F462722

General Info

Members Datasets Scaffolds Average Seq Length
552 230 552 157

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10001571|Ga0105248_1000157111
Length 181
Sequence VCKKFCNKKTSDRHSRAQAVIMLRMIIGIAAVDRKGAIGKGGKLPWHYSADMKFFRETTTGHAVVMGRKTWLTIGKPLKNRLNIVLSRDPNIEPQESLLVLSDIESVLSLNQSLSTNLFVIGGAQIYEAFLPSIEQWIITEVPVTVKGADAFMPEGYLEGFNATDAKPIGDGLTVRFYERA

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
164 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
165 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
177 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
178 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
179 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
180 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
184 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
189 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
190 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
191 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
192 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
196 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
197 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
198 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
199 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
200 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
201 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
202 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
203 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
204 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
207 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
208 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
209 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
210 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
211 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
212 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
213 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
214 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
215 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
218 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
219 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.17
Rhizosphere 97.28
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000114 3300000532 Bacteria 6628
2 JGI24751J29686_10000050 3300002459 Bacteria 68540
3 JGI25406J46586_10018162 3300003203 Unclassified 2894
4 rootH2_10054533 3300003320 Unclassified 1953
5 rootL2_10137033 3300003322 Unclassified 1470
6 rootL2_10138097 3300003322 Unclassified 1923
7 Ga0065714_10065325 3300005288 Bacteria 10908
8 Ga0065704_10097557 3300005289 Bacteria 2367
9 Ga0065712_10057129 3300005290 Bacteria 1095
10 Ga0065712_10068401 3300005290 Bacteria 10913
11 Ga0065712_10426402 3300005290 Bacteria 707
12 Ga0065712_10468174 3300005290 Bacteria 672
13 Ga0065715_10001359 3300005293 Bacteria 8994
14 Ga0065715_10158954 3300005293 Bacteria 1648
15 Ga0065715_10179393 3300005293 Bacteria 1487
16 Ga0065715_10334890 3300005293 Bacteria 977
17 Ga0065715_10453322 3300005293 Bacteria 824
18 Ga0065715_10460842 3300005293 Bacteria 816
19 Ga0065715_10553748 3300005293 Bacteria 739
20 Ga0065707_10000960 3300005295 Bacteria 10503
21 Ga0070676_10077707 3300005328 Bacteria 2007
22 Ga0070683_102184474 3300005329 Bacteria 531
23 Ga0070690_100042298 3300005330 Bacteria 2885
24 Ga0070690_100386813 3300005330 Bacteria 1024
25 Ga0070670_100000266 3300005331 Bacteria 46547
26 Ga0070670_100052467 3300005331 Bacteria 3502
27 Ga0070670_100209459 3300005331 Bacteria 1695
28 Ga0070670_100792850 3300005331 Bacteria 855
29 Ga0070677_10141856 3300005333 Unclassified 1109
30 Ga0068869_100199513 3300005334 Bacteria 1577
31 Ga0068869_100489625 3300005334 Bacteria 1025
32 Ga0068869_101032494 3300005334 Bacteria 717
33 Ga0070680_100036035 3300005336 Bacteria 3996
34 Ga0070682_100002088 3300005337 Bacteria 11121
35 Ga0070682_100434879 3300005337 Bacteria 1001
36 Ga0070660_100615307 3300005339 Bacteria 909
37 Ga0070687_100688708 3300005343 Unclassified 713
38 Ga0070687_100933278 3300005343 Unclassified 624
39 Ga0070692_10007217 3300005345 Bacteria 4883
40 Ga0070692_10159233 3300005345 Bacteria 1292
41 Ga0070692_10187016 3300005345 Bacteria 1204
42 Ga0070669_100069297 3300005353 Bacteria 2605
43 Ga0070669_101558258 3300005353 Unclassified 575
44 Ga0070675_100287224 3300005354 Bacteria 1447
45 Ga0070675_100645331 3300005354 Bacteria 962
46 Ga0070673_100076005 3300005364 Bacteria 2711
47 Ga0070673_100350173 3300005364 Bacteria 1311
48 Ga0070673_100546363 3300005364 Bacteria 1052
49 Ga0070673_100599331 3300005364 Bacteria 1005
50 Ga0070688_100006390 3300005365 Bacteria 6300
51 Ga0070688_100376623 3300005365 Bacteria 1045
52 Ga0070688_101005584 3300005365 Bacteria 662
53 Ga0070659_100565902 3300005366 Unclassified 974
54 Ga0070659_101667296 3300005366 Bacteria 570
55 Ga0070703_10002431 3300005406 Bacteria 5365
56 Ga0070709_10137638 3300005434 Bacteria 1674
57 Ga0070705_100008941 3300005440 Bacteria 4966
58 Ga0070705_100018334 3300005440 Bacteria 3668
59 Ga0070705_100228041 3300005440 Bacteria 1294
60 Ga0070705_101026385 3300005440 Unclassified 671
61 Ga0070705_101556456 3300005440 Unclassified 555
62 Ga0070700_100000131 3300005441 Bacteria 45427
63 Ga0070700_100024587 3300005441 Bacteria 3539
64 Ga0070700_100040071 3300005441 Bacteria 2865
65 Ga0070700_100146928 3300005441 Bacteria 1608
66 Ga0070700_100262075 3300005441 Bacteria 1245
67 Ga0070700_100375124 3300005441 Bacteria 1062
68 Ga0070694_100002992 3300005444 Bacteria 10045
69 Ga0070694_100018810 3300005444 Bacteria 4389
70 Ga0070694_100054519 3300005444 Bacteria 2709
71 Ga0070694_100206393 3300005444 Unclassified 1467
72 Ga0070694_100213296 3300005444 Bacteria 1445
73 Ga0070694_100245983 3300005444 Bacteria 1351
74 Ga0070694_100627768 3300005444 Bacteria 868
75 Ga0070694_101498937 3300005444 Bacteria 571
76 Ga0070708_100433420 3300005445 Bacteria 1240
77 Ga0070662_100795248 3300005457 Bacteria 804
78 Ga0070681_10180599 3300005458 Bacteria 2032
79 Ga0070681_10372427 3300005458 Bacteria 1339
80 Ga0070681_10840704 3300005458 Bacteria 836
81 Ga0068867_100072859 3300005459 Bacteria 2572
82 Ga0070685_10647594 3300005466 Unclassified 765
83 Ga0070706_100000616 3300005467 Bacteria 41104
84 Ga0070706_100521910 3300005467 Bacteria 1105
85 Ga0070707_100026882 3300005468 Bacteria 5469
86 Ga0070698_100004211 3300005471 Bacteria 15808
87 Ga0070699_100003366 3300005518 Bacteria 14142
88 Ga0070699_100125455 3300005518 Bacteria 2260
89 Ga0070699_101194722 3300005518 Bacteria 698
90 Ga0070679_100147963 3300005530 Bacteria 2326
91 Ga0070679_100467210 3300005530 Bacteria 1206
92 Ga0070697_100030061 3300005536 Bacteria 4361
93 Ga0068853_100632526 3300005539 Bacteria 1018
94 Ga0068853_101074310 3300005539 Bacteria 776
95 Ga0068853_101169992 3300005539 Bacteria 742
96 Ga0070672_101119969 3300005543 Bacteria 700
97 Ga0070686_100545413 3300005544 Bacteria 906
98 Ga0070695_100141532 3300005545 Bacteria 1669
99 Ga0070695_100152925 3300005545 Unclassified 1612
100 Ga0070695_100519204 3300005545 Bacteria 924
101 Ga0070695_100539625 3300005545 Bacteria 908
102 Ga0070696_100006184 3300005546 Bacteria 8003
103 Ga0070696_100044574 3300005546 Bacteria 3071
104 Ga0070696_100058366 3300005546 Bacteria 2694
105 Ga0070696_100194217 3300005546 Bacteria 1512
106 Ga0070696_100625555 3300005546 Unclassified 870
107 Ga0070693_100087052 3300005547 Bacteria 1875
108 Ga0070693_100218843 3300005547 Bacteria 1246
109 Ga0070693_100282842 3300005547 Bacteria 1111
110 Ga0070693_100622633 3300005547 Bacteria 782
111 Ga0070704_100037403 3300005549 Bacteria 3316
112 Ga0070704_100086001 3300005549 Bacteria 2329
113 Ga0070704_101141525 3300005549 Unclassified 709
114 Ga0068855_101046256 3300005563 Bacteria 856
115 Ga0070664_100485095 3300005564 Bacteria 1138
116 Ga0068857_100075869 3300005577 Bacteria 2997
117 Ga0068857_100188211 3300005577 Bacteria 1880
118 Ga0068857_100489946 3300005577 Bacteria 1153
