300006028 Bacteria 7709
100 Ga0070717_10010134 3300006028 Bacteria 7097
101 Ga0070717_10016274 3300006028 Bacteria 5764
102 Ga0070717_10059081 3300006028 Bacteria 3172
103 Ga0070717_10384694 3300006028 Bacteria 1258
104 Ga0075432_10005895 3300006058 Bacteria 4170
105 Ga0070715_10001287 3300006163 Bacteria 7186
106 Ga0070715_10035527 3300006163 Bacteria 2050
107 Ga0070716_100015500 3300006173 Bacteria 3917
108 Ga0070716_100198847 3300006173 Bacteria 1330
109 Ga0070712_100006582 3300006175 Bacteria 7216
110 Ga0070712_100096319 3300006175 Bacteria 2179
111 Ga0070712_100592139 3300006175 Bacteria 938
112 Ga0075428_100205572 3300006844 Bacteria 2128
113 Ga0075428_100508727 3300006844 Bacteria 1288
114 Ga0075430_100000242 3300006846 Bacteria 37737
115 Ga0075430_100102679 3300006846 Bacteria 2387
116 Ga0075433_10021690 3300006852 Bacteria 5387
117 Ga0075433_10023853 3300006852 Bacteria 5155
118 Ga0075434_100011970 3300006871 Bacteria 8207
119 Ga0075434_100037089 3300006871 Bacteria 4825
120 Ga0068865_100195158 3300006881 Bacteria 1568
121 Ga0068865_100677932 3300006881 Bacteria 879
122 Ga0075435_100181404 3300007076 Bacteria 1779
123 Ga0075435_100182381 3300007076 Bacteria 1774
124 Ga0105250_10124254 3300009092 Bacteria 1062
125 Ga0111539_10010281 3300009094 Bacteria 11779
126 Ga0111539_10928577 3300009094 Bacteria 1012
127 Ga0105245_10981426 3300009098 Bacteria 889
128 Ga0105245_11261958 3300009098 Bacteria 787
129 Ga0105245_11442550 3300009098 Bacteria 739
130 Ga0114129_10025453 3300009147 Bacteria 8387
131 Ga0114129_10144111 3300009147 Bacteria 3264
132 Ga0105243_10551239 3300009148 Bacteria 1102
133 Ga0105242_10268421 3300009176 Bacteria 1544
134 Ga0105248_10599559 3300009177 Bacteria 1243
135 Ga0105238_10461373 3300009551 Bacteria 1268
136 Ga0105238_10608257 3300009551 Bacteria 1101
137 Ga0105238_10611063 3300009551 Bacteria 1099
138 Ga0105249_10002880 3300009553 Bacteria 14852
139 Ga0105249_10133036 3300009553 Bacteria 2376
140 Ga0099796_10061026 3300010159 Bacteria 1336
141 Ga0105239_10222907 3300010375 Bacteria 2115
142 Ga0105239_11426343 3300010375 Bacteria 800
143 Ga0157370_10057658 3300013104 Bacteria 3692
144 Ga0157369_10440513 3300013105 Bacteria 1350
145 Ga0157369_10922792 3300013105 Bacteria 895
146 Ga0157374_10115852 3300013296 Bacteria 2582
147 Ga0157375_12277659 3300013308 Bacteria 646
148 Ga0163163_10327952 3300014325 Bacteria 1585
149 Ga0157380_10275908 3300014326 Bacteria 1535
150 Ga0157379_10296679 3300014968 Bacteria 1473
151 Ga0206353_11711586 3300020082 Bacteria 3104
152 Ga0206353_12013433 3300020082 Bacteria 1031
153 Ga0213875_10113533 3300021388 Bacteria 1266
154 Ga0207656_10060159 3300025321 Bacteria 1664
155 Ga0207692_10005044 3300025898 Bacteria 5260
156 Ga0207692_10009874 3300025898 Bacteria 4001
157 Ga0207692_10009987 3300025898 Bacteria 3982
158 Ga0207692_10022716 3300025898 Bacteria 2890
159 Ga0207685_10003609 3300025905 Bacteria 3791
160 Ga0207685_10093391 3300025905 Bacteria 1272
161 Ga0207685_10135353 3300025905 Bacteria 1099
162 Ga0207685_10163464 3300025905 Bacteria 1018
163 Ga0207699_10000854 3300025906 Bacteria 14497
164 Ga0207699_10001661 3300025906 Bacteria 10552
165 Ga0207699_10015978 3300025906 Bacteria 3914
166 Ga0207699_10057957 3300025906 Bacteria 2315
167 Ga0207705_10006101 3300025909 Bacteria 8968
168 Ga0207684_10458820 3300025910 Bacteria 1094
169 Ga0207707_10741118 3300025912 Bacteria 822
170 Ga0207695_10031465 3300025913 Bacteria 5818
171 Ga0207693_10011505 3300025915 Bacteria 7156
172 Ga0207693_10056016 3300025915 Bacteria 3091
173 Ga0207693_10088936 3300025915 Bacteria 2420
174 Ga0207693_10215094 3300025915 Bacteria 1510
175 Ga0207693_10447187 3300025915 Bacteria 1010
176 Ga0207693_10447188 3300025915 Bacteria 1010
177 Ga0207663_10003570 3300025916 Bacteria 7634
178 Ga0207663_10011675 3300025916 Bacteria 4727
179 Ga0207663_10271522 3300025916 Bacteria 1256
180 Ga0207663_10352874 3300025916 Bacteria 1114
181 Ga0207662_10172242 3300025918 Bacteria 1388
182 Ga0207657_10927939 3300025919 Bacteria 670
183 Ga0207652_10355371 3300025921 Bacteria 1322
184 Ga0207646_10026392 3300025922 Bacteria 5301
185 Ga0207646_10053965 3300025922 Bacteria 3595
186 Ga0207646_10182531 3300025922 Bacteria 1895
187 Ga0207681_10099347 3300025923 Bacteria 2096
188 Ga0207694_10281177 3300025924 Bacteria 1367
189 Ga0207694_10712228 3300025924 Bacteria 847
190 Ga0207659_10289278 3300025926 Bacteria 1342
191 Ga0207687_10188333 3300025927 Bacteria 1604
