F462722
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 552 | 230 | 552 | 157 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10001571|Ga0105248_1000157111 |
| Length | 181 |
| Sequence | VCKKFCNKKTSDRHSRAQAVIMLRMIIGIAAVDRKGAIGKGGKLPWHYSADMKFFRETTTGHAVVMGRKTWLTIGKPLKNRLNIVLSRDPNIEPQESLLVLSDIESVLSLNQSLSTNLFVIGGAQIYEAFLPSIEQWIITEVPVTVKGADAFMPEGYLEGFNATDAKPIGDGLTVRFYERA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 145 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 156 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 158 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 162 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 163 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 164 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 165 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 166 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 167 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 177 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 178 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 179 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 180 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 181 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 183 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 184 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 185 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 186 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 187 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 188 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 189 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 190 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 191 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 192 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 193 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 194 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 195 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 196 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 197 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 198 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 199 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 200 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 201 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 202 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 203 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 204 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 205 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 207 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 208 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 209 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 210 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 211 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 212 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 213 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 214 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 215 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 216 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 218 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 219 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.17 |
| Rhizosphere | 97.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000114 | 3300000532 | Bacteria | 6628 |
| 2 | JGI24751J29686_10000050 | 3300002459 | Bacteria | 68540 |
| 3 | JGI25406J46586_10018162 | 3300003203 | Unclassified | 2894 |
| 4 | rootH2_10054533 | 3300003320 | Unclassified | 1953 |
| 5 | rootL2_10137033 | 3300003322 | Unclassified | 1470 |
| 6 | rootL2_10138097 | 3300003322 | Unclassified | 1923 |
| 7 | Ga0065714_10065325 | 3300005288 | Bacteria | 10908 |
| 8 | Ga0065704_10097557 | 3300005289 | Bacteria | 2367 |
| 9 | Ga0065712_10057129 | 3300005290 | Bacteria | 1095 |
| 10 | Ga0065712_10068401 | 3300005290 | Bacteria | 10913 |
| 11 | Ga0065712_10426402 | 3300005290 | Bacteria | 707 |
| 12 | Ga0065712_10468174 | 3300005290 | Bacteria | 672 |
| 13 | Ga0065715_10001359 | 3300005293 | Bacteria | 8994 |
| 14 | Ga0065715_10158954 | 3300005293 | Bacteria | 1648 |
| 15 | Ga0065715_10179393 | 3300005293 | Bacteria | 1487 |
| 16 | Ga0065715_10334890 | 3300005293 | Bacteria | 977 |
| 17 | Ga0065715_10453322 | 3300005293 | Bacteria | 824 |
| 18 | Ga0065715_10460842 | 3300005293 | Bacteria | 816 |
| 19 | Ga0065715_10553748 | 3300005293 | Bacteria | 739 |
| 20 | Ga0065707_10000960 | 3300005295 | Bacteria | 10503 |
| 21 | Ga0070676_10077707 | 3300005328 | Bacteria | 2007 |
| 22 | Ga0070683_102184474 | 3300005329 | Bacteria | 531 |
| 23 | Ga0070690_100042298 | 3300005330 | Bacteria | 2885 |
| 24 | Ga0070690_100386813 | 3300005330 | Bacteria | 1024 |
| 25 | Ga0070670_100000266 | 3300005331 | Bacteria | 46547 |
| 26 | Ga0070670_100052467 | 3300005331 | Bacteria | 3502 |
| 27 | Ga0070670_100209459 | 3300005331 | Bacteria | 1695 |
| 28 | Ga0070670_100792850 | 3300005331 | Bacteria | 855 |
| 29 | Ga0070677_10141856 | 3300005333 | Unclassified | 1109 |
| 30 | Ga0068869_100199513 | 3300005334 | Bacteria | 1577 |
| 31 | Ga0068869_100489625 | 3300005334 | Bacteria | 1025 |
| 32 | Ga0068869_101032494 | 3300005334 | Bacteria | 717 |
| 33 | Ga0070680_100036035 | 3300005336 | Bacteria | 3996 |
| 34 | Ga0070682_100002088 | 3300005337 | Bacteria | 11121 |
| 35 | Ga0070682_100434879 | 3300005337 | Bacteria | 1001 |
| 36 | Ga0070660_100615307 | 3300005339 | Bacteria | 909 |
| 37 | Ga0070687_100688708 | 3300005343 | Unclassified | 713 |
| 38 | Ga0070687_100933278 | 3300005343 | Unclassified | 624 |
| 39 | Ga0070692_10007217 | 3300005345 | Bacteria | 4883 |
| 40 | Ga0070692_10159233 | 3300005345 | Bacteria | 1292 |
| 41 | Ga0070692_10187016 | 3300005345 | Bacteria | 1204 |
| 42 | Ga0070669_100069297 | 3300005353 | Bacteria | 2605 |
| 43 | Ga0070669_101558258 | 3300005353 | Unclassified | 575 |
| 44 | Ga0070675_100287224 | 3300005354 | Bacteria | 1447 |
| 45 | Ga0070675_100645331 | 3300005354 | Bacteria | 962 |
| 46 | Ga0070673_100076005 | 3300005364 | Bacteria | 2711 |
| 47 | Ga0070673_100350173 | 3300005364 | Bacteria | 1311 |
| 48 | Ga0070673_100546363 | 3300005364 | Bacteria | 1052 |
| 49 | Ga0070673_100599331 | 3300005364 | Bacteria | 1005 |
| 50 | Ga0070688_100006390 | 3300005365 | Bacteria | 6300 |
| 51 | Ga0070688_100376623 | 3300005365 | Bacteria | 1045 |
| 52 | Ga0070688_101005584 | 3300005365 | Bacteria | 662 |
| 53 | Ga0070659_100565902 | 3300005366 | Unclassified | 974 |