119 Ga0068857_101134524 3300005577 Bacteria 756
120 Ga0068857_102061809 3300005577 Bacteria 560
121 Ga0068854_100436356 3300005578 Bacteria 1091
122 Ga0068856_102152281 3300005614 Bacteria 567
123 Ga0070702_100070382 3300005615 Bacteria 2065
124 Ga0070702_100283122 3300005615 Unclassified 1139
125 Ga0070702_100307977 3300005615 Bacteria 1098
126 Ga0070702_100679934 3300005615 Bacteria 782
127 Ga0068852_100734395 3300005616 Bacteria 999
128 Ga0068859_100002808 3300005617 Bacteria 17648
129 Ga0068859_100003853 3300005617 Bacteria 15325
130 Ga0068859_100033966 3300005617 Bacteria 5121
131 Ga0068859_100088357 3300005617 Bacteria 3149
132 Ga0068859_100100075 3300005617 Bacteria 2954
133 Ga0068859_100143877 3300005617 Bacteria 2458
134 Ga0068859_100174930 3300005617 Bacteria 2228
135 Ga0068859_100186915 3300005617 Bacteria 2156
136 Ga0068859_100227879 3300005617 Bacteria 1951
137 Ga0068859_100232810 3300005617 Bacteria 1930
138 Ga0068859_100283093 3300005617 Bacteria 1751
139 Ga0068859_100351228 3300005617 Bacteria 1569
140 Ga0068859_101664290 3300005617 Bacteria 705
141 Ga0068859_101971555 3300005617 Unclassified 645
142 Ga0068864_100000619 3300005618 Bacteria 29969
143 Ga0068864_100041446 3300005618 Bacteria 3938
144 Ga0068864_100191475 3300005618 Bacteria 1875
145 Ga0068864_100370217 3300005618 Bacteria 1356
146 Ga0068864_100925109 3300005618 Bacteria 862
147 Ga0068864_101021776 3300005618 Bacteria 821
148 Ga0068861_100000821 3300005719 Bacteria 18796
149 Ga0068851_10001845 3300005834 Bacteria 9287
150 Ga0068870_10035986 3300005840 Bacteria 2544
151 Ga0068870_10354568 3300005840 Bacteria 942
152 Ga0068863_100058964 3300005841 Bacteria 3632
153 Ga0068863_100107284 3300005841 Bacteria 2657
154 Ga0068863_100670222 3300005841 Bacteria 1029
155 Ga0068858_100056291 3300005842 Bacteria 3635
156 Ga0068858_100079286 3300005842 Bacteria 3051
157 Ga0068858_100152417 3300005842 Bacteria 2174
158 Ga0068858_100214779 3300005842 Bacteria 1821
159 Ga0068858_100387289 3300005842 Unclassified 1342
160 Ga0068858_100812126 3300005842 Bacteria 913
161 Ga0068858_101293496 3300005842 Bacteria 718
162 Ga0068860_100007764 3300005843 Bacteria 10716
163 Ga0068860_100017714 3300005843 Bacteria 6938
164 Ga0068860_100189365 3300005843 Bacteria 1991
165 Ga0068860_100400126 3300005843 Bacteria 1358
166 Ga0068860_101830061 3300005843 Unclassified 629
167 Ga0068862_100036060 3300005844 Bacteria 4189
168 Ga0068862_100245127 3300005844 Bacteria 1631
169 Ga0068862_100696433 3300005844 Unclassified 984
170 Ga0068862_101304442 3300005844 Bacteria 727
171 Ga0081539_10000407 3300005985 Bacteria 91696
172 Ga0070716_100020148 3300006173 Bacteria 3498
173 Ga0097621_100028667 3300006237 Bacteria 4389
174 Ga0097621_100249091 3300006237 Bacteria 1555
175 Ga0097621_100666066 3300006237 Bacteria 956
176 Ga0068871_100005373 3300006358 Bacteria 8977
177 Ga0068871_100139530 3300006358 Bacteria 2061
178 Ga0075428_100296721 3300006844 Bacteria 1738
179 Ga0075428_101244868 3300006844 Bacteria 784
180 Ga0075430_100703786 3300006846 Unclassified 833
181 Ga0075431_100191521 3300006847 Bacteria 2095
182 Ga0075431_100584819 3300006847 Bacteria 1101
183 Ga0075433_10042453 3300006852 Bacteria 3945
184 Ga0075433_10544534 3300006852 Bacteria 1021
185 Ga0075433_11075250 3300006852 Bacteria 700
186 Ga0075434_100079771 3300006871 Bacteria 3269
187 Ga0075434_100346220 3300006871 Bacteria 1507
188 Ga0075434_101249867 3300006871 Unclassified 754
189 Ga0075429_100448286 3300006880 Bacteria 1131
190 Ga0075436_100089397 3300006914 Bacteria 2140
191 Ga0097620_100002808 3300006931 Bacteria 17648
192 Ga0097620_100003853 3300006931 Bacteria 15325
193 Ga0097620_100033964 3300006931 Bacteria 5121
194 Ga0097620_100088350 3300006931 Bacteria 3149
195 Ga0097620_100100077 3300006931 Bacteria 2954
196 Ga0097620_100143881 3300006931 Bacteria 2458
197 Ga0097620_100174924 3300006931 Bacteria 2228
198 Ga0097620_100186920 3300006931 Bacteria 2156
199 Ga0097620_100227887 3300006931 Bacteria 1951
200 Ga0097620_100232811 3300006931 Bacteria 1930
201 Ga0097620_100283083 3300006931 Bacteria 1751
202 Ga0097620_100351224 3300006931 Bacteria 1569
203 Ga0097620_101664620 3300006931 Bacteria 705
204 Ga0097620_101971690 3300006931 Unclassified 645
205 Ga0075435_100087691 3300007076 Bacteria 2564
206 Ga0075435_100679946 3300007076 Bacteria 894
207 Ga0105251_10115457 3300009011 Bacteria 1221
208 Ga0105240_10038496 3300009093 Bacteria 6134
209 Ga0111539_10001336 3300009094 Bacteria 32835
210 Ga0111539_10102446 3300009094 Bacteria 3360
211 Ga0111539_10201166 3300009094 Bacteria 2323
212 Ga0111539_11299167 3300009094 Unclassified 844
213 Ga0105245_10847457 3300009098 Bacteria 954
214 Ga0105247_10000819 3300009101 Bacteria 23704
215 Ga0105247_10209372 3300009101 Bacteria 1314
216 Ga0105247_10215755 3300009101 Bacteria 1296
217 Ga0105247_10298496 3300009101 Bacteria 1117
218 Ga0105247_10378885 3300009101 Bacteria 1002
219 Ga0105247_11075062 3300009101 Bacteria 633
220 Ga0114129_10011837 3300009147 Bacteria 12409
221 Ga0114129_10048031 3300009147 Bacteria 5997
222 Ga0114129_10313111 3300009147 Bacteria 2089
223 Ga0114129_10483027 3300009147 Bacteria 1621
224 Ga0114129_10892505 3300009147 Bacteria 1127
225 Ga0105243_10237538 3300009148 Bacteria 1620
226 Ga0105243_10448727 3300009148 Bacteria 1210
227 Ga0105243_10528718 3300009148 Bacteria 1123
228 Ga0105243_10637151 3300009148 Bacteria 1031
229 Ga0105243_10663552 3300009148 Bacteria 1012
230 Ga0105243_11010076 3300009148 Bacteria 835
231 Ga0105241_10002866 3300009174 Bacteria 12886
232 Ga0105241_10065202 3300009174 Bacteria 2814
233 Ga0105241_10118901 3300009174 Bacteria 2125
234 Ga0105241_10137222 3300009174 Bacteria 1987
235 Ga0105241_10210636 3300009174 Bacteria 1628
236 Ga0105241_10317456 3300009174 Bacteria 1342
237 Ga0105241_10457251 3300009174 Bacteria 1130
238 Ga0105241_10527551 3300009174 Bacteria 1057
239 Ga0105241_10934698 3300009174 Bacteria 807
240 Ga0105241_10963180 3300009174 Bacteria 796
241 Ga0105241_11159709 3300009174 Bacteria 730
242 Ga0105241_11643277 3300009174 Bacteria 623
243 Ga0105241_12389900 3300009174 Bacteria 527
244 Ga0105242_10034046 3300009176 Bacteria 4083
245 Ga0105242_10117665 3300009176 Bacteria 2275
246 Ga0105242_11800731 3300009176 Bacteria 651
247 Ga0105248_10001571 3300009177 Bacteria 25421
248 Ga0105248_10002339 3300009177 Bacteria 21032
249 Ga0105248_10004801 3300009177 Bacteria 14961
250 Ga0105248_10222972 3300009177 Bacteria 2122
251 Ga0105248_10235525 3300009177 Bacteria 2061
252 Ga0105248_10691965 3300009177 Bacteria 1150
253 Ga0105248_11165688 3300009177 Bacteria 871
254 Ga0105248_11717621 3300009177 Bacteria 712
255 Ga0105237_10002641 3300009545 Bacteria 22063
256 Ga0105237_10021451 3300009545 Bacteria 6640
257 Ga0105237_10410788 3300009545 Bacteria 1359
258 Ga0105237_10412714 3300009545 Bacteria 1355
259 Ga0105237_10817713 3300009545 Bacteria 939
260 Ga0105237_11186061 3300009545 Bacteria 770
261 Ga0105238_10008559 3300009551 Bacteria 10236
262 Ga0105238_10028603 3300009551 Bacteria 5678
263 Ga0105238_11100177 3300009551 Bacteria 817
264 Ga0105249_10043905 3300009553 Bacteria 4065
265 Ga0105249_10045444 3300009553 Bacteria 3994
266 Ga0105249_10375546 3300009553 Bacteria 1446
267 Ga0105239_10046466 3300010375 Bacteria 4758
268 Ga0105239_10505674 3300010375 Bacteria 1374
269 Ga0105239_11352954 3300010375 Bacteria 822
270 Ga0105246_10557118 3300011119 Bacteria 983
271 Ga0105246_11016761 3300011119 Bacteria 751
272 Ga0105246_11231776 3300011119 Bacteria 690
273 Ga0157373_10015466 3300013100 Bacteria 5578
274 Ga0157373_10028246 3300013100 Bacteria 4047
275 Ga0157373_10537929 3300013100 Bacteria 846
276 Ga0157373_10897362 3300013100 Bacteria 657
277 Ga0157378_10410334 3300013297 Unclassified 1337
278 Ga0157378_11690658 3300013297 Bacteria 680
279 Ga0163162_10021630 3300013306 Bacteria 6336
280 Ga0163162_10043322 3300013306 Bacteria 4507
281 Ga0163162_10312700 3300013306 Bacteria 1703
282 Ga0163162_11149772 3300013306 Bacteria 880