192 Ga0207700_10020046 3300025928 Bacteria 4531
193 Ga0207700_10062583 3300025928 Bacteria 2827
194 Ga0207700_10249707 3300025928 Bacteria 1515
195 Ga0207700_10323904 3300025928 Bacteria 1336
196 Ga0207664_10000648 3300025929 Bacteria 24123
197 Ga0207664_10004443 3300025929 Bacteria 9498
198 Ga0207664_10006206 3300025929 Bacteria 8207
199 Ga0207664_10101890 3300025929 Bacteria 2373
200 Ga0207664_10244363 3300025929 Bacteria 1564
201 Ga0207690_10005818 3300025932 Bacteria 7295
202 Ga0207690_10774854 3300025932 Bacteria 792
203 Ga0207706_10173996 3300025933 Bacteria 1891
204 Ga0207686_10427266 3300025934 Bacteria 1015
205 Ga0207669_10095144 3300025937 Bacteria 1952
206 Ga0207665_10000801 3300025939 Bacteria 21278
207 Ga0207665_10007035 3300025939 Bacteria 7450
208 Ga0207691_10414286 3300025940 Bacteria 1148
209 Ga0207711_10198413 3300025941 Bacteria 1830
210 Ga0207689_10064059 3300025942 Bacteria 3024
211 Ga0207689_10521252 3300025942 Bacteria 997
212 Ga0207661_10185415 3300025944 Bacteria 1821
213 Ga0207661_10321402 3300025944 Bacteria 1391
214 Ga0207679_10169370 3300025945 Bacteria 1796
215 Ga0207667_10019388 3300025949 Bacteria 7593
216 Ga0207667_10848483 3300025949 Bacteria 908
217 Ga0207712_10031690 3300025961 Bacteria 3563
218 Ga0207712_10271440 3300025961 Bacteria 1380
219 Ga0207668_10185481 3300025972 Bacteria 1644
220 Ga0207668_10255553 3300025972 Bacteria 1425
221 Ga0207640_10625975 3300025981 Bacteria 914
222 Ga0207658_10014541 3300025986 Bacteria 5389
223 Ga0207658_10377424 3300025986 Bacteria 1241
224 Ga0207658_10814043 3300025986 Bacteria 848
225 Ga0207677_10795488 3300026023 Bacteria 846
226 Ga0207703_11417854 3300026035 Bacteria 668
227 Ga0207678_10750142 3300026067 Bacteria 860
228 Ga0207708_10288289 3300026075 Bacteria 1332
229 Ga0207702_10017807 3300026078 Bacteria 5881
230 Ga0207641_10021776 3300026088 Bacteria 5269
231 Ga0207641_10075008 3300026088 Bacteria 2920
232 Ga0207648_10112098 3300026089 Bacteria 2395
233 Ga0207648_10457765 3300026089 Bacteria 1162
234 Ga0207676_10071951 3300026095 Bacteria 2778
235 Ga0207676_10561335 3300026095 Bacteria 1092
236 Ga0207676_11149997 3300026095 Bacteria 768
237 Ga0207675_100153755 3300026118 Bacteria 2191
238 Ga0207428_10000812 3300027907 Bacteria 35326
239 Ga0268266_10007082 3300028379 Bacteria 10182
240 Ga0268266_10741828 3300028379 Bacteria 947
241 Ga0268266_11295495 3300028379 Bacteria 704
242 Ga0268265_10003830 3300028380 Bacteria 10659
243 Ga0268265_10676922 3300028380 Bacteria 994
244 Ga0268264_10451377 3300028381 Bacteria 1246
245 Ga0307515_10390026 3300028794 Bacteria 1022
246 Ga0316178_1061792 3300030735 Bacteria 951
247 Ga0307513_10006146 3300031456 Bacteria 15755
248 Ga0307513_10063662 3300031456 Bacteria 3891
249 Ga0307408_100142179 3300031548 Bacteria 1885
250 Ga0307408_101765240 3300031548 Bacteria 591
251 Ga0307405_10003552 3300031731 Bacteria 7188
252 Ga0307405_10305353 3300031731 Bacteria 1209
253 Ga0307405_10966312 3300031731 Bacteria 725
254 Ga0307413_10004570 3300031824 Bacteria 6045
255 Ga0307413_10022989 3300031824 Bacteria 3372
256 Ga0307413_10208304 3300031824 Bacteria 1418
257 Ga0307413_10687789 3300031824 Bacteria 848
258 Ga0307413_11027792 3300031824 Bacteria 708
259 Ga0307413_11148640 3300031824 Bacteria 673
260 Ga0307410_10005074 3300031852 Bacteria 6919
261 Ga0307410_10032634 3300031852 Bacteria 3354
262 Ga0307410_10048714 3300031852 Bacteria 2840
263 Ga0307410_10183109 3300031852 Bacteria 1587
264 Ga0307410_10209855 3300031852 Bacteria 1491
265 Ga0307410_10255243 3300031852 Bacteria 1365
266 Ga0307410_10258913 3300031852 Bacteria 1356
267 Ga0307410_10469000 3300031852 Bacteria 1030
268 Ga0307406_10004047 3300031901 Bacteria 7975
269 Ga0307406_10032236 3300031901 Bacteria 3198
270 Ga0307406_10146809 3300031901 Bacteria 1677
271 Ga0307406_10165489 3300031901 Bacteria 1595
272 Ga0307406_10668733 3300031901 Bacteria 864
273 Ga0307407_10002771 3300031903 Bacteria 6981
274 Ga0307407_10229010 3300031903 Bacteria 1261
275 Ga0307407_10293845 3300031903 Bacteria 1130
276 Ga0307407_10378350 3300031903 Bacteria 1010
277 Ga0307412_10006453 3300031911 Bacteria 6631
278 Ga0307412_10374420 3300031911 Bacteria 1151
279 Ga0307412_10689018 3300031911 Bacteria 876
280 Ga0307409_100000121 3300031995 Bacteria 29222
281 Ga0307409_100071849 3300031995 Bacteria 2753
282 Ga0307409_100100318 3300031995 Bacteria 2399
283 Ga0307409_100121247 3300031995 Bacteria 2215
284 Ga0307409_100132261 3300031995 Bacteria 2135
285 Ga0307409_100219800 3300031995 Bacteria 1714