| 54 | Ga0070659_101667296 | 3300005366 | Bacteria | 570 |
| 55 | Ga0070703_10002431 | 3300005406 | Bacteria | 5365 |
| 56 | Ga0070709_10137638 | 3300005434 | Bacteria | 1674 |
| 57 | Ga0070705_100008941 | 3300005440 | Bacteria | 4966 |
| 58 | Ga0070705_100018334 | 3300005440 | Bacteria | 3668 |
| 59 | Ga0070705_100228041 | 3300005440 | Bacteria | 1294 |
| 60 | Ga0070705_101026385 | 3300005440 | Unclassified | 671 |
| 61 | Ga0070705_101556456 | 3300005440 | Unclassified | 555 |
| 62 | Ga0070700_100000131 | 3300005441 | Bacteria | 45427 |
| 63 | Ga0070700_100024587 | 3300005441 | Bacteria | 3539 |
| 64 | Ga0070700_100040071 | 3300005441 | Bacteria | 2865 |
| 65 | Ga0070700_100146928 | 3300005441 | Bacteria | 1608 |
| 66 | Ga0070700_100262075 | 3300005441 | Bacteria | 1245 |
| 67 | Ga0070700_100375124 | 3300005441 | Bacteria | 1062 |
| 68 | Ga0070694_100002992 | 3300005444 | Bacteria | 10045 |
| 69 | Ga0070694_100018810 | 3300005444 | Bacteria | 4389 |
| 70 | Ga0070694_100054519 | 3300005444 | Bacteria | 2709 |
| 71 | Ga0070694_100206393 | 3300005444 | Unclassified | 1467 |
| 72 | Ga0070694_100213296 | 3300005444 | Bacteria | 1445 |
| 73 | Ga0070694_100245983 | 3300005444 | Bacteria | 1351 |
| 74 | Ga0070694_100627768 | 3300005444 | Bacteria | 868 |
| 75 | Ga0070694_101498937 | 3300005444 | Bacteria | 571 |
| 76 | Ga0070708_100433420 | 3300005445 | Bacteria | 1240 |
| 77 | Ga0070662_100795248 | 3300005457 | Bacteria | 804 |
| 78 | Ga0070681_10180599 | 3300005458 | Bacteria | 2032 |
| 79 | Ga0070681_10372427 | 3300005458 | Bacteria | 1339 |
| 80 | Ga0070681_10840704 | 3300005458 | Bacteria | 836 |
| 81 | Ga0068867_100072859 | 3300005459 | Bacteria | 2572 |
| 82 | Ga0070685_10647594 | 3300005466 | Unclassified | 765 |
| 83 | Ga0070706_100000616 | 3300005467 | Bacteria | 41104 |
| 84 | Ga0070706_100521910 | 3300005467 | Bacteria | 1105 |
| 85 | Ga0070707_100026882 | 3300005468 | Bacteria | 5469 |
| 86 | Ga0070698_100004211 | 3300005471 | Bacteria | 15808 |
| 87 | Ga0070699_100003366 | 3300005518 | Bacteria | 14142 |
| 88 | Ga0070699_100125455 | 3300005518 | Bacteria | 2260 |
| 89 | Ga0070699_101194722 | 3300005518 | Bacteria | 698 |
| 90 | Ga0070679_100147963 | 3300005530 | Bacteria | 2326 |
| 91 | Ga0070679_100467210 | 3300005530 | Bacteria | 1206 |
| 92 | Ga0070697_100030061 | 3300005536 | Bacteria | 4361 |
| 93 | Ga0068853_100632526 | 3300005539 | Bacteria | 1018 |
| 94 | Ga0068853_101074310 | 3300005539 | Bacteria | 776 |
| 95 | Ga0068853_101169992 | 3300005539 | Bacteria | 742 |
| 96 | Ga0070672_101119969 | 3300005543 | Bacteria | 700 |
| 97 | Ga0070686_100545413 | 3300005544 | Bacteria | 906 |
| 98 | Ga0070695_100141532 | 3300005545 | Bacteria | 1669 |
| 99 | Ga0070695_100152925 | 3300005545 | Unclassified | 1612 |
| 100 | Ga0070695_100519204 | 3300005545 | Bacteria | 924 |
| 101 | Ga0070695_100539625 | 3300005545 | Bacteria | 908 |
| 102 | Ga0070696_100006184 | 3300005546 | Bacteria | 8003 |
| 103 | Ga0070696_100044574 | 3300005546 | Bacteria | 3071 |
| 104 | Ga0070696_100058366 | 3300005546 | Bacteria | 2694 |
| 105 | Ga0070696_100194217 | 3300005546 | Bacteria | 1512 |
| 106 | Ga0070696_100625555 | 3300005546 | Unclassified | 870 |