283 Ga0163162_11187546 3300013306 Bacteria 866
284 Ga0163162_11375590 3300013306 Bacteria 803
285 Ga0157372_10531695 3300013307 Unclassified 1370
286 Ga0157372_10560256 3300013307 Bacteria 1332
287 Ga0157372_10998345 3300013307 Bacteria 969
288 Ga0157372_11277484 3300013307 Unclassified 847
289 Ga0157375_10038398 3300013308 Bacteria 4598
290 Ga0157375_11321447 3300013308 Bacteria 848
291 Ga0157375_11324298 3300013308 Bacteria 847
292 Ga0157375_11672563 3300013308 Bacteria 753
293 Ga0157375_12575484 3300013308 Bacteria 608
294 Ga0163163_10007264 3300014325 Bacteria 9767
295 Ga0163163_10018206 3300014325 Bacteria 6569
296 Ga0163163_10978892 3300014325 Bacteria 909
297 Ga0163163_11384629 3300014325 Bacteria 765
298 Ga0157380_10044984 3300014326 Bacteria 3462
299 Ga0157380_11257357 3300014326 Bacteria 786
300 Ga0157380_11322197 3300014326 Bacteria 769
301 Ga0157380_11401586 3300014326 Bacteria 749
302 Ga0157377_10328607 3300014745 Bacteria 1018
303 Ga0157377_10522962 3300014745 Bacteria 833
304 Ga0157377_10559238 3300014745 Bacteria 809
305 Ga0157377_10613305 3300014745 Bacteria 778
306 Ga0207656_10003437 3300025321 Bacteria 5443
307 Ga0207713_1072369 3300025735 Bacteria 1269
308 Ga0207653_10001589 3300025885 Bacteria 7336
309 Ga0207710_10000745 3300025900 Bacteria 17972
310 Ga0207710_10249626 3300025900 Bacteria 887
311 Ga0207647_10001169 3300025904 Bacteria 20225
312 Ga0207647_10023247 3300025904 Bacteria 4103
313 Ga0207647_10139564 3300025904 Bacteria 1421
314 Ga0207647_10290916 3300025904 Bacteria 931
315 Ga0207684_10000172 3300025910 Bacteria 106888
316 Ga0207684_10221519 3300025910 Bacteria 1633
317 Ga0207654_10014078 3300025911 Bacteria 4127
318 Ga0207654_10558637 3300025911 Bacteria 814
319 Ga0207654_10721718 3300025911 Bacteria 717
320 Ga0207707_10699514 3300025912 Bacteria 851
321 Ga0207695_10554503 3300025913 Bacteria 1031
322 Ga0207671_10008097 3300025914 Bacteria 8975
323 Ga0207671_10210142 3300025914 Bacteria 1522
324 Ga0207671_10236892 3300025914 Bacteria 1433
325 Ga0207671_10691752 3300025914 Bacteria 811
326 Ga0207660_10049600 3300025917 Bacteria 2977
327 Ga0207662_10035104 3300025918 Bacteria 2928
328 Ga0207652_10110053 3300025921 Bacteria 2443
329 Ga0207652_10421379 3300025921 Bacteria 1204
330 Ga0207652_11250371 3300025921 Bacteria 645
331 Ga0207646_10376628 3300025922 Bacteria 1282
332 Ga0207681_10022760 3300025923 Bacteria 4000
333 Ga0207694_10123528 3300025924 Bacteria 2069
334 Ga0207694_10216706 3300025924 Bacteria 1560
335 Ga0207650_10000022 3300025925 Bacteria 318878
336 Ga0207650_10053748 3300025925 Bacteria 2986
337 Ga0207650_10055116 3300025925 Bacteria 2950
338 Ga0207659_10862569 3300025926 Bacteria 778
339 Ga0207659_11237770 3300025926 Unclassified 641
340 Ga0207690_10114835 3300025932 Bacteria 1945
341 Ga0207690_10295691 3300025932 Bacteria 1265
342 Ga0207706_10638801 3300025933 Bacteria 912
343 Ga0207709_10166802 3300025935 Bacteria 1542
344 Ga0207709_11330219 3300025935 Bacteria 594
345 Ga0207670_10000531 3300025936 Bacteria 20964
346 Ga0207670_10097514 3300025936 Bacteria 2093
347 Ga0207670_10570512 3300025936 Unclassified 926
348 Ga0207691_10492318 3300025940 Bacteria 1041
349 Ga0207711_10013780 3300025941 Bacteria 6712
350 Ga0207711_10038231 3300025941 Bacteria 4080
351 Ga0207711_10161242 3300025941 Bacteria 2030
352 Ga0207711_10197275 3300025941 Bacteria 1836
353 Ga0207711_10438861 3300025941 Bacteria 1215
354 Ga0207711_10778280 3300025941 Bacteria 891
355 Ga0207689_10033823 3300025942 Bacteria 4246
356 Ga0207689_10396018 3300025942 Bacteria 1151
357 Ga0207679_11059922 3300025945 Bacteria 743
358 Ga0207667_10950810 3300025949 Bacteria 849
359 Ga0207651_10186778 3300025960 Bacteria 1650
360 Ga0207651_11221960 3300025960 Bacteria 675
361 Ga0207712_10034761 3300025961 Bacteria 3418
362 Ga0207712_10251594 3300025961 Bacteria 1428
363 Ga0207640_10014875 3300025981 Bacteria 4489
364 Ga0207640_10171300 3300025981 Bacteria 1618
365 Ga0207640_10959816 3300025981 Bacteria 750
366 Ga0207640_11618024 3300025981 Bacteria 584
367 Ga0207703_10038583 3300026035 Bacteria 3813
368 Ga0207703_10094513 3300026035 Bacteria 2520
369 Ga0207703_10933902 3300026035 Bacteria 831
370 Ga0207639_10329795 3300026041 Bacteria 1357
371 Ga0207708_10000087 3300026075 Bacteria 73043
372 Ga0207708_10021945 3300026075 Bacteria 4818
373 Ga0207708_10037723 3300026075 Bacteria 3681
374 Ga0207708_10055963 3300026075 Bacteria 3008
375 Ga0207708_10101639 3300026075 Bacteria 2225
376 Ga0207708_10455313 3300026075 Bacteria 1066
377 Ga0207708_10491910 3300026075 Bacteria 1027
378 Ga0207708_10586557 3300026075 Bacteria 943
379 Ga0207641_10031890 3300026088 Bacteria 4372
380 Ga0207641_10241100 3300026088 Bacteria 1685
381 Ga0207641_10537259 3300026088 Bacteria 1139
382 Ga0207641_10762333 3300026088 Bacteria 956
383 Ga0207641_10892964 3300026088 Bacteria 882
384 Ga0207641_11129978 3300026088 Bacteria 782
385 Ga0207648_10047355 3300026089 Bacteria 3769
386 Ga0207648_10189579 3300026089 Bacteria 1822
387 Ga0207648_10289355 3300026089 Bacteria 1467
388 Ga0207648_10341127 3300026089 Bacteria 1349
389 Ga0207648_10347211 3300026089 Bacteria 1337
390 Ga0207676_10019565 3300026095 Bacteria 4941
391 Ga0207676_10031460 3300026095 Bacteria 3991
392 Ga0207676_10172210 3300026095 Bacteria 1887
393 Ga0207676_10472944 3300026095 Bacteria 1185
394 Ga0207676_10618205 3300026095 Bacteria 1042
395 Ga0207676_10622772 3300026095 Bacteria 1039
396 Ga0207676_11124742 3300026095 Bacteria 777
397 Ga0207674_10059481 3300026116 Bacteria 3866
398 Ga0207674_10104800 3300026116 Bacteria 2806
399 Ga0207674_10150754 3300026116 Bacteria 2282
400 Ga0207674_10161931 3300026116 Bacteria 2192
401 Ga0207674_10742113 3300026116 Bacteria 948
402 Ga0207674_10865399 3300026116 Bacteria 871
403 Ga0207674_10995797 3300026116 Unclassified 807
404 Ga0207674_11203984 3300026116 Bacteria 727
405 Ga0207674_11278851 3300026116 Bacteria 703
406 Ga0207675_100004382 3300026118 Bacteria 13642
407 Ga0207675_100623667 3300026118 Bacteria 1083
408 Ga0207675_100652698 3300026118 Bacteria 1058
409 Ga0207698_10667191 3300026142 Bacteria 1032
410 Ga0207428_10004743 3300027907 Bacteria 12855
411 Ga0207428_10136446 3300027907 Bacteria 1875
412 Ga0268265_10302128 3300028380 Bacteria 1442
413 Ga0268264_10029518 3300028381 Bacteria 4492
414 Ga0268264_10263273 3300028381 Bacteria 1607
415 Ga0268264_10282024 3300028381 Bacteria 1557
416 Ga0268264_10297990 3300028381 Bacteria 1517
417 Ga0268264_10326445 3300028381 Bacteria 1453
418 Ga0268264_10422163 3300028381 Bacteria 1286
419 Ga0316182_1432847 3300030745 Bacteria 1719
420 Ga0307408_100020033 3300031548 Bacteria 4509
421 Ga0307408_100244814 3300031548 Bacteria 1476
422 Ga0307408_100497679 3300031548 Bacteria 1066
423 Ga0307408_100898024 3300031548 Bacteria 811
424 Ga0307405_10057201 3300031731 Bacteria 2449
425 Ga0307405_10357849 3300031731 Bacteria 1128
426 Ga0307413_10085050 3300031824 Bacteria 2041
427 Ga0307410_10061410 3300031852 Bacteria 2572
428 Ga0307406_10012520 3300031901 Bacteria 4835
429 Ga0307412_10008521 3300031911 Bacteria 5859
430 Ga0307416_100021200 3300032002 Bacteria 4659
431 Ga0307416_100122631 3300032002 Bacteria 2320
432 Ga0307416_100317532 3300032002 Bacteria 1558
433 Ga0307416_101328461 3300032002 Bacteria 825
434 Ga0307414_10190039 3300032004 Bacteria 1660
435 Ga0307414_10496321 3300032004 Bacteria 1079
436 Ga0307411_10265594 3300032005 Bacteria 1358
437 Ga0307411_11447660 3300032005 Bacteria 630
438 Ga0307415_100000991 3300032126 Bacteria 13108
439 Ga0307415_101012572 3300032126 Bacteria 773
440 Ga0373949_0110781 3300035090 Unclassified 762
441 Ga0373951_0000859 3300035091 Bacteria 8215
442 Ga0373952_0174201 3300035092 Unclassified 617
443 Ga0373932_0039673 3300035112 Bacteria 1352
444 Ga0373941_0009537 3300035115 Bacteria 2449
445 Ga0373961_0042894 3300035241 Bacteria 1313
446 Ga0395900_0113790 3300037418 Bacteria 2777
447 Ga0395900_0641165 3300037418 Bacteria 1000
448 Ga0395898_0182035 3300037466 Bacteria 2008