286 Ga0307409_100249359 3300031995 Bacteria 1622
287 Ga0307409_100280004 3300031995 Bacteria 1541
288 Ga0307409_100315322 3300031995 Bacteria 1461
289 Ga0307409_100767223 3300031995 Bacteria 969
290 Ga0307409_100850361 3300031995 Bacteria 923
291 Ga0307409_101113305 3300031995 Bacteria 811
292 Ga0307409_101211602 3300031995 Bacteria 778
293 Ga0307409_101836002 3300031995 Bacteria 635
294 Ga0307416_100005701 3300032002 Bacteria 7699
295 Ga0307416_100016676 3300032002 Bacteria 5115
296 Ga0307416_100018151 3300032002 Bacteria 4948
297 Ga0307416_100019397 3300032002 Bacteria 4821
298 Ga0307416_100085572 3300032002 Bacteria 2684
299 Ga0307416_100089664 3300032002 Bacteria 2634
300 Ga0307416_100134793 3300032002 Bacteria 2231
301 Ga0307416_100241634 3300032002 Bacteria 1750
302 Ga0307416_100449432 3300032002 Bacteria 1341
303 Ga0307416_100526833 3300032002 Bacteria 1251
304 Ga0307416_100621174 3300032002 Bacteria 1163
305 Ga0307416_100973502 3300032002 Bacteria 951
306 Ga0307416_101155482 3300032002 Bacteria 879
307 Ga0307416_102257119 3300032002 Bacteria 645
308 Ga0307414_10099179 3300032004 Bacteria 2188
309 Ga0307414_10128577 3300032004 Bacteria 1962
310 Ga0307414_10240964 3300032004 Bacteria 1497
311 Ga0307414_10337801 3300032004 Bacteria 1288
312 Ga0307414_10712703 3300032004 Bacteria 909
313 Ga0307411_10619349 3300032005 Bacteria 933
314 Ga0307411_10867758 3300032005 Bacteria 800
315 Ga0307415_100005953 3300032126 Bacteria 6534
316 Ga0307415_100023141 3300032126 Bacteria 3851
317 Ga0307415_100047001 3300032126 Bacteria 2903
318 Ga0307415_100118006 3300032126 Bacteria 1983
319 Ga0307415_100165271 3300032126 Bacteria 1720
320 Ga0307415_100298068 3300032126 Bacteria 1334
321 Ga0307415_100373339 3300032126 Bacteria 1208
322 Ga0307415_100655904 3300032126 Bacteria 941
323 Ga0316214_1001620 3300033545 Bacteria 2662
324 Ga0373930_0003309 3300034816 Bacteria 2547
325 Ga0373958_0025020 3300034819 Bacteria 1134
326 Ga0373959_0104340 3300034820 Bacteria 678
327 Ga0373940_0000672 3300035088 Bacteria 5478
328 Ga0373949_0074787 3300035090 Bacteria 893
329 Ga0373952_0002724 3300035092 Bacteria 3192
330 Ga0373923_0008487 3300035111 Bacteria 3666
331 Ga0373939_0015411 3300035114 Bacteria 2000
332 Ga0373956_0000419 3300035119 Bacteria 17279
333 Ga0373943_0112680 3300035170 Bacteria 1436
334 Ga0373943_0249986 3300035170 Bacteria 995
335 Ga0373946_0209864 3300035171 Bacteria 936
336 Ga0373942_0032662 3300035207 Bacteria 1383
337 Ga0373961_0021395 3300035241 Bacteria 1720
338 Ga0373931_0091612 3300035691 Bacteria 1694
339 Ga0373931_0097655 3300035691 Bacteria 1647
340 Ga0373927_0041521 3300035695 Bacteria 2983
341 Ga0373927_0410223 3300035695 Bacteria 894
342 Ga0373925_1320162 3300037068 Bacteria 592
343 Ga0395899_0079757 3300037312 Bacteria 2384
344 Ga0395899_0197456 3300037312 Bacteria 1405
345 Ga0395899_0272608 3300037312 Bacteria 1154
346 Ga0395899_0446801 3300037312 Bacteria 847
347 Ga0395900_0037438 3300037418 Bacteria 5002
348 Ga0395900_0039304 3300037418 Bacteria 4874
349 Ga0395900_0119250 3300037418 Bacteria 2708
350 Ga0395898_0037888 3300037466 Bacteria 4780
351 Ga0395898_0929651 3300037466 Bacteria 807
352 Ga0395905_0722415 3300037471 Bacteria 898
353 Ga0436364_0795184 3300037853 Bacteria 4769
354 Ga0436364_0968900 3300037853 Bacteria 6032
355 Ga0436364_1274783 3300037853 Bacteria 3834
356 Ga0395901_0027542 3300038443 Bacteria 5840
357 Ga0395901_0036242 3300038443 Bacteria 5097
358 Ga0395901_0048266 3300038443 Bacteria 4421
359 Ga0395901_0096320 3300038443 Bacteria 3101
360 Ga0395901_0098694 3300038443 Bacteria 3062
361 Ga0395901_0282891 3300038443 Bacteria 1723
362 Ga0436365_1331061 3300039437 Bacteria 4338
363 Ga0439443_013081 3300042003 Bacteria 1236
364 Ga0439448_0008112 3300042005 Bacteria 3067
365 Ga0439448_0032573 3300042005 Bacteria 1659
366 Ga0439448_0208505 3300042005 Bacteria 686
367 Ga0439450_010013 3300042008 Bacteria 1816
368 Ga0439454_000386 3300042011 Bacteria 3406
369 Ga0439455_0011420 3300042012 Bacteria 1973
370 Ga0439435_0026910 3300042436 Bacteria 1535
371 Ga0439460_0033491 3300042461 Bacteria 1476
372 Ga0439460_0049364 3300042461 Bacteria 1258
373 Ga0439440_0010484 3300042993 Bacteria 1938
374 Ga0466966_0081664 3300044684 Bacteria 2012
375 Ga0466966_0206931 3300044684 Bacteria 1186
376 Ga0466966_0208366 3300044684 Bacteria 1182
377 Ga0466961_0020147 3300044693 Bacteria 4293
378 Ga0466963_0612626 3300044694 Bacteria 769
379 Ga0466964_0017045 3300044706 Bacteria 2779