| 107 | Ga0070693_100087052 | 3300005547 | Bacteria | 1875 |
| 108 | Ga0070693_100218843 | 3300005547 | Bacteria | 1246 |
| 109 | Ga0070693_100282842 | 3300005547 | Bacteria | 1111 |
| 110 | Ga0070693_100622633 | 3300005547 | Bacteria | 782 |
| 111 | Ga0070704_100037403 | 3300005549 | Bacteria | 3316 |
| 112 | Ga0070704_100086001 | 3300005549 | Bacteria | 2329 |
| 113 | Ga0070704_101141525 | 3300005549 | Unclassified | 709 |
| 114 | Ga0068855_101046256 | 3300005563 | Bacteria | 856 |
| 115 | Ga0070664_100485095 | 3300005564 | Bacteria | 1138 |
| 116 | Ga0068857_100075869 | 3300005577 | Bacteria | 2997 |
| 117 | Ga0068857_100188211 | 3300005577 | Bacteria | 1880 |
| 118 | Ga0068857_100489946 | 3300005577 | Bacteria | 1153 |
| 119 | Ga0068857_101134524 | 3300005577 | Bacteria | 756 |
| 120 | Ga0068857_102061809 | 3300005577 | Bacteria | 560 |
| 121 | Ga0068854_100436356 | 3300005578 | Bacteria | 1091 |
| 122 | Ga0068856_102152281 | 3300005614 | Bacteria | 567 |
| 123 | Ga0070702_100070382 | 3300005615 | Bacteria | 2065 |
| 124 | Ga0070702_100283122 | 3300005615 | Unclassified | 1139 |
| 125 | Ga0070702_100307977 | 3300005615 | Bacteria | 1098 |
| 126 | Ga0070702_100679934 | 3300005615 | Bacteria | 782 |
| 127 | Ga0068852_100734395 | 3300005616 | Bacteria | 999 |
| 128 | Ga0068859_100002808 | 3300005617 | Bacteria | 17648 |
| 129 | Ga0068859_100003853 | 3300005617 | Bacteria | 15325 |
| 130 | Ga0068859_100033966 | 3300005617 | Bacteria | 5121 |
| 131 | Ga0068859_100088357 | 3300005617 | Bacteria | 3149 |
| 132 | Ga0068859_100100075 | 3300005617 | Bacteria | 2954 |
| 133 | Ga0068859_100143877 | 3300005617 | Bacteria | 2458 |
| 134 | Ga0068859_100174930 | 3300005617 | Bacteria | 2228 |
| 135 | Ga0068859_100186915 | 3300005617 | Bacteria | 2156 |
| 136 | Ga0068859_100227879 | 3300005617 | Bacteria | 1951 |
| 137 | Ga0068859_100232810 | 3300005617 | Bacteria | 1930 |
| 138 | Ga0068859_100283093 | 3300005617 | Bacteria | 1751 |
| 139 | Ga0068859_100351228 | 3300005617 | Bacteria | 1569 |
| 140 | Ga0068859_101664290 | 3300005617 | Bacteria | 705 |
| 141 | Ga0068859_101971555 | 3300005617 | Unclassified | 645 |
| 142 | Ga0068864_100000619 | 3300005618 | Bacteria | 29969 |
| 143 | Ga0068864_100041446 | 3300005618 | Bacteria | 3938 |
| 144 | Ga0068864_100191475 | 3300005618 | Bacteria | 1875 |
| 145 | Ga0068864_100370217 | 3300005618 | Bacteria | 1356 |
| 146 | Ga0068864_100925109 | 3300005618 | Bacteria | 862 |
| 147 | Ga0068864_101021776 | 3300005618 | Bacteria | 821 |
| 148 | Ga0068861_100000821 | 3300005719 | Bacteria | 18796 |
| 149 | Ga0068851_10001845 | 3300005834 | Bacteria | 9287 |
| 150 | Ga0068870_10035986 | 3300005840 | Bacteria | 2544 |
| 151 | Ga0068870_10354568 | 3300005840 | Bacteria | 942 |
| 152 | Ga0068863_100058964 | 3300005841 | Bacteria | 3632 |
| 153 | Ga0068863_100107284 | 3300005841 | Bacteria | 2657 |
| 154 | Ga0068863_100670222 | 3300005841 | Bacteria | 1029 |
| 155 | Ga0068858_100056291 | 3300005842 | Bacteria | 3635 |
| 156 | Ga0068858_100079286 | 3300005842 | Bacteria | 3051 |
| 157 | Ga0068858_100152417 | 3300005842 | Bacteria | 2174 |
| 158 | Ga0068858_100214779 | 3300005842 | Bacteria | 1821 |
| 159 | Ga0068858_100387289 | 3300005842 | Unclassified | 1342 |
| 160 | Ga0068858_100812126 | 3300005842 | Bacteria | 913 |