449 Ga0395898_0324033 3300037466 Bacteria 1470
450 Ga0395898_0341978 3300037466 Bacteria 1427
451 Ga0242420_017424 3300038996 Unclassified 1257
452 Ga0439439_0082301 3300041406 Bacteria 872
453 Ga0439455_0010795 3300042012 Bacteria 2017
454 Ga0439458_0010139 3300042157 Bacteria 2098
455 Ga0451576_0200984 3300045051 Bacteria 2082
456 Ga0496100_0936359 3300048903 Bacteria 681
457 Ga0496102_0836472 3300048905 Bacteria 843
458 Ga0496106_0110987 3300048909 Bacteria 2135
459 Ga0496108_0299193 3300048911 Bacteria 1401
460 Ga0496109_0723977 3300048912 Bacteria 933
461 Ga0496110_0640116 3300048913 Bacteria 963
462 Ga0496112_0224532 3300048915 Bacteria 1834
463 Ga0496112_0350508 3300048915 Bacteria 1419
464 Ga0496112_1176635 3300048915 Unclassified 684
465 Ga0496113_0078824 3300048916 Bacteria 2521
466 Ga0496113_0368590 3300048916 Bacteria 1153
467 Ga0496113_0815520 3300048916 Bacteria 741
468 Ga0501292_025737 3300049515 Bacteria 970
469 Ga0501296_006382 3300049519 Bacteria 1335
470 Ga0501298_052336 3300049521 Bacteria 850
471 Ga0501299_024595 3300049522 Bacteria 1125
472 Ga0501302_012880 3300049525 Bacteria 634
473 Ga0501076_0895544 3300049592 Bacteria 732
474 Ga0501198_038421 3300049649 Bacteria 822
475 Ga0501199_004551 3300049650 Bacteria 1368
476 Ga0501202_002680 3300049652 Bacteria 3005
477 Ga0501202_003498 3300049652 Bacteria 2693
478 Ga0501207_001767 3300049654 Bacteria 2734
479 Ga0501207_044977 3300049654 Bacteria 776
480 Ga0501214_003880 3300049659 Bacteria 1353
481 Ga0501216_004464 3300049660 Bacteria 2078
482 Ga0501216_054278 3300049660 Bacteria 794
483 Ga0501217_000158 3300049661 Bacteria 9539
484 Ga0501217_017062 3300049661 Bacteria 1671
485 Ga0501217_035638 3300049661 Bacteria 1245
486 Ga0501223_003805 3300049663 Bacteria 3262
487 Ga0501224_002160 3300049664 Bacteria 2666
488 Ga0501224_019472 3300049664 Bacteria 1011
489 Ga0501227_002994 3300049665 Bacteria 3690
490 Ga0501230_001873 3300049667 Bacteria 2594
491 Ga0501230_005418 3300049667 Bacteria 1805
492 Ga0501233_005408 3300049668 Bacteria 2370
493 Ga0501233_018556 3300049668 Bacteria 1464
494 Ga0501233_106427 3300049668 Bacteria 746
495 Ga0501233_137498 3300049668 Bacteria 672
496 Ga0501235_018043 3300049669 Bacteria 1562
497 Ga0501235_026164 3300049669 Bacteria 1306
498 Ga0501236_005193 3300049670 Bacteria 1569
499 Ga0501240_000583 3300049673 Bacteria 3062
500 Ga0501240_010695 3300049673 Bacteria 1224
501 Ga0501242_034083 3300049674 Bacteria 699
502 Ga0501249_095305 3300049679 Bacteria 709
503 Ga0501250_038684 3300049680 Bacteria 692
504 Ga0501253_005132 3300049683 Bacteria 1697
505 Ga0501253_077619 3300049683 Bacteria 744
506 Ga0501256_002487 3300049685 Bacteria 1468
507 Ga0501256_010795 3300049685 Bacteria 875
508 Ga0501260_005970 3300049689 Bacteria 1161
509 Ga0501261_053920 3300049690 Bacteria 666
510 Ga0501221_033393 3300049704 Bacteria 1086
511 Ga0501225_0001760 3300049705 Bacteria 6785
512 Ga0501225_0207734 3300049705 Bacteria 624
513 Ga0501229_003087 3300049706 Bacteria 1981
514 Ga0501234_026646 3300049707 Bacteria 928
515 Ga0501234_038579 3300049707 Bacteria 779
516 Ga0501245_003911 3300049708 Bacteria 2036
517 Ga0501264_009273 3300049761 Bacteria 936
518 Ga0501268_021954 3300049765 Bacteria 1099
519 Ga0501268_034662 3300049765 Bacteria 928
520 Ga0501271_044193 3300049768 Bacteria 588
521 Ga0501272_053437 3300049769 Bacteria 565
522 Ga0501278_035790 3300049774 Bacteria 522
523 Ga0501279_035618 3300049775 Bacteria 750
524 Ga0501283_001293 3300049779 Bacteria 3285
525 Ga0501035_0969542 3300049822 Bacteria 670
526 Ga0501204_004553 3300049850 Bacteria 1497
527 Ga0501212_003606 3300049851 Bacteria 1954
528 Ga0501212_007050 3300049851 Bacteria 1531
529 Ga0501226_001610 3300049853 Bacteria 2860
530 Ga0501226_015661 3300049853 Bacteria 836
531 nmdc:mga05p37_109434_c1 3300050507 Bacteria 3399
532 nmdc:mga05p37_135232_c1 3300050507 Bacteria 3024
533 nmdc:mga09592_425127_c1 3300050508 Bacteria 1147
534 nmdc:mga0qj67_243968_c1 3300050509 Bacteria 1457
535 nmdc:mga0qj67_509054_c1 3300050509 Bacteria 968
536 nmdc:mga06r32_280498_c1 3300050510 Bacteria 1653
537 nmdc:mga06r32_93810_c1 3300050510 Bacteria 2936
538 nmdc:mga08y16_1383_c1 3300050511 Bacteria 24251
539 nmdc:mga08y16_145834_c1 3300050511 Bacteria 2461
540 nmdc:mga08y16_518191_c1 3300050511 Bacteria 1209
541 nmdc:mga08y16_87892_c1 3300050511 Bacteria 3238
542 nmdc:mga0n895_153091_c1 3300050512 Bacteria 2336
543 nmdc:mga0n895_64074_c1 3300050512 Bacteria 3635
544 nmdc:mga0n895_711317_c1 3300050512 Bacteria 1000
545 nmdc:mga0n895_949064_c1 3300050512 Bacteria 843
546 nmdc:mga0rr50_7056_c1 3300050513 Bacteria 6895
547 nmdc:mga08x19_15088_c2 3300050514 Bacteria 2157
548 nmdc:mga0a205_154302_c1 3300050515 Bacteria 2195
549 nmdc:mga0a205_24062_c1 3300050515 Bacteria 5784
550 nmdc:mga0a205_333328_c1 3300050515 Bacteria 1387
551 Ga0501084_0527992 3300054114 Bacteria 998
552 Ga0530510_0111388 3300061734 Bacteria 2005

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10007217 Ga0070692_100072174 155
2 3300005406 Ga0070703_10002431 Ga0070703_100024313 155
3 3300005440 Ga0070705_100008941 Ga0070705_1000089412 155
4 3300005441 Ga0070700_100040071 Ga0070700_1000400712 155
5 3300005444 Ga0070694_100002992 Ga0070694_1000029924 155
6 3300005467 Ga0070706_100000616 Ga0070706_10000061623 155
7 3300005539 Ga0068853_101074310 Ga0068853_1010743101 155
8 3300005545 Ga0070695_100539625 Ga0070695_1005396252 155
9 3300005546 Ga0070696_100058366 Ga0070696_1000583663 155
10 3300005547 Ga0070693_100087052 Ga0070693_1000870522 155
11 3300005549 Ga0070704_100086001 Ga0070704_1000860013 155
12 3300005563 Ga0068855_101046256 Ga0068855_1010462561 155
13 3300005578 Ga0068854_100436356 Ga0068854_1004363562 155
14 3300005615 Ga0070702_100070382 Ga0070702_1000703823 155
15 3300005616 Ga0068852_100734395 Ga0068852_1007343952 155
16 3300005617 Ga0068859_100100075 Ga0068859_1001000752 155
17 3300005834 Ga0068851_10001845 Ga0068851_100018459 155
18 3300005842 Ga0068858_100152417 Ga0068858_1001524172 155
19 3300006844 Ga0075428_101244868 Ga0075428_1012448681 155
20 3300006852 Ga0075433_10042453 Ga0075433_100424534 155
21 3300006852 Ga0075433_11075250 Ga0075433_110752501 155
22 3300006871 Ga0075434_101249867 Ga0075434_1012498672 155
23 3300006931 Ga0097620_100100077 Ga0097620_1001000772 155
24 3300009093 Ga0105240_10038496 Ga0105240_100384965 155
25 3300009094 Ga0111539_10201166 Ga0111539_102011662 155
26 3300009147 Ga0114129_10011837 Ga0114129_1001183711 155
27 3300009545 Ga0105237_10002641 Ga0105237_1000264111 155
28 3300010375 Ga0105239_10046466 Ga0105239_100464664 155
29 3300013307 Ga0157372_10998345 Ga0157372_109983452 155
30 3300025321 Ga0207656_10003437 Ga0207656_100034376 155
31 3300025885 Ga0207653_10001589 Ga0207653_100015894 155
32 3300025904 Ga0207647_10139564 Ga0207647_101395642 155
33 3300025910 Ga0207684_10000172 Ga0207684_1000017286 155
34 3300025913 Ga0207695_10554503 Ga0207695_105545032 155
35 3300025914 Ga0207671_10008097 Ga0207671_100080973 155
36 3300025936 Ga0207670_10570512 Ga0207670_105705122 155
37 3300026035 Ga0207703_10094513 Ga0207703_100945132 155
38 3300026075 Ga0207708_10101639 Ga0207708_101016392 155
39 3300037418 Ga0395900_0641165 Ga0395900_0641165_298_765 155
40 3300037466 Ga0395898_0324033 Ga0395898_0324033_251_718 155
41 3300048916 Ga0496113_0078824 Ga0496113_0078824_166_633 155
42 3300049654 Ga0501207_044977 Ga0501207_044977_16_483 155
43 3300049668 Ga0501233_018556 Ga0501233_018556_732_1199 155
44 3300049774 Ga0501278_035790 Ga0501278_035790_25_492 155
45 3300049851 Ga0501212_007050 Ga0501212_007050_857_1324 155
46 3300050507 nmdc:mga05p37_135232_c1 nmdc:mga05p37_135232_c1_1721_2188 155
47 3300050511 nmdc:mga08y16_87892_c1 nmdc:mga08y16_87892_c1_269_736 155
48 3300050512 nmdc:mga0n895_949064_c1 nmdc:mga0n895_949064_c1_329_796 155
49 3300050515 nmdc:mga0a205_24062_c1 nmdc:mga0a205_24062_c1_2733_3200 155
50 3300003203 JGI25406J46586_10018162 JGI25406J46586_100181624 156