380 Ga0466971_0119225 3300044719 Bacteria 1221
381 Ga0466971_0142955 3300044719 Bacteria 1114
382 Ga0466968_0294299 3300044735 Bacteria 779
383 Ga0466970_0177761 3300044765 Bacteria 1180
384 Ga0466970_0254038 3300044765 Bacteria 985
385 Ga0466970_0279489 3300044765 Bacteria 939
386 Ga0466957_0029202 3300044842 Bacteria 3287
387 Ga0466957_0154900 3300044842 Bacteria 1484
388 Ga0466957_0656742 3300044842 Bacteria 738
389 Ga0466960_0288405 3300044901 Bacteria 922
390 Ga0466959_0029897 3300045049 Bacteria 4035
391 Ga0466959_0082169 3300045049 Bacteria 2321
392 Ga0466959_0112854 3300045049 Bacteria 1938
393 Ga0466959_0113175 3300045049 Bacteria 1935
394 Ga0466959_0224800 3300045049 Bacteria 1301
395 Ga0466958_0233924 3300045836 Bacteria 1174
396 Ga0466958_0328112 3300045836 Bacteria 984
397 Ga0466958_0502511 3300045836 Bacteria 787
398 Ga0466967_0013577 3300045976 Bacteria 6302
399 Ga0466967_0127040 3300045976 Bacteria 2363
400 Ga0466967_0195501 3300045976 Bacteria 1913
401 Ga0466967_0216695 3300045976 Bacteria 1817
402 Ga0466967_0271158 3300045976 Bacteria 1626
403 Ga0466967_0368493 3300045976 Bacteria 1393
404 Ga0466967_0383129 3300045976 Bacteria 1366
405 Ga0466967_0471686 3300045976 Bacteria 1229
406 Ga0466967_1469149 3300045976 Bacteria 679
407 Ga0466967_1583148 3300045976 Bacteria 653
408 Ga0495592_0026781 3300046454 Bacteria 4370
409 Ga0495629_0006528 3300046459 Bacteria 8642
410 Ga0495653_0086592 3300046463 Bacteria 2302
411 Ga0495653_0150198 3300046463 Bacteria 1628
412 Ga0495580_0059682 3300046472 Bacteria 2681
413 Ga0495582_0003548 3300046473 Bacteria 8792
414 Ga0495662_0037421 3300046476 Bacteria 2343
415 Ga0495662_0322772 3300046476 Bacteria 759
416 Ga0495664_0172485 3300046477 Bacteria 1312
417 Ga0495596_0033382 3300046500 Bacteria 2048
418 Ga0495608_0050207 3300046511 Bacteria 2768
419 Ga0495618_0057657 3300046514 Bacteria 2459
420 Ga0495620_0117831 3300046515 Bacteria 1049
421 Ga0495630_0108901 3300046517 Bacteria 2098
422 Ga0495630_0267685 3300046517 Bacteria 1305
423 Ga0495652_0139012 3300046529 Bacteria 1912
424 Ga0495652_0398847 3300046529 Bacteria 974
425 Ga0495665_0002424 3300046531 Bacteria 10076
426 Ga0495598_0046165 3300046537 Bacteria 1294
427 Ga0495645_0047646 3300046543 Bacteria 3122
428 Ga0495667_0255276 3300046559 Bacteria 1115
429 Ga0495634_0012224 3300046642 Bacteria 6223
430 Ga0495635_0044143 3300046663 Bacteria 3075
431 Ga0495635_0436735 3300046663 Bacteria 866
432 Ga0495657_0284074 3300046675 Bacteria 990
433 Ga0495624_0119963 3300046690 Bacteria 1615
434 Ga0495624_0192696 3300046690 Bacteria 1239
435 Ga0495674_0164076 3300047319 Bacteria 1857
436 Ga0495676_0071256 3300047321 Bacteria 2672
437 Ga0495676_0108791 3300047321 Bacteria 2038
438 Ga0495680_0006442 3300047322 Bacteria 10909
439 Ga0495680_0287281 3300047322 Bacteria 1158
440 Ga0495675_0037831 3300047444 Bacteria 3072
441 Ga0495681_0177978 3300047470 Bacteria 876
442 Ga0495684_0054248 3300047471 Bacteria 3058
443 Ga0495593_0014823 3300047673 Bacteria 4428
444 Ga0495593_0018570 3300047673 Bacteria 3905
445 Ga0495602_0049397 3300048088 Bacteria 3768
446 Ga0495614_0138800 3300048089 Bacteria 1079
447 Ga0496100_0056471 3300048903 Bacteria 2568
448 Ga0496100_0117593 3300048903 Bacteria 1856
449 Ga0496100_0130531 3300048903 Bacteria 1769
450 Ga0496100_0427919 3300048903 Bacteria 1012
451 Ga0496100_0847091 3300048903 Bacteria 717
452 Ga0496101_0024168 3300048904 Bacteria 4203
453 Ga0496101_0026125 3300048904 Bacteria 4058
454 Ga0496101_0369697 3300048904 Bacteria 1128
455 Ga0496102_0000912 3300048905 Bacteria 27864
456 Ga0496102_0082643 3300048905 Bacteria 2963
457 Ga0496102_0116602 3300048905 Bacteria 2492
458 Ga0496102_0117481 3300048905 Bacteria 2482
459 Ga0496102_0502893 3300048905 Bacteria 1134
460 Ga0496102_0957620 3300048905 Bacteria 777
461 Ga0496102_1065322 3300048905 Bacteria 728
462 Ga0496102_1101096 3300048905 Bacteria 714
463 Ga0496104_0004060 3300048907 Bacteria 12694
464 Ga0496104_0126858 3300048907 Bacteria 2450
465 Ga0496104_0352476 3300048907 Bacteria 1384
466 Ga0496104_0596462 3300048907 Bacteria 1015
467 Ga0496105_0002764 3300048908 Bacteria 12815
468 Ga0496105_0300829 3300048908 Bacteria 1290
469 Ga0496105_0639922 3300048908 Bacteria 821
470 Ga0496106_0026972 3300048909 Bacteria 4277
471 Ga0496106_0142110 3300048909 Bacteria 1888
472 Ga0496106_0151516 3300048909 Bacteria 1830
473 Ga0496106_0471011 3300048909 Bacteria 1009
474 Ga0496107_0026650 3300048910 Bacteria 4099