| 161 | Ga0068858_101293496 | 3300005842 | Bacteria | 718 |
| 162 | Ga0068860_100007764 | 3300005843 | Bacteria | 10716 |
| 163 | Ga0068860_100017714 | 3300005843 | Bacteria | 6938 |
| 164 | Ga0068860_100189365 | 3300005843 | Bacteria | 1991 |
| 165 | Ga0068860_100400126 | 3300005843 | Bacteria | 1358 |
| 166 | Ga0068860_101830061 | 3300005843 | Unclassified | 629 |
| 167 | Ga0068862_100036060 | 3300005844 | Bacteria | 4189 |
| 168 | Ga0068862_100245127 | 3300005844 | Bacteria | 1631 |
| 169 | Ga0068862_100696433 | 3300005844 | Unclassified | 984 |
| 170 | Ga0068862_101304442 | 3300005844 | Bacteria | 727 |
| 171 | Ga0081539_10000407 | 3300005985 | Bacteria | 91696 |
| 172 | Ga0070716_100020148 | 3300006173 | Bacteria | 3498 |
| 173 | Ga0097621_100028667 | 3300006237 | Bacteria | 4389 |
| 174 | Ga0097621_100249091 | 3300006237 | Bacteria | 1555 |
| 175 | Ga0097621_100666066 | 3300006237 | Bacteria | 956 |
| 176 | Ga0068871_100005373 | 3300006358 | Bacteria | 8977 |
| 177 | Ga0068871_100139530 | 3300006358 | Bacteria | 2061 |
| 178 | Ga0075428_100296721 | 3300006844 | Bacteria | 1738 |
| 179 | Ga0075428_101244868 | 3300006844 | Bacteria | 784 |
| 180 | Ga0075430_100703786 | 3300006846 | Unclassified | 833 |
| 181 | Ga0075431_100191521 | 3300006847 | Bacteria | 2095 |
| 182 | Ga0075431_100584819 | 3300006847 | Bacteria | 1101 |
| 183 | Ga0075433_10042453 | 3300006852 | Bacteria | 3945 |
| 184 | Ga0075433_10544534 | 3300006852 | Bacteria | 1021 |
| 185 | Ga0075433_11075250 | 3300006852 | Bacteria | 700 |
| 186 | Ga0075434_100079771 | 3300006871 | Bacteria | 3269 |
| 187 | Ga0075434_100346220 | 3300006871 | Bacteria | 1507 |
| 188 | Ga0075434_101249867 | 3300006871 | Unclassified | 754 |
| 189 | Ga0075429_100448286 | 3300006880 | Bacteria | 1131 |
| 190 | Ga0075436_100089397 | 3300006914 | Bacteria | 2140 |
| 191 | Ga0097620_100002808 | 3300006931 | Bacteria | 17648 |
| 192 | Ga0097620_100003853 | 3300006931 | Bacteria | 15325 |
| 193 | Ga0097620_100033964 | 3300006931 | Bacteria | 5121 |
| 194 | Ga0097620_100088350 | 3300006931 | Bacteria | 3149 |
| 195 | Ga0097620_100100077 | 3300006931 | Bacteria | 2954 |
| 196 | Ga0097620_100143881 | 3300006931 | Bacteria | 2458 |
| 197 | Ga0097620_100174924 | 3300006931 | Bacteria | 2228 |
| 198 | Ga0097620_100186920 | 3300006931 | Bacteria | 2156 |
| 199 | Ga0097620_100227887 | 3300006931 | Bacteria | 1951 |
| 200 | Ga0097620_100232811 | 3300006931 | Bacteria | 1930 |
| 201 | Ga0097620_100283083 | 3300006931 | Bacteria | 1751 |
| 202 | Ga0097620_100351224 | 3300006931 | Bacteria | 1569 |
| 203 | Ga0097620_101664620 | 3300006931 | Bacteria | 705 |
| 204 | Ga0097620_101971690 | 3300006931 | Unclassified | 645 |
| 205 | Ga0075435_100087691 | 3300007076 | Bacteria | 2564 |
| 206 | Ga0075435_100679946 | 3300007076 | Bacteria | 894 |
| 207 | Ga0105251_10115457 | 3300009011 | Bacteria | 1221 |
| 208 | Ga0105240_10038496 | 3300009093 | Bacteria | 6134 |
| 209 | Ga0111539_10001336 | 3300009094 | Bacteria | 32835 |
| 210 | Ga0111539_10102446 | 3300009094 | Bacteria | 3360 |
| 211 | Ga0111539_10201166 | 3300009094 | Bacteria | 2323 |
| 212 | Ga0111539_11299167 | 3300009094 | Unclassified | 844 |
| 213 | Ga0105245_10847457 | 3300009098 | Bacteria | 954 |