51 3300005293 Ga0065715_10158954 Ga0065715_101589542 156
52 3300005293 Ga0065715_10460842 Ga0065715_104608422 156
53 3300005293 Ga0065715_10553748 Ga0065715_105537481 156
54 3300005330 Ga0070690_100042298 Ga0070690_1000422983 156
55 3300005364 Ga0070673_100546363 Ga0070673_1005463632 156
56 3300005365 Ga0070688_100376623 Ga0070688_1003766232 156
57 3300005440 Ga0070705_100018334 Ga0070705_1000183342 156
58 3300005441 Ga0070700_100262075 Ga0070700_1002620752 156
59 3300005444 Ga0070694_100245983 Ga0070694_1002459832 156
60 3300005444 Ga0070694_100627768 Ga0070694_1006277682 156
61 3300005444 Ga0070694_101498937 Ga0070694_1014989371 156
62 3300005458 Ga0070681_10372427 Ga0070681_103724272 156
63 3300005530 Ga0070679_100467210 Ga0070679_1004672102 156
64 3300005545 Ga0070695_100141532 Ga0070695_1001415322 156
65 3300005549 Ga0070704_100037403 Ga0070704_1000374032 156
66 3300005617 Ga0068859_100002808 Ga0068859_1000028082 156
67 3300005617 Ga0068859_100174930 Ga0068859_1001749302 156
68 3300005617 Ga0068859_100283093 Ga0068859_1002830932 156
69 3300005842 Ga0068858_100056291 Ga0068858_1000562914 156
70 3300005842 Ga0068858_100387289 Ga0068858_1003872891 156
71 3300005842 Ga0068858_100812126 Ga0068858_1008121262 156
72 3300005843 Ga0068860_100189365 Ga0068860_1001893653 156
73 3300005985 Ga0081539_10000407 Ga0081539_1000040782 156
74 3300006847 Ga0075431_100191521 Ga0075431_1001915213 156
75 3300006847 Ga0075431_100584819 Ga0075431_1005848192 156
76 3300006880 Ga0075429_100448286 Ga0075429_1004482862 156
77 3300006931 Ga0097620_100002808 Ga0097620_10000280824 156
78 3300006931 Ga0097620_100174924 Ga0097620_1001749242 156
79 3300006931 Ga0097620_100283083 Ga0097620_1002830832 156
80 3300009101 Ga0105247_10000819 Ga0105247_100008199 156
81 3300009101 Ga0105247_10298496 Ga0105247_102984962 156
82 3300009147 Ga0114129_10048031 Ga0114129_100480316 156
83 3300009148 Ga0105243_10528718 Ga0105243_105287182 156
84 3300009174 Ga0105241_10457251 Ga0105241_104572512 156
85 3300009176 Ga0105242_11800731 Ga0105242_118007311 156
86 3300009177 Ga0105248_10002339 Ga0105248_1000233917 156
87 3300009177 Ga0105248_10222972 Ga0105248_102229723 156
88 3300009545 Ga0105237_10021451 Ga0105237_100214515 156
89 3300009545 Ga0105237_10410788 Ga0105237_104107882 156
90 3300009545 Ga0105237_10412714 Ga0105237_104127142 156
91 3300009545 Ga0105237_10817713 Ga0105237_108177132 156
92 3300011119 Ga0105246_11016761 Ga0105246_110167612 156
93 3300011119 Ga0105246_11231776 Ga0105246_112317762 156
94 3300013306 Ga0163162_11149772 Ga0163162_111497721 156
95 3300025900 Ga0207710_10000745 Ga0207710_100007457 156
96 3300025900 Ga0207710_10249626 Ga0207710_102496262 156
97 3300025904 Ga0207647_10023247 Ga0207647_100232474 156
98 3300025914 Ga0207671_10210142 Ga0207671_102101422 156
99 3300025914 Ga0207671_10236892 Ga0207671_102368922 156
100 3300025914 Ga0207671_10691752 Ga0207671_106917522 156
101 3300025921 Ga0207652_10421379 Ga0207652_104213792 156
102 3300025935 Ga0207709_11330219 Ga0207709_113302191 156
103 3300025941 Ga0207711_10038231 Ga0207711_100382312 156
104 3300025941 Ga0207711_10197275 Ga0207711_101972753 156
105 3300025981 Ga0207640_11618024 Ga0207640_116180241 156
106 3300026035 Ga0207703_10038583 Ga0207703_100385833 156
107 3300026035 Ga0207703_10933902 Ga0207703_109339022 156
108 3300026041 Ga0207639_10329795 Ga0207639_103297952 156
109 3300026075 Ga0207708_10055963 Ga0207708_100559632 156
110 3300026116 Ga0207674_10995797 Ga0207674_109957972 156
111 3300026116 Ga0207674_11203984 Ga0207674_112039842 156
112 3300026142 Ga0207698_10667191 Ga0207698_106671912 156
113 3300028381 Ga0268264_10297990 Ga0268264_102979902 156
114 3300031548 Ga0307408_100020033 Ga0307408_1000200333 156
115 3300031731 Ga0307405_10057201 Ga0307405_100572012 156
116 3300031824 Ga0307413_10085050 Ga0307413_100850502 156
117 3300031852 Ga0307410_10061410 Ga0307410_100614104 156
118 3300031901 Ga0307406_10012520 Ga0307406_100125202 156
119 3300031911 Ga0307412_10008521 Ga0307412_100085212 156
120 3300032002 Ga0307416_100122631 Ga0307416_1001226311 156
121 3300032004 Ga0307414_10190039 Ga0307414_101900392 156
122 3300032005 Ga0307411_11447660 Ga0307411_114476601 156
123 3300032126 Ga0307415_100000991 Ga0307415_1000009916 156
124 3300037418 Ga0395900_0113790 Ga0395900_0113790_2190_2660 156
125 3300037466 Ga0395898_0182035 Ga0395898_0182035_489_959 156
126 3300038996 Ga0242420_017424 Ga0242420_017424_551_1021 156
127 3300048903 Ga0496100_0936359 Ga0496100_0936359_65_535 156
128 3300048909 Ga0496106_0110987 Ga0496106_0110987_270_740 156
129 3300048916 Ga0496113_0815520 Ga0496113_0815520_33_503 156
130 3300049521 Ga0501298_052336 Ga0501298_052336_367_837 156
131 3300049650 Ga0501199_004551 Ga0501199_004551_846_1316 156
132 3300049652 Ga0501202_002680 Ga0501202_002680_859_1329 156
133 3300049654 Ga0501207_001767 Ga0501207_001767_1678_2148 156
134 3300049659 Ga0501214_003880 Ga0501214_003880_427_897 156
135 3300049660 Ga0501216_004464 Ga0501216_004464_1149_1619 156
136 3300049661 Ga0501217_000158 Ga0501217_000158_4546_5016 156
137 3300049663 Ga0501223_003805 Ga0501223_003805_1978_2448 156
138 3300049664 Ga0501224_002160 Ga0501224_002160_609_1079 156
139 3300049665 Ga0501227_002994 Ga0501227_002994_2023_2493 156
140 3300049667 Ga0501230_001873 Ga0501230_001873_1336_1806 156
141 3300049668 Ga0501233_005408 Ga0501233_005408_726_1196 156
142 3300049669 Ga0501235_026164 Ga0501235_026164_42_512 156
143 3300049670 Ga0501236_005193 Ga0501236_005193_202_672 156
144 3300049673 Ga0501240_000583 Ga0501240_000583_1338_1808 156
145 3300049674 Ga0501242_034083 Ga0501242_034083_62_532 156
146 3300049683 Ga0501253_077619 Ga0501253_077619_61_531 156
147 3300049685 Ga0501256_002487 Ga0501256_002487_414_884 156
148 3300049689 Ga0501260_005970 Ga0501260_005970_199_669 156
149 3300049705 Ga0501225_0001760 Ga0501225_0001760_1171_1641 156
150 3300049706 Ga0501229_003087 Ga0501229_003087_145_615 156
151 3300049707 Ga0501234_026646 Ga0501234_026646_204_674 156
152 3300049765 Ga0501268_034662 Ga0501268_034662_46_516 156
153 3300049775 Ga0501279_035618 Ga0501279_035618_121_591 156
154 3300049850 Ga0501204_004553 Ga0501204_004553_994_1464 156
155 3300049851 Ga0501212_003606 Ga0501212_003606_609_1079 156
156 3300049853 Ga0501226_001610 Ga0501226_001610_1402_1872 156
157 3300050507 nmdc:mga05p37_109434_c1 nmdc:mga05p37_109434_c1_68_556 156
158 3300050508 nmdc:mga09592_425127_c1 nmdc:mga09592_425127_c1_339_809 156
159 3300050509 nmdc:mga0qj67_509054_c1 nmdc:mga0qj67_509054_c1_241_711 156
160 3300050510 nmdc:mga06r32_280498_c1 nmdc:mga06r32_280498_c1_476_946 156
161 3300050510 nmdc:mga06r32_93810_c1 nmdc:mga06r32_93810_c1_1872_2342 156
162 3300002459 JGI24751J29686_10000050 JGI24751J29686_1000005013 157
163 3300003320 rootH2_10054533 rootH2_100545332 157
164 3300003322 rootL2_10137033 rootL2_101370332 157
165 3300003322 rootL2_10138097 rootL2_101380972 157
166 3300005288 Ga0065714_10065325 Ga0065714_100653258 157
167 3300005289 Ga0065704_10097557 Ga0065704_100975573 157
168 3300005290 Ga0065712_10057129 Ga0065712_100571291 157
169 3300005290 Ga0065712_10068401 Ga0065712_100684018 157
170 3300005290 Ga0065712_10468174 Ga0065712_104681741 157
171 3300005293 Ga0065715_10001359 Ga0065715_100013593 157
172 3300005293 Ga0065715_10179393 Ga0065715_101793931 157
173 3300005293 Ga0065715_10334890 Ga0065715_103348902 157
174 3300005293 Ga0065715_10453322 Ga0065715_104533221 157
175 3300005295 Ga0065707_10000960 Ga0065707_100009603 157
176 3300005328 Ga0070676_10077707 Ga0070676_100777072 157
177 3300005329 Ga0070683_102184474 Ga0070683_1021844741 157
178 3300005330 Ga0070690_100386813 Ga0070690_1003868132 157
179 3300005331 Ga0070670_100000266 Ga0070670_1000002669 157
180 3300005331 Ga0070670_100792850 Ga0070670_1007928501 157
181 3300005333 Ga0070677_10141856 Ga0070677_101418562 157
182 3300005334 Ga0068869_100199513 Ga0068869_1001995132 157
183 3300005334 Ga0068869_100489625 Ga0068869_1004896252 157