475 Ga0496107_0030219 3300048910 Bacteria 3861
476 Ga0496108_0012275 3300048911 Bacteria 6968
477 Ga0496108_0038983 3300048911 Bacteria 3960
478 Ga0496109_0013300 3300048912 Bacteria 7130
479 Ga0496109_0017796 3300048912 Bacteria 6232
480 Ga0496109_0686433 3300048912 Bacteria 961
481 Ga0496110_0100534 3300048913 Bacteria 2592
482 Ga0496111_0193314 3300048914 Bacteria 1513
483 Ga0496112_0007783 3300048915 Bacteria 9538
484 Ga0496112_0019413 3300048915 Bacteria 6416
485 Ga0496112_0019993 3300048915 Bacteria 6338
486 Ga0496113_0023338 3300048916 Bacteria 4387
487 Ga0496113_0054905 3300048916 Bacteria 2984
488 Ga0496114_0018952 3300048917 Bacteria 5573
489 Ga0496114_0083164 3300048917 Bacteria 2708
490 Ga0496114_0314132 3300048917 Bacteria 1384
491 Ga0496114_0381303 3300048917 Bacteria 1248
492 Ga0496115_0002572 3300048918 Bacteria 13028
493 Ga0496115_0060277 3300048918 Bacteria 3057
494 Ga0496115_0084384 3300048918 Bacteria 2590
495 Ga0496115_0449104 3300048918 Bacteria 1041
496 Ga0496115_0480399 3300048918 Bacteria 1001
497 Ga0496115_0788914 3300048918 Bacteria 740
498 Ga0496124_0134806 3300048927 Bacteria 1956
499 Ga0496126_0057448 3300048929 Bacteria 3513
500 Ga0501031_0008588 3300049568 Bacteria 6648
501 Ga0501032_0038771 3300049569 Bacteria 3243
502 Ga0501033_0152382 3300049570 Bacteria 1667
503 Ga0501036_0009328 3300049572 Bacteria 8070
504 Ga0501038_0014866 3300049574 Bacteria 7088
505 Ga0501039_0001649 3300049575 Bacteria 16458
506 Ga0501039_0279914 3300049575 Bacteria 1311
507 Ga0501041_0006693 3300049577 Bacteria 6752
508 Ga0501042_0047639 3300049578 Bacteria 3056
509 Ga0501043_0019095 3300049579 Bacteria 5381
510 Ga0501046_0002905 3300049580 Bacteria 15888
511 Ga0501048_0065476 3300049582 Bacteria 2569
512 Ga0501069_0023333 3300049585 Bacteria 3373
513 Ga0501072_0036644 3300049588 Bacteria 3845
514 Ga0501074_0032112 3300049590 Bacteria 3805
515 Ga0501075_0004632 3300049591 Bacteria 9332
516 Ga0501076_0001450 3300049592 Bacteria 15952
517 Ga0501076_0411239 3300049592 Bacteria 1113
518 Ga0501077_0004181 3300049593 Bacteria 8722
519 Ga0501079_0010523 3300049741 Bacteria 7032
520 Ga0501080_0007074 3300049742 Bacteria 10135
521 Ga0501081_0016328 3300049743 Bacteria 4907
522 Ga0501083_0047010 3300049744 Bacteria 2918
523 Ga0501035_0012836 3300049822 Bacteria 7737
524 Ga0501044_0160421 3300049823 Bacteria 2226
525 nmdc:mga05p37_18612_c1 3300050507 Bacteria 8394
526 nmdc:mga05p37_7776_c1 3300050507 Bacteria 12660
527 nmdc:mga09592_463597_c1 3300050508 Bacteria 1093
528 nmdc:mga0qj67_100122_c1 3300050509 Bacteria 2336
529 nmdc:mga06r32_132293_c1 3300050510 Bacteria 2468
530 nmdc:mga08y16_77951_c1 3300050511 Bacteria 3455
531 nmdc:mga0n895_26402_c1 3300050512 Bacteria 5499
532 nmdc:mga0n895_30803_c1 3300050512 Bacteria 5131
533 nmdc:mga0n895_46977_c1 3300050512 Bacteria 4220
534 nmdc:mga0rr50_252604_c1 3300050513 Bacteria 1465
535 nmdc:mga0rr50_62244_c1 3300050513 Bacteria 2814
536 nmdc:mga08x19_114469_c1 3300050514 Bacteria 1802
537 nmdc:mga0a205_2379_c1 3300050515 Bacteria 16569
538 nmdc:mga0a205_645813_c1 3300050515 Bacteria 910
539 Ga0495601_0013731 3300053077 Bacteria 4873
540 Ga0495612_0115925 3300053078 Bacteria 1150
541 Ga0495595_0235062 3300053084 Bacteria 916
542 Ga0495619_0146840 3300053085 Bacteria 1626
543 Ga0500560_123843 3300053107 Bacteria 867
544 Ga0500587_012972 3300053739 Bacteria 1051
545 Ga0501084_0014258 3300054114 Bacteria 6583
546 Ga0501082_0048431 3300060353 Bacteria 3662
547 Ga0466962_0031342 3300061719 Bacteria 2546
548 Ga0466962_0047314 3300061719 Bacteria 2055
549 Ga0530510_0009679 3300061734 Bacteria 6762
550 2623499816 2622736605 Bacteria 4992138
551 2623589737 2622736626 Bacteria 7181580
552 2868094277 2868088558 Bacteria 7609351
553 Ga0207702_10779825
554 JGI25406J46586_10018575
555 JGI25406J46586_10040029
556 JGI25406J46586_10042827
557 JGI25407J50210_10003242
558 Ga0070658_10000338
559 Ga0070658_10030129
560 Ga0070683_100332858
561 Ga0070690_101236663
562 Ga0070670_100178706
563 Ga0068869_101002375
564 Ga0070682_100751986
565 Ga0068868_100230880
566 Ga0068868_100703824
567 Ga0070660_100266890
568 Ga0070691_10108183
569 Ga0070687_100175530
570 Ga0070661_100399281
571 Ga0070692_10455793
572 Ga0070668_100007909
573 Ga0070668_100053199
574 Ga0070669_100646224
575 Ga0070675_100333089
576 Ga0070673_100796856
577 Ga0070659_100824311
578 Ga0070667_100003752
579 Ga0070667_100430975
580 Ga0070667_100503986
581 Ga0070667_100771226
582 Ga0070709_10012896
583 Ga0070709_10025527