| 214 | Ga0105247_10000819 | 3300009101 | Bacteria | 23704 |
| 215 | Ga0105247_10209372 | 3300009101 | Bacteria | 1314 |
| 216 | Ga0105247_10215755 | 3300009101 | Bacteria | 1296 |
| 217 | Ga0105247_10298496 | 3300009101 | Bacteria | 1117 |
| 218 | Ga0105247_10378885 | 3300009101 | Bacteria | 1002 |
| 219 | Ga0105247_11075062 | 3300009101 | Bacteria | 633 |
| 220 | Ga0114129_10011837 | 3300009147 | Bacteria | 12409 |
| 221 | Ga0114129_10048031 | 3300009147 | Bacteria | 5997 |
| 222 | Ga0114129_10313111 | 3300009147 | Bacteria | 2089 |
| 223 | Ga0114129_10483027 | 3300009147 | Bacteria | 1621 |
| 224 | Ga0114129_10892505 | 3300009147 | Bacteria | 1127 |
| 225 | Ga0105243_10237538 | 3300009148 | Bacteria | 1620 |
| 226 | Ga0105243_10448727 | 3300009148 | Bacteria | 1210 |
| 227 | Ga0105243_10528718 | 3300009148 | Bacteria | 1123 |
| 228 | Ga0105243_10637151 | 3300009148 | Bacteria | 1031 |
| 229 | Ga0105243_10663552 | 3300009148 | Bacteria | 1012 |
| 230 | Ga0105243_11010076 | 3300009148 | Bacteria | 835 |
| 231 | Ga0105241_10002866 | 3300009174 | Bacteria | 12886 |
| 232 | Ga0105241_10065202 | 3300009174 | Bacteria | 2814 |
| 233 | Ga0105241_10118901 | 3300009174 | Bacteria | 2125 |
| 234 | Ga0105241_10137222 | 3300009174 | Bacteria | 1987 |
| 235 | Ga0105241_10210636 | 3300009174 | Bacteria | 1628 |
| 236 | Ga0105241_10317456 | 3300009174 | Bacteria | 1342 |
| 237 | Ga0105241_10457251 | 3300009174 | Bacteria | 1130 |
| 238 | Ga0105241_10527551 | 3300009174 | Bacteria | 1057 |
| 239 | Ga0105241_10934698 | 3300009174 | Bacteria | 807 |
| 240 | Ga0105241_10963180 | 3300009174 | Bacteria | 796 |
| 241 | Ga0105241_11159709 | 3300009174 | Bacteria | 730 |
| 242 | Ga0105241_11643277 | 3300009174 | Bacteria | 623 |
| 243 | Ga0105241_12389900 | 3300009174 | Bacteria | 527 |
| 244 | Ga0105242_10034046 | 3300009176 | Bacteria | 4083 |
| 245 | Ga0105242_10117665 | 3300009176 | Bacteria | 2275 |
| 246 | Ga0105242_11800731 | 3300009176 | Bacteria | 651 |
| 247 | Ga0105248_10001571 | 3300009177 | Bacteria | 25421 |
| 248 | Ga0105248_10002339 | 3300009177 | Bacteria | 21032 |
| 249 | Ga0105248_10004801 | 3300009177 | Bacteria | 14961 |
| 250 | Ga0105248_10222972 | 3300009177 | Bacteria | 2122 |
| 251 | Ga0105248_10235525 | 3300009177 | Bacteria | 2061 |
| 252 | Ga0105248_10691965 | 3300009177 | Bacteria | 1150 |
| 253 | Ga0105248_11165688 | 3300009177 | Bacteria | 871 |
| 254 | Ga0105248_11717621 | 3300009177 | Bacteria | 712 |
| 255 | Ga0105237_10002641 | 3300009545 | Bacteria | 22063 |
| 256 | Ga0105237_10021451 | 3300009545 | Bacteria | 6640 |
| 257 | Ga0105237_10410788 | 3300009545 | Bacteria | 1359 |
| 258 | Ga0105237_10412714 | 3300009545 | Bacteria | 1355 |
| 259 | Ga0105237_10817713 | 3300009545 | Bacteria | 939 |
| 260 | Ga0105237_11186061 | 3300009545 | Bacteria | 770 |
| 261 | Ga0105238_10008559 | 3300009551 | Bacteria | 10236 |
| 262 | Ga0105238_10028603 | 3300009551 | Bacteria | 5678 |
| 263 | Ga0105238_11100177 | 3300009551 | Bacteria | 817 |
| 264 | Ga0105249_10043905 | 3300009553 | Bacteria | 4065 |
| 265 | Ga0105249_10045444 | 3300009553 | Bacteria | 3994 |
| 266 | Ga0105249_10375546 | 3300009553 | Bacteria | 1446 |
| 267 | Ga0105239_10046466 | 3300010375 | Bacteria | 4758 |