184 3300005334 Ga0068869_101032494 Ga0068869_1010324941 157
185 3300005336 Ga0070680_100036035 Ga0070680_1000360352 157
186 3300005337 Ga0070682_100002088 Ga0070682_10000208812 157
187 3300005337 Ga0070682_100434879 Ga0070682_1004348792 157
188 3300005339 Ga0070660_100615307 Ga0070660_1006153072 157
189 3300005343 Ga0070687_100688708 Ga0070687_1006887082 157
190 3300005343 Ga0070687_100933278 Ga0070687_1009332781 157
191 3300005345 Ga0070692_10159233 Ga0070692_101592333 157
192 3300005345 Ga0070692_10187016 Ga0070692_101870162 157
193 3300005353 Ga0070669_100069297 Ga0070669_1000692973 157
194 3300005353 Ga0070669_101558258 Ga0070669_1015582581 157
195 3300005354 Ga0070675_100287224 Ga0070675_1002872242 157
196 3300005354 Ga0070675_100645331 Ga0070675_1006453311 157
197 3300005364 Ga0070673_100350173 Ga0070673_1003501732 157
198 3300005364 Ga0070673_100599331 Ga0070673_1005993311 157
199 3300005365 Ga0070688_101005584 Ga0070688_1010055841 157
200 3300005366 Ga0070659_100565902 Ga0070659_1005659022 157
201 3300005434 Ga0070709_10137638 Ga0070709_101376382 157
202 3300005440 Ga0070705_100228041 Ga0070705_1002280412 157
203 3300005440 Ga0070705_101026385 Ga0070705_1010263851 157
204 3300005440 Ga0070705_101556456 Ga0070705_1015564561 157
205 3300005441 Ga0070700_100000131 Ga0070700_10000013142 157
206 3300005441 Ga0070700_100024587 Ga0070700_1000245873 157
207 3300005441 Ga0070700_100146928 Ga0070700_1001469282 157
208 3300005441 Ga0070700_100375124 Ga0070700_1003751242 157
209 3300005444 Ga0070694_100206393 Ga0070694_1002063932 157
210 3300005444 Ga0070694_100213296 Ga0070694_1002132962 157
211 3300005445 Ga0070708_100433420 Ga0070708_1004334201 157
212 3300005457 Ga0070662_100795248 Ga0070662_1007952481 157
213 3300005458 Ga0070681_10180599 Ga0070681_101805992 157
214 3300005458 Ga0070681_10840704 Ga0070681_108407041 157
215 3300005459 Ga0068867_100072859 Ga0068867_1000728592 157
216 3300005466 Ga0070685_10647594 Ga0070685_106475942 157
217 3300005467 Ga0070706_100521910 Ga0070706_1005219102 157
218 3300005468 Ga0070707_100026882 Ga0070707_1000268827 157
219 3300005471 Ga0070698_100004211 Ga0070698_1000042117 157
220 3300005518 Ga0070699_100003366 Ga0070699_10000336610 157
221 3300005518 Ga0070699_100125455 Ga0070699_1001254553 157
222 3300005518 Ga0070699_101194722 Ga0070699_1011947221 157
223 3300005530 Ga0070679_100147963 Ga0070679_1001479633 157
224 3300005536 Ga0070697_100030061 Ga0070697_1000300613 157
225 3300005539 Ga0068853_100632526 Ga0068853_1006325261 157
226 3300005539 Ga0068853_101169992 Ga0068853_1011699921 157
227 3300005543 Ga0070672_101119969 Ga0070672_1011199692 157
228 3300005544 Ga0070686_100545413 Ga0070686_1005454132 157
229 3300005545 Ga0070695_100152925 Ga0070695_1001529252 157
230 3300005545 Ga0070695_100519204 Ga0070695_1005192042 157
231 3300005546 Ga0070696_100044574 Ga0070696_1000445744 157
232 3300005546 Ga0070696_100194217 Ga0070696_1001942172 157
233 3300005546 Ga0070696_100625555 Ga0070696_1006255552 157
234 3300005547 Ga0070693_100282842 Ga0070693_1002828421 157
235 3300005549 Ga0070704_101141525 Ga0070704_1011415252 157
236 3300005577 Ga0068857_100188211 Ga0068857_1001882112 157
237 3300005577 Ga0068857_101134524 Ga0068857_1011345242 157
238 3300005577 Ga0068857_102061809 Ga0068857_1020618091 157
239 3300005614 Ga0068856_102152281 Ga0068856_1021522811 157
240 3300005615 Ga0070702_100283122 Ga0070702_1002831222 157
241 3300005615 Ga0070702_100307977 Ga0070702_1003079772 157
242 3300005615 Ga0070702_100679934 Ga0070702_1006799342 157
243 3300005617 Ga0068859_100003853 Ga0068859_1000038534 157
244 3300005617 Ga0068859_100033966 Ga0068859_1000339665 157
245 3300005617 Ga0068859_100088357 Ga0068859_1000883572 157
246 3300005617 Ga0068859_100143877 Ga0068859_1001438772 157
247 3300005617 Ga0068859_100186915 Ga0068859_1001869152 157
248 3300005617 Ga0068859_100227879 Ga0068859_1002278792 157
249 3300005617 Ga0068859_100232810 Ga0068859_1002328102 157
250 3300005617 Ga0068859_100351228 Ga0068859_1003512282 157
251 3300005617 Ga0068859_101664290 Ga0068859_1016642901 157
252 3300005617 Ga0068859_101971555 Ga0068859_1019715551 157
253 3300005618 Ga0068864_100000619 Ga0068864_1000006198 157
254 3300005618 Ga0068864_100191475 Ga0068864_1001914751 157
255 3300005618 Ga0068864_100370217 Ga0068864_1003702172 157
256 3300005618 Ga0068864_100925109 Ga0068864_1009251092 157
257 3300005618 Ga0068864_101021776 Ga0068864_1010217761 157
258 3300005719 Ga0068861_100000821 Ga0068861_10000082110 157
259 3300005840 Ga0068870_10035986 Ga0068870_100359863 157
260 3300005840 Ga0068870_10354568 Ga0068870_103545682 157
261 3300005841 Ga0068863_100058964 Ga0068863_1000589642 157
262 3300005841 Ga0068863_100107284 Ga0068863_1001072842 157
263 3300005841 Ga0068863_100670222 Ga0068863_1006702222 157
264 3300005842 Ga0068858_100079286 Ga0068858_1000792862 157
265 3300005842 Ga0068858_100214779 Ga0068858_1002147792 157
266 3300005842 Ga0068858_101293496 Ga0068858_1012934962 157
267 3300005843 Ga0068860_100007764 Ga0068860_10000776413 157
268 3300005843 Ga0068860_100017714 Ga0068860_1000177146 157
269 3300005843 Ga0068860_100400126 Ga0068860_1004001262 157
270 3300005843 Ga0068860_101830061 Ga0068860_1018300612 157
271 3300005844 Ga0068862_100036060 Ga0068862_1000360603 157
272 3300005844 Ga0068862_100245127 Ga0068862_1002451272 157
273 3300005844 Ga0068862_101304442 Ga0068862_1013044422 157
274 3300006173 Ga0070716_100020148 Ga0070716_1000201482 157
275 3300006237 Ga0097621_100028667 Ga0097621_1000286673 157
276 3300006237 Ga0097621_100249091 Ga0097621_1002490912 157
277 3300006237 Ga0097621_100666066 Ga0097621_1006660662 157
278 3300006358 Ga0068871_100005373 Ga0068871_1000053734 157
279 3300006358 Ga0068871_100139530 Ga0068871_1001395302 157
280 3300006844 Ga0075428_100296721 Ga0075428_1002967212 157
281 3300006846 Ga0075430_100703786 Ga0075430_1007037861 157
282 3300006914 Ga0075436_100089397 Ga0075436_1000893972 157
283 3300006931 Ga0097620_100003853 Ga0097620_1000038534 157
284 3300006931 Ga0097620_100033964 Ga0097620_1000339643 157
285 3300006931 Ga0097620_100088350 Ga0097620_1000883502 157
286 3300006931 Ga0097620_100143881 Ga0097620_1001438812 157
287 3300006931 Ga0097620_100186920 Ga0097620_1001869202 157
288 3300006931 Ga0097620_100227887 Ga0097620_1002278872 157
289 3300006931 Ga0097620_100232811 Ga0097620_1002328113 157
290 3300006931 Ga0097620_100351224 Ga0097620_1003512242 157
291 3300006931 Ga0097620_101664620 Ga0097620_1016646201 157
292 3300006931 Ga0097620_101971690 Ga0097620_1019716901 157
293 3300009011 Ga0105251_10115457 Ga0105251_101154572 157
294 3300009094 Ga0111539_10001336 Ga0111539_1000133630 157
295 3300009094 Ga0111539_10102446 Ga0111539_101024464 157
296 3300009094 Ga0111539_11299167 Ga0111539_112991672 157
297 3300009101 Ga0105247_10209372 Ga0105247_102093722 157
298 3300009101 Ga0105247_10215755 Ga0105247_102157552 157
299 3300009101 Ga0105247_10378885 Ga0105247_103788852 157
300 3300009101 Ga0105247_11075062 Ga0105247_110750621 157
301 3300009147 Ga0114129_10483027 Ga0114129_104830272 157
302 3300009147 Ga0114129_10892505 Ga0114129_108925052 157
303 3300009148 Ga0105243_10237538 Ga0105243_102375382 157
304 3300009148 Ga0105243_10448727 Ga0105243_104487271 157
305 3300009148 Ga0105243_10663552 Ga0105243_106635522 157
306 3300009148 Ga0105243_11010076 Ga0105243_110100762 157
307 3300009174 Ga0105241_10002866 Ga0105241_100028662 157
308 3300009174 Ga0105241_10065202 Ga0105241_100652022 157
309 3300009174 Ga0105241_10118901 Ga0105241_101189012 157
310 3300009174 Ga0105241_10210636 Ga0105241_102106362 157
311 3300009174 Ga0105241_10317456 Ga0105241_103174562 157
312 3300009174 Ga0105241_10527551 Ga0105241_105275512 157
313 3300009174 Ga0105241_10934698 Ga0105241_109346982 157
314 3300009174 Ga0105241_10963180 Ga0105241_109631801 157
315 3300009174 Ga0105241_11159709 Ga0105241_111597091 157
316 3300009174 Ga0105241_11643277 Ga0105241_116432771 157
317 3300009174 Ga0105241_12389900 Ga0105241_123899001 157