584 Ga0070714_100000491
585 Ga0070714_100018644
586 Ga0070714_100056919
587 Ga0070714_100558524
588 Ga0070713_100010893
589 Ga0070713_100171495
590 Ga0070713_101010318
591 Ga0070710_10007573
592 Ga0070710_10069347
593 Ga0070711_100106203
594 Ga0070711_100719024
595 Ga0070705_100048093
596 Ga0070694_100933435
597 Ga0070708_100044212
598 Ga0070708_100064222
599 Ga0070678_100637310
600 Ga0070662_100088354
601 Ga0070681_10706370
602 Ga0070681_11192402
603 Ga0068867_100048255
604 Ga0068867_100877026
605 Ga0070707_100020775
606 Ga0070707_100047965
607 Ga0070698_100090368
608 Ga0070679_100167393
609 Ga0070679_100458130
610 Ga0070684_100417735
611 Ga0070684_100661220
612 Ga0070697_100196637
613 Ga0068853_101199189
614 Ga0070696_100021847
615 Ga0070693_100562828
616 Ga0070665_100003764
617 Ga0070665_100200279
618 Ga0070665_100516584
619 Ga0070704_100715913
620 Ga0068855_101108854
621 Ga0068854_100068239
622 Ga0068854_100194447
623 Ga0068856_100046784
624 Ga0068856_100080348
625 Ga0068856_100875499
626 Ga0070702_100047415
627 Ga0068864_100046662
628 Ga0068864_101165627
629 Ga0068866_10267359
630 Ga0068851_10053167
631 Ga0068863_100023974
632 Ga0068863_100091306
633 Ga0068863_100364541
634 Ga0068860_100492502
635 Ga0068860_100685287
636 Ga0068862_100000591
637 Ga0068862_100217293
638 Ga0081455_10051524
639 Ga0081538_10007786
640 Ga0081538_10013357
641 Ga0081538_10014327
642 Ga0081538_10028529
643 Ga0081538_10095670
644 Ga0081538_10115594
645 Ga0081538_10165424
646 Ga0081540_1020575
647 Ga0081539_10000420
648 Ga0081539_10000538
649 Ga0081539_10004989
650 Ga0081539_10033254
651 Ga0070717_10008406
652 Ga0070717_10010134
653 Ga0070717_10016274
654 Ga0070717_10059081
655 Ga0070717_10384694
656 Ga0075432_10005895
657 Ga0070715_10001287
658 Ga0070715_10035527
659 Ga0070716_100015500
660 Ga0070716_100198847
661 Ga0070712_100006582
662 Ga0070712_100096319
663 Ga0070712_100592139
664 Ga0075428_100205572
665 Ga0075428_100508727
666 Ga0075430_100000242
667 Ga0075430_100102679
668 Ga0075433_10021690
669 Ga0075433_10023853
670 Ga0075434_100011970
671 Ga0075434_100037089
672 Ga0068865_100195158
673 Ga0068865_100677932
674 Ga0075435_100181404
675 Ga0075435_100182381
676 Ga0105250_10124254
677 Ga0111539_10010281
678 Ga0111539_10928577
679 Ga0105245_10981426
680 Ga0105245_11261958
681 Ga0105245_11442550
682 Ga0114129_10025453
683 Ga0114129_10144111
684 Ga0105243_10551239
685 Ga0105242_10268421
686 Ga0105248_10599559
687 Ga0105238_10461373
688 Ga0105238_10608257
689 Ga0105238_10611063
690 Ga0105249_10002880
691 Ga0105249_10133036
692 Ga0099796_10061026
693 Ga0105239_10222907
694 Ga0105239_11426343
695 Ga0157370_10057658
696 Ga0157369_10440513
697 Ga0157369_10922792
698 Ga0157374_10115852
699 Ga0157375_12277659
700 Ga0163163_10327952
701 Ga0157380_10275908
702 Ga0157379_10296679
703 Ga0206353_11711586
704 Ga0206353_12013433
705 Ga0213875_10113533
706 Ga0207656_10060159
707 Ga0207692_10005044
708 Ga0207692_10009874
709 Ga0207692_10009987
710 Ga0207692_10022716
711 Ga0207685_10003609
712 Ga0207685_10093391
713 Ga0207685_10135353
714 Ga0207685_10163464
715 Ga0207699_10000854
716 Ga0207699_10001661
717 Ga0207699_10015978
718 Ga0207699_10057957
719 Ga0207705_10006101
720 Ga0207684_10458820
721 Ga0207707_10741118
722 Ga0207695_10031465
723 Ga0207693_10011505
724 Ga0207693_10056016
725 Ga0207693_10088936
726 Ga0207693_10215094
727 Ga0207693_10447187
728 Ga0207693_10447188
729 Ga0207663_10003570
730 Ga0207663_10011675
731 Ga0207663_10271522
732 Ga0207663_10352874
733 Ga0207662_10172242
734 Ga0207657_10927939
735 Ga0207652_10355371
736 Ga0207646_10026392
737 Ga0207646_10053965
738 Ga0207646_10182531
739 Ga0207681_10099347
740 Ga0207694_10281177
741 Ga0207694_10712228
742 Ga0207659_10289278
743 Ga0207687_10188333
744 Ga0207700_10020046
745 Ga0207700_10062583
746 Ga0207700_10249707
747 Ga0207700_10323904
748 Ga0207664_10000648
749 Ga0207664_10004443
750 Ga0207664_10006206
751 Ga0207664_10101890
752 Ga0207664_10244363
753 Ga0207690_10005818
754 Ga0207690_10774854
755 Ga0207706_10173996
756 Ga0207686_10427266
757 Ga0207669_10095144
758 Ga0207665_10000801
759 Ga0207665_10007035
760 Ga0207691_10414286
761 Ga0207711_10198413
762 Ga0207689_10064059
763 Ga0207689_10521252
764 Ga0207661_10185415
765 Ga0207661_10321402
766 Ga0207679_10169370
767 Ga0207667_10019388
768 Ga0207667_10848483
769 Ga0207712_10031690
770 Ga0207712_10271440
771 Ga0207668_10185481
772 Ga0207668_10255553
773 Ga0207640_10625975
774 Ga0207658_10014541
775 Ga0207658_10377424