| 268 | Ga0105239_10505674 | 3300010375 | Bacteria | 1374 |
| 269 | Ga0105239_11352954 | 3300010375 | Bacteria | 822 |
| 270 | Ga0105246_10557118 | 3300011119 | Bacteria | 983 |
| 271 | Ga0105246_11016761 | 3300011119 | Bacteria | 751 |
| 272 | Ga0105246_11231776 | 3300011119 | Bacteria | 690 |
| 273 | Ga0157373_10015466 | 3300013100 | Bacteria | 5578 |
| 274 | Ga0157373_10028246 | 3300013100 | Bacteria | 4047 |
| 275 | Ga0157373_10537929 | 3300013100 | Bacteria | 846 |
| 276 | Ga0157373_10897362 | 3300013100 | Bacteria | 657 |
| 277 | Ga0157378_10410334 | 3300013297 | Unclassified | 1337 |
| 278 | Ga0157378_11690658 | 3300013297 | Bacteria | 680 |
| 279 | Ga0163162_10021630 | 3300013306 | Bacteria | 6336 |
| 280 | Ga0163162_10043322 | 3300013306 | Bacteria | 4507 |
| 281 | Ga0163162_10312700 | 3300013306 | Bacteria | 1703 |
| 282 | Ga0163162_11149772 | 3300013306 | Bacteria | 880 |
| 283 | Ga0163162_11187546 | 3300013306 | Bacteria | 866 |
| 284 | Ga0163162_11375590 | 3300013306 | Bacteria | 803 |
| 285 | Ga0157372_10531695 | 3300013307 | Unclassified | 1370 |
| 286 | Ga0157372_10560256 | 3300013307 | Bacteria | 1332 |
| 287 | Ga0157372_10998345 | 3300013307 | Bacteria | 969 |
| 288 | Ga0157372_11277484 | 3300013307 | Unclassified | 847 |
| 289 | Ga0157375_10038398 | 3300013308 | Bacteria | 4598 |
| 290 | Ga0157375_11321447 | 3300013308 | Bacteria | 848 |
| 291 | Ga0157375_11324298 | 3300013308 | Bacteria | 847 |
| 292 | Ga0157375_11672563 | 3300013308 | Bacteria | 753 |
| 293 | Ga0157375_12575484 | 3300013308 | Bacteria | 608 |
| 294 | Ga0163163_10007264 | 3300014325 | Bacteria | 9767 |
| 295 | Ga0163163_10018206 | 3300014325 | Bacteria | 6569 |
| 296 | Ga0163163_10978892 | 3300014325 | Bacteria | 909 |
| 297 | Ga0163163_11384629 | 3300014325 | Bacteria | 765 |
| 298 | Ga0157380_10044984 | 3300014326 | Bacteria | 3462 |
| 299 | Ga0157380_11257357 | 3300014326 | Bacteria | 786 |
| 300 | Ga0157380_11322197 | 3300014326 | Bacteria | 769 |
| 301 | Ga0157380_11401586 | 3300014326 | Bacteria | 749 |
| 302 | Ga0157377_10328607 | 3300014745 | Bacteria | 1018 |
| 303 | Ga0157377_10522962 | 3300014745 | Bacteria | 833 |
| 304 | Ga0157377_10559238 | 3300014745 | Bacteria | 809 |
| 305 | Ga0157377_10613305 | 3300014745 | Bacteria | 778 |
| 306 | Ga0207656_10003437 | 3300025321 | Bacteria | 5443 |
| 307 | Ga0207713_1072369 | 3300025735 | Bacteria | 1269 |
| 308 | Ga0207653_10001589 | 3300025885 | Bacteria | 7336 |
| 309 | Ga0207710_10000745 | 3300025900 | Bacteria | 17972 |
| 310 | Ga0207710_10249626 | 3300025900 | Bacteria | 887 |
| 311 | Ga0207647_10001169 | 3300025904 | Bacteria | 20225 |
| 312 | Ga0207647_10023247 | 3300025904 | Bacteria | 4103 |
| 313 | Ga0207647_10139564 | 3300025904 | Bacteria | 1421 |
| 314 | Ga0207647_10290916 | 3300025904 | Bacteria | 931 |
| 315 | Ga0207684_10000172 | 3300025910 | Bacteria | 106888 |
| 316 | Ga0207684_10221519 | 3300025910 | Bacteria | 1633 |
| 317 | Ga0207654_10014078 | 3300025911 | Bacteria | 4127 |
| 318 | Ga0207654_10558637 | 3300025911 | Bacteria | 814 |
| 319 | Ga0207654_10721718 | 3300025911 | Bacteria | 717 |
| 320 | Ga0207707_10699514 | 3300025912 | Bacteria | 851 |
| 321 | Ga0207695_10554503 | 3300025913 | Bacteria | 1031 |
| 322 | Ga