318 3300009176 Ga0105242_10034046 Ga0105242_100340464 157
319 3300009177 Ga0105248_10001571 Ga0105248_1000157111 157
320 3300009177 Ga0105248_10004801 Ga0105248_1000480114 157
321 3300009177 Ga0105248_10235525 Ga0105248_102355252 157
322 3300009177 Ga0105248_10691965 Ga0105248_106919652 157
323 3300009177 Ga0105248_11165688 Ga0105248_111656882 157
324 3300009177 Ga0105248_11717621 Ga0105248_117176211 157
325 3300009545 Ga0105237_11186061 Ga0105237_111860612 157
326 3300009551 Ga0105238_10008559 Ga0105238_1000855910 157
327 3300009551 Ga0105238_10028603 Ga0105238_100286036 157
328 3300009551 Ga0105238_11100177 Ga0105238_111001772 157
329 3300009553 Ga0105249_10045444 Ga0105249_100454444 157
330 3300009553 Ga0105249_10375546 Ga0105249_103755462 157
331 3300010375 Ga0105239_10505674 Ga0105239_105056742 157
332 3300010375 Ga0105239_11352954 Ga0105239_113529541 157
333 3300011119 Ga0105246_10557118 Ga0105246_105571182 157
334 3300013100 Ga0157373_10015466 Ga0157373_100154664 157
335 3300013100 Ga0157373_10028246 Ga0157373_100282464 157
336 3300013100 Ga0157373_10537929 Ga0157373_105379292 157
337 3300013100 Ga0157373_10897362 Ga0157373_108973621 157
338 3300013297 Ga0157378_10410334 Ga0157378_104103342 157
339 3300013297 Ga0157378_11690658 Ga0157378_116906582 157
340 3300013306 Ga0163162_10021630 Ga0163162_100216304 157
341 3300013306 Ga0163162_10312700 Ga0163162_103127003 157
342 3300013306 Ga0163162_11187546 Ga0163162_111875462 157
343 3300013306 Ga0163162_11375590 Ga0163162_113755902 157
344 3300013307 Ga0157372_10531695 Ga0157372_105316952 157
345 3300013307 Ga0157372_10560256 Ga0157372_105602562 157
346 3300013307 Ga0157372_11277484 Ga0157372_112774841 157
347 3300013308 Ga0157375_10038398 Ga0157375_100383982 157
348 3300013308 Ga0157375_11321447 Ga0157375_113214471 157
349 3300013308 Ga0157375_11672563 Ga0157375_116725631 157
350 3300013308 Ga0157375_12575484 Ga0157375_125754841 157
351 3300014325 Ga0163163_10007264 Ga0163163_100072648 157
352 3300014325 Ga0163163_10978892 Ga0163163_109788922 157
353 3300014325 Ga0163163_11384629 Ga0163163_113846292 157
354 3300014326 Ga0157380_10044984 Ga0157380_100449843 157
355 3300014326 Ga0157380_11257357 Ga0157380_112573571 157
356 3300014326 Ga0157380_11322197 Ga0157380_113221972 157
357 3300014326 Ga0157380_11401586 Ga0157380_114015862 157
358 3300014745 Ga0157377_10328607 Ga0157377_103286072 157
359 3300014745 Ga0157377_10522962 Ga0157377_105229622 157
360 3300014745 Ga0157377_10559238 Ga0157377_105592381 157
361 3300014745 Ga0157377_10613305 Ga0157377_106133052 157
362 3300025735 Ga0207713_1072369 Ga0207713_10723692 157
363 3300025904 Ga0207647_10001169 Ga0207647_1000116922 157
364 3300025904 Ga0207647_10290916 Ga0207647_102909162 157
365 3300025910 Ga0207684_10221519 Ga0207684_102215191 157
366 3300025911 Ga0207654_10014078 Ga0207654_100140785 157
367 3300025911 Ga0207654_10558637 Ga0207654_105586371 157
368 3300025911 Ga0207654_10721718 Ga0207654_107217181 157
369 3300025912 Ga0207707_10699514 Ga0207707_106995142 157
370 3300025917 Ga0207660_10049600 Ga0207660_100496002 157
371 3300025921 Ga0207652_10110053 Ga0207652_101100532 157
372 3300025922 Ga0207646_10376628 Ga0207646_103766282 157
373 3300025923 Ga0207681_10022760 Ga0207681_100227603 157
374 3300025924 Ga0207694_10123528 Ga0207694_101235282 157
375 3300025924 Ga0207694_10216706 Ga0207694_102167062 157
376 3300025925 Ga0207650_10000022 Ga0207650_1000002287 157
377 3300025925 Ga0207650_10053748 Ga0207650_100537484 157
378 3300025926 Ga0207659_10862569 Ga0207659_108625691 157
379 3300025926 Ga0207659_11237770 Ga0207659_112377702 157
380 3300025932 Ga0207690_10114835 Ga0207690_101148353 157
381 3300025932 Ga0207690_10295691 Ga0207690_102956912 157
382 3300025933 Ga0207706_10638801 Ga0207706_106388012 157
383 3300025935 Ga0207709_10166802 Ga0207709_101668022 157
384 3300025936 Ga0207670_10000531 Ga0207670_1000053110 157
385 3300025940 Ga0207691_10492318 Ga0207691_104923182 157
386 3300025941 Ga0207711_10013780 Ga0207711_100137805 157
387 3300025941 Ga0207711_10161242 Ga0207711_101612421 157
388 3300025941 Ga0207711_10438861 Ga0207711_104388612 157
389 3300025941 Ga0207711_10778280 Ga0207711_107782801 157
390 3300025942 Ga0207689_10033823 Ga0207689_100338231 157
391 3300025942 Ga0207689_10396018 Ga0207689_103960182 157
392 3300025945 Ga0207679_11059922 Ga0207679_110599222 157
393 3300025949 Ga0207667_10950810 Ga0207667_109508102 157
394 3300025960 Ga0207651_10186778 Ga0207651_101867783 157
395 3300025960 Ga0207651_11221960 Ga0207651_112219601 157
396 3300025961 Ga0207712_10034761 Ga0207712_100347613 157
397 3300025961 Ga0207712_10251594 Ga0207712_102515942 157
398 3300025981 Ga0207640_10171300 Ga0207640_101713002 157
399 3300025981 Ga0207640_10959816 Ga0207640_109598162 157
400 3300026075 Ga0207708_10000087 Ga0207708_1000008744 157
401 3300026075 Ga0207708_10021945 Ga0207708_100219454 157
402 3300026075 Ga0207708_10037723 Ga0207708_100377234 157
403 3300026075 Ga0207708_10455313 Ga0207708_104553132 157
404 3300026075 Ga0207708_10491910 Ga0207708_104919102 157
405 3300026088 Ga0207641_10031890 Ga0207641_100318905 157
406 3300026088 Ga0207641_10537259 Ga0207641_105372592 157
407 3300026088 Ga0207641_10762333 Ga0207641_107623332 157
408 3300026088 Ga0207641_10892964 Ga0207641_108929642 157
409 3300026088 Ga0207641_11129978 Ga0207641_111299781 157
410 3300026089 Ga0207648_10047355 Ga0207648_100473554 157
411 3300026089 Ga0207648_10189579 Ga0207648_101895792 157
412 3300026089 Ga0207648_10289355 Ga0207648_102893552 157
413 3300026089 Ga0207648_10341127 Ga0207648_103411272 157
414 3300026089 Ga0207648_10347211 Ga0207648_103472112 157
415 3300026095 Ga0207676_10019565 Ga0207676_100195654 157
416 3300026095 Ga0207676_10472944 Ga0207676_104729442 157
417 3300026095 Ga0207676_10618205 Ga0207676_106182052 157
418 3300026095 Ga0207676_10622772 Ga0207676_106227721 157
419 3300026095 Ga0207676_11124742 Ga0207676_111247422 157
420 3300026116 Ga0207674_10104800 Ga0207674_101048002 157
421 3300026116 Ga0207674_10161931 Ga0207674_101619312 157
422 3300026116 Ga0207674_10742113 Ga0207674_107421132 157
423 3300026116 Ga0207674_10865399 Ga0207674_108653992 157
424 3300026116 Ga0207674_11278851 Ga0207674_112788512 157
425 3300026118 Ga0207675_100004382 Ga0207675_10000438210 157
426 3300026118 Ga0207675_100623667 Ga0207675_1006236671 157
427 3300026118 Ga0207675_100652698 Ga0207675_1006526982 157
428 3300027907 Ga0207428_10004743 Ga0207428_100047437 157
429 3300027907 Ga0207428_10136446 Ga0207428_101364462 157
430 3300028380 Ga0268265_10302128 Ga0268265_103021282 157
431 3300028381 Ga0268264_10029518 Ga0268264_100295185 157
432 3300028381 Ga0268264_10263273 Ga0268264_102632733 157
433 3300028381 Ga0268264_10282024 Ga0268264_102820242 157
434 3300028381 Ga0268264_10326445 Ga0268264_103264452 157
435 3300028381 Ga0268264_10422163 Ga0268264_104221632 157
436 3300030745 Ga0316182_1432847 Ga0316182_14328472 157
437 3300031548 Ga0307408_100244814 Ga0307408_1002448142 157
438 3300031548 Ga0307408_100497679 Ga0307408_1004976792 157
439 3300031548 Ga0307408_100898024 Ga0307408_1008980242 157
440 3300031731 Ga0307405_10357849 Ga0307405_103578492 157
441 3300032002 Ga0307416_100021200 Ga0307416_1000212004 157
442 3300032002 Ga0307416_101328461 Ga0307416_1013284611 157
443 3300032004 Ga0307414_10496321 Ga0307414_104963212 157
444 3300032005 Ga0307411_10265594 Ga0307411_102655942 157
445 3300032126 Ga0307415_101012572 Ga0307415_1010125722 157
446 3300035090 Ga0373949_0110781 Ga0373949_0110781_112_588 157
447 3300035091 Ga0373951_0000859 Ga0373951_0000859_5497_5970 157
448 3300035092 Ga0373952_0174201 Ga0373952_0174201_23_499 157
449 3300035112 Ga0373932_0039673 Ga0373932_0039673_303_776 157
450 3300035115 Ga0373941_0009537 Ga0373941_0009537_50_526 157
451 3300035241 Ga0373961_0042894 Ga0373961_0042894_546_1022 157
452 3300037466 Ga0395898_0341978 Ga0395898_0341978_227_700 157
453 3300041406 Ga0439439_0082301 Ga0439439_0082301_331_804 157