776 Ga0207658_10814043
777 Ga0207677_10795488
778 Ga0207703_11417854
779 Ga0207678_10750142
780 Ga0207708_10288289
781 Ga0207702_10017807
782 Ga0207641_10021776
783 Ga0207641_10075008
784 Ga0207648_10112098
785 Ga0207648_10457765
786 Ga0207676_10071951
787 Ga0207676_10561335
788 Ga0207676_11149997
789 Ga0207675_100153755
790 Ga0207428_10000812
791 Ga0268266_10007082
792 Ga0268266_10741828
793 Ga0268266_11295495
794 Ga0268265_10003830
795 Ga0268265_10676922
796 Ga0268264_10451377
797 Ga0307515_10390026
798 Ga0316178_1061792
799 Ga0307513_10006146
800 Ga0307513_10063662
801 Ga0307408_100142179
802 Ga0307408_101765240
803 Ga0307405_10003552
804 Ga0307405_10305353
805 Ga0307405_10966312
806 Ga0307413_10004570
807 Ga0307413_10022989
808 Ga0307413_10208304
809 Ga0307413_10687789
810 Ga0307413_11027792
811 Ga0307413_11148640
812 Ga0307410_10005074
813 Ga0307410_10032634
814 Ga0307410_10048714
815 Ga0307410_10183109
816 Ga0307410_10209855
817 Ga0307410_10255243
818 Ga0307410_10258913
819 Ga0307410_10469000
820 Ga0307406_10004047
821 Ga0307406_10032236
822 Ga0307406_10146809
823 Ga0307406_10165489
824 Ga0307406_10668733
825 Ga0307407_10002771
826 Ga0307407_10229010
827 Ga0307407_10293845
828 Ga0307407_10378350
829 Ga0307412_10006453
830 Ga0307412_10374420
831 Ga0307412_10689018
832 Ga0307409_100000121
833 Ga0307409_100071849
834 Ga0307409_100100318
835 Ga0307409_100121247
836 Ga0307409_100132261
837 Ga0307409_100219800
838 Ga0307409_100249359
839 Ga0307409_100280004
840 Ga0307409_100315322
841 Ga0307409_100767223
842 Ga0307409_100850361
843 Ga0307409_101113305
844 Ga0307409_101211602
845 Ga0307409_101836002
846 Ga0307416_100005701
847 Ga0307416_100016676
848 Ga0307416_100018151
849 Ga0307416_100019397
850 Ga0307416_100085572
851 Ga0307416_100089664
852 Ga0307416_100134793
853 Ga0307416_100241634
854 Ga0307416_100449432
855 Ga0307416_100526833
856 Ga0307416_100621174
857 Ga0307416_100973502
858 Ga0307416_101155482
859 Ga0307416_102257119
860 Ga0307414_10099179
861 Ga0307414_10128577
862 Ga0307414_10240964
863 Ga0307414_10337801
864 Ga0307414_10712703
865 Ga0307411_10619349
866 Ga0307411_10867758
867 Ga0307415_100005953
868 Ga0307415_100023141
869 Ga0307415_100047001
870 Ga0307415_100118006
871 Ga0307415_100165271
872 Ga0307415_100298068
873 Ga0307415_100373339
874 Ga0307415_100655904
875 Ga0316214_1001620
876 Ga0373930_0003309
877 Ga0373958_0025020
878 Ga0373959_0104340
879 Ga0373940_0000672
880 Ga0373949_0074787
881 Ga0373952_0002724
882 Ga0373923_0008487
883 Ga0373939_0015411
884 Ga0373956_0000419
885 Ga0373943_0112680
886 Ga0373943_0249986
887 Ga0373946_0209864
888 Ga0373942_0032662
889 Ga0373961_0021395
890 Ga0373931_0091612
891 Ga0373931_0097655
892 Ga0373927_0041521
893 Ga0373927_0410223
894 Ga0373925_1320162
895 Ga0395899_0079757
896 Ga0395899_0197456
897 Ga0395899_0272608
898 Ga0395899_0446801
899 Ga0395900_0037438
900 Ga0395900_0039304
901 Ga0395900_0119250
902 Ga0395898_0037888
903 Ga0395898_0929651
904 Ga0395905_0722415
905 Ga0436364_0795184
906 Ga0436364_0968900
907 Ga0436364_1274783
908 Ga0395901_0027542
909 Ga0395901_0036242
910 Ga0395901_0048266
911 Ga0395901_0096320
912 Ga0395901_0098694
913 Ga0395901_0282891
914 Ga0436365_1331061
915 Ga0439443_013081
916 Ga0439448_0008112
917 Ga0439448_0032573
918 Ga0439448_0208505
919 Ga0439450_010013
920 Ga0439454_000386
921 Ga0439455_0011420
922 Ga0439435_0026910
923 Ga0439460_0033491
924 Ga0439460_0049364
925 Ga0439440_0010484
926 Ga0466966_0081664
927 Ga0466966_0206931
928 Ga0466966_0208366
929 Ga0466961_0020147
930 Ga0466963_0612626
931 Ga0466964_0017045
932 Ga0466971_0119225
933 Ga0466971_0142955
934 Ga0466968_0294299
935 Ga0466970_0177761
936 Ga0466970_0254038
937 Ga0466970_0279489
938 Ga0466957_0029202
939 Ga0466957_0154900
940 Ga0466957_0656742
941 Ga0466960_0288405
942 Ga0466959_0029897
943 Ga0466959_0082169
944 Ga0466959_0112854
945 Ga0466959_0113175
946 Ga0466959_0224800
947 Ga0466958_0233924
948 Ga0466958_0328112
949 Ga0466958_0502511
950 Ga0466967_0013577
951 Ga0466967_0127040
952 Ga0466967_0195501
953 Ga0466967_0216695
954 Ga0466967_0271158
955 Ga0466967_0368493
956 Ga0466967_0383129
957 Ga0466967_0471686
958 Ga0466967_1469149
959 Ga0466967_1583148
960 Ga0495592_0026781
961 Ga0495629_0006528
962 Ga0495653_0086592
963 Ga0495653_0150198
964 Ga0495580_0059682
965 Ga0495582_0003548
966 Ga0495662_0037421
967 Ga0495662_0322772
968 Ga0495664_0172485
969 Ga0495596_0033382
970 Ga0495608_0050207
971 Ga0495618_0057657
972 Ga0495620_0117831