454 3300048905 Ga0496102_0836472 Ga0496102_0836472_16_489 157
455 3300048912 Ga0496109_0723977 Ga0496109_0723977_57_530 157
456 3300048913 Ga0496110_0640116 Ga0496110_0640116_429_902 157
457 3300048915 Ga0496112_0224532 Ga0496112_0224532_1271_1744 157
458 3300048915 Ga0496112_0350508 Ga0496112_0350508_36_509 157
459 3300048915 Ga0496112_1176635 Ga0496112_1176635_180_653 157
460 3300048916 Ga0496113_0368590 Ga0496113_0368590_543_1016 157
461 3300049515 Ga0501292_025737 Ga0501292_025737_411_884 157
462 3300049519 Ga0501296_006382 Ga0501296_006382_454_936 157
463 3300049522 Ga0501299_024595 Ga0501299_024595_298_771 157
464 3300049525 Ga0501302_012880 Ga0501302_012880_91_573 157
465 3300049592 Ga0501076_0895544 Ga0501076_0895544_87_560 157
466 3300049649 Ga0501198_038421 Ga0501198_038421_276_749 157
467 3300049652 Ga0501202_003498 Ga0501202_003498_1625_2107 157
468 3300049660 Ga0501216_054278 Ga0501216_054278_217_699 157
469 3300049661 Ga0501217_017062 Ga0501217_017062_794_1267 157
470 3300049661 Ga0501217_035638 Ga0501217_035638_552_1034 157
471 3300049664 Ga0501224_019472 Ga0501224_019472_282_764 157
472 3300049667 Ga0501230_005418 Ga0501230_005418_730_1203 157
473 3300049668 Ga0501233_106427 Ga0501233_106427_183_656 157
474 3300049668 Ga0501233_137498 Ga0501233_137498_175_648 157
475 3300049669 Ga0501235_018043 Ga0501235_018043_660_1142 157
476 3300049673 Ga0501240_010695 Ga0501240_010695_420_902 157
477 3300049679 Ga0501249_095305 Ga0501249_095305_15_488 157
478 3300049680 Ga0501250_038684 Ga0501250_038684_77_550 157
479 3300049683 Ga0501253_005132 Ga0501253_005132_1014_1496 157
480 3300049685 Ga0501256_010795 Ga0501256_010795_181_663 157
481 3300049690 Ga0501261_053920 Ga0501261_053920_88_570 157
482 3300049704 Ga0501221_033393 Ga0501221_033393_256_738 157
483 3300049705 Ga0501225_0207734 Ga0501225_0207734_138_611 157
484 3300049707 Ga0501234_038579 Ga0501234_038579_70_552 157
485 3300049708 Ga0501245_003911 Ga0501245_003911_1023_1496 157
486 3300049761 Ga0501264_009273 Ga0501264_009273_83_565 157
487 3300049765 Ga0501268_021954 Ga0501268_021954_450_932 157
488 3300049768 Ga0501271_044193 Ga0501271_044193_26_508 157
489 3300049769 Ga0501272_053437 Ga0501272_053437_25_498 157
490 3300049779 Ga0501283_001293 Ga0501283_001293_2023_2505 157
491 3300049822 Ga0501035_0969542 Ga0501035_0969542_124_597 157
492 3300049853 Ga0501226_015661 Ga0501226_015661_298_771 157
493 3300050509 nmdc:mga0qj67_243968_c1 nmdc:mga0qj67_243968_c1_124_597 157
494 3300050511 nmdc:mga08y16_1383_c1 nmdc:mga08y16_1383_c1_8748_9221 157
495 3300050511 nmdc:mga08y16_145834_c1 nmdc:mga08y16_145834_c1_568_1041 157
496 3300050511 nmdc:mga08y16_518191_c1 nmdc:mga08y16_518191_c1_711_1187 157
497 3300050512 nmdc:mga0n895_153091_c1 nmdc:mga0n895_153091_c1_1818_2291 157
498 3300050514 nmdc:mga08x19_15088_c2 nmdc:mga08x19_15088_c2_1228_1701 157
499 3300050515 nmdc:mga0a205_154302_c1 nmdc:mga0a205_154302_c1_354_827 157
500 3300054114 Ga0501084_0527992 Ga0501084_0527992_215_688 157
501 3300061734 Ga0530510_0111388 Ga0530510_0111388_698_1171 157
502 3300000532 CNAas_1000114 CNAas_10001143 158
503 3300005290 Ga0065712_10426402 Ga0065712_104264021 158
504 3300005331 Ga0070670_100052467 Ga0070670_1000524673 158
505 3300005331 Ga0070670_100209459 Ga0070670_1002094592 158
506 3300005364 Ga0070673_100076005 Ga0070673_1000760052 158
507 3300005365 Ga0070688_100006390 Ga0070688_1000063906 158
508 3300005366 Ga0070659_101667296 Ga0070659_1016672961 158
509 3300005444 Ga0070694_100018810 Ga0070694_1000188103 158
510 3300005444 Ga0070694_100054519 Ga0070694_1000545193 158
511 3300005546 Ga0070696_100006184 Ga0070696_1000061845 158
512 3300005547 Ga0070693_100218843 Ga0070693_1002188432 158
513 3300005547 Ga0070693_100622633 Ga0070693_1006226331 158
514 3300005564 Ga0070664_100485095 Ga0070664_1004850952 158
515 3300005577 Ga0068857_100075869 Ga0068857_1000758693 158
516 3300005577 Ga0068857_100489946 Ga0068857_1004899462 158
517 3300005618 Ga0068864_100041446 Ga0068864_1000414464 158
518 3300005844 Ga0068862_100696433 Ga0068862_1006964332 158
519 3300006852 Ga0075433_10544534 Ga0075433_105445342 158
520 3300006871 Ga0075434_100079771 Ga0075434_1000797713 158
521 3300006871 Ga0075434_100346220 Ga0075434_1003462202 158
522 3300007076 Ga0075435_100087691 Ga0075435_1000876912 158
523 3300007076 Ga0075435_100679946 Ga0075435_1006799462 158
524 3300009098 Ga0105245_10847457 Ga0105245_108474571 158
525 3300009147 Ga0114129_10313111 Ga0114129_103131112 158
526 3300009148 Ga0105243_10637151 Ga0105243_106371511 158
527 3300009174 Ga0105241_10137222 Ga0105241_101372222 158
528 3300009176 Ga0105242_10117665 Ga0105242_101176653 158
529 3300009553 Ga0105249_10043905 Ga0105249_100439052 158
530 3300013306 Ga0163162_10043322 Ga0163162_100433223 158
531 3300013308 Ga0157375_11324298 Ga0157375_113242982 158
532 3300014325 Ga0163163_10018206 Ga0163163_100182066 158
533 3300025918 Ga0207662_10035104 Ga0207662_100351042 158
534 3300025921 Ga0207652_11250371 Ga0207652_112503712 158
535 3300025925 Ga0207650_10055116 Ga0207650_100551162 158
536 3300025936 Ga0207670_10097514 Ga0207670_100975142 158
537 3300025981 Ga0207640_10014875 Ga0207640_100148752 158
538 3300026075 Ga0207708_10586557 Ga0207708_105865572 158
539 3300026088 Ga0207641_10241100 Ga0207641_102411001 158
540 3300026095 Ga0207676_10031460 Ga0207676_100314602 158
541 3300026095 Ga0207676_10172210 Ga0207676_101722103 158
542 3300026116 Ga0207674_10059481 Ga0207674_100594812 158
543 3300026116 Ga0207674_10150754 Ga0207674_101507542 158
544 3300032002 Ga0307416_100317532 Ga0307416_1003175322 158
545 3300042012 Ga0439455_0010795 Ga0439455_0010795_265_759 158
546 3300042157 Ga0439458_0010139 Ga0439458_0010139_425_919 158
547 3300045051 Ga0451576_0200984 Ga0451576_0200984_409_894 158
548 3300048911 Ga0496108_0299193 Ga0496108_0299193_679_1158 158
549 3300050512 nmdc:mga0n895_64074_c1 nmdc:mga0n895_64074_c1_2415_2900 158
550 3300050512 nmdc:mga0n895_711317_c1 nmdc:mga0n895_711317_c1_389_883 158
551 3300050513 nmdc:mga0rr50_7056_c1 nmdc:mga0rr50_7056_c1_2811_3305 158
552 3300050515 nmdc:mga0a205_333328_c1 nmdc:mga0a205_333328_c1_250_735 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

25

177

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfr-assembly1.cif.gz_A crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate 0.9345 3 158
5ecx-assembly1.cif.gz_B klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine 0.9249 2 156
7reg-assembly1.cif.gz_A dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.9216 2 156
7rgj-assembly1.cif.gz_A dfra1 complexed with nadph and 5-(3-(7-(4-(aminomethyl)phenyl)benzo[d][1,3]dioxol-5-yl)but-1-yn-1-yl)-6-ethylpyrimidine-2,4-diamine (ucp1223) 0.9195 2 156
3dfr-assembly1.cif.gz_A crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate 0.9176 3 158
ID Description Score Start End Superfamily
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9249 2 156 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9208 2 158 3.40.430.10
3ix9B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9096 2 158 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9025 2 156 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9021 1 155 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2V8QDB3-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9939 34 155 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WUG3-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9895 1 156 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A7W1LYM9-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9843 2 158 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A2V8RKV1-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9842 1 157 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A059WN40-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9837 2 158 GO:0004146
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Feature Viewer

pLDDT pTM Quality
92.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map