973 Ga0495630_0108901
974 Ga0495630_0267685
975 Ga0495652_0139012
976 Ga0495652_0398847
977 Ga0495665_0002424
978 Ga0495598_0046165
979 Ga0495645_0047646
980 Ga0495667_0255276
981 Ga0495634_0012224
982 Ga0495635_0044143
983 Ga0495635_0436735
984 Ga0495657_0284074
985 Ga0495624_0119963
986 Ga0495624_0192696
987 Ga0495674_0164076
988 Ga0495676_0071256
989 Ga0495676_0108791
990 Ga0495680_0006442
991 Ga0495680_0287281
992 Ga0495675_0037831
993 Ga0495681_0177978
994 Ga0495684_0054248
995 Ga0495593_0014823
996 Ga0495593_0018570
997 Ga0495602_0049397
998 Ga0495614_0138800
999 Ga0496100_0056471
1000 Ga0496100_0117593
1001 Ga0496100_0130531
1002 Ga0496100_0427919
1003 Ga0496100_0847091
1004 Ga0496101_0024168
1005 Ga0496101_0026125
1006 Ga0496101_0369697
1007 Ga0496102_0000912
1008 Ga0496102_0082643
1009 Ga0496102_0116602
1010 Ga0496102_0117481
1011 Ga0496102_0502893
1012 Ga0496102_0957620
1013 Ga0496102_1065322
1014 Ga0496102_1101096
1015 Ga0496104_0004060
1016 Ga0496104_0126858
1017 Ga0496104_0352476
1018 Ga0496104_0596462
1019 Ga0496105_0002764
1020 Ga0496105_0300829
1021 Ga0496105_0639922
1022 Ga0496106_0026972
1023 Ga0496106_0142110
1024 Ga0496106_0151516
1025 Ga0496106_0471011
1026 Ga0496107_0026650
1027 Ga0496107_0030219
1028 Ga0496108_0012275
1029 Ga0496108_0038983
1030 Ga0496109_0013300
1031 Ga0496109_0017796
1032 Ga0496109_0686433
1033 Ga0496110_0100534
1034 Ga0496111_0193314
1035 Ga0496112_0007783
1036 Ga0496112_0019413
1037 Ga0496112_0019993
1038 Ga0496113_0023338
1039 Ga0496113_0054905
1040 Ga0496114_0018952
1041 Ga0496114_0083164
1042 Ga0496114_0314132
1043 Ga0496114_0381303
1044 Ga0496115_0002572
1045 Ga0496115_0060277
1046 Ga0496115_0084384
1047 Ga0496115_0449104
1048 Ga0496115_0480399
1049 Ga0496115_0788914
1050 Ga0496124_0134806
1051 Ga0496126_0057448
1052 Ga0501031_0008588
1053 Ga0501032_0038771
1054 Ga0501033_0152382
1055 Ga0501036_0009328
1056 Ga0501038_0014866
1057 Ga0501039_0001649
1058 Ga0501039_0279914
1059 Ga0501041_0006693
1060 Ga0501042_0047639
1061 Ga0501043_0019095
1062 Ga0501046_0002905
1063 Ga0501048_0065476
1064 Ga0501069_0023333
1065 Ga0501072_0036644
1066 Ga0501074_0032112
1067 Ga0501075_0004632
1068 Ga0501076_0001450
1069 Ga0501076_0411239
1070 Ga0501077_0004181
1071 Ga0501079_0010523
1072 Ga0501080_0007074
1073 Ga0501081_0016328
1074 Ga0501083_0047010
1075 Ga0501035_0012836
1076 Ga0501044_0160421
1077 nmdc:mga05p37_18612_c1
1078 nmdc:mga05p37_7776_c1
1079 nmdc:mga09592_463597_c1
1080 nmdc:mga0qj67_100122_c1
1081 nmdc:mga06r32_132293_c1
1082 nmdc:mga08y16_77951_c1
1083 nmdc:mga0n895_26402_c1
1084 nmdc:mga0n895_30803_c1
1085 nmdc:mga0n895_46977_c1
1086 nmdc:mga0rr50_252604_c1
1087 nmdc:mga0rr50_62244_c1
1088 nmdc:mga08x19_114469_c1
1089 nmdc:mga0a205_2379_c1
1090 nmdc:mga0a205_645813_c1
1091 Ga0495601_0013731
1092 Ga0495612_0115925
1093 Ga0495595_0235062
1094 Ga0495619_0146840
1095 Ga0500560_123843
1096 Ga0500587_012972
1097 Ga0501084_0014258
1098 Ga0501082_0048431
1099 Ga0466962_0031342
1100 Ga0466962_0047314
1101 Ga0530510_0009679
1102 2623499816
1103 2623589737
1104 2868094277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

60

211

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.8608 3 188
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.8536 3 188
3t63-assembly1.cif.gz_N axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase 0.8513 8 176
1ykk-assembly1.cif.gz_B protocatechuate 3,4-dioxygenase y408c mutant 0.8513 8 176
4whp-assembly1.cif.gz_D resting protocatechuate 3,4-dioxygenase (pseudomonas putida) at ph 6.5 0.8505 8 176
ID Description Score Start End Superfamily
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8323 6 188 2.60.130.10
af_E7FFQ7_1118_1203_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8121 39 141 2.60.40.1120
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8118 19 187 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8071 6 188 2.60.130.10
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8048 38 141 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A521FSL9-F1-model_v4 Protocatechuate 3,4-dioxygenase, alpha subunit 0.9765 60 188 GO:0005506
GO:0009056
GO:0018578
AF-A0A1C9ICP8-F1-model_v4 Protocatechuate dioxygenase alpha subunit 0.9743 43 181 GO:0008199
GO:0009056
GO:0018578
AF-A0A521FSL9-F1-model_v4 Protocatechuate 3,4-dioxygenase, alpha subunit 0.969 60 188 GO:0005506
GO:0009056
GO:0018578
AF-U0EAS1-F1-model_v4 deleted 0.9658 9 188
AF-A0A529XP50-F1-model_v4 deleted 0.9632 101 188

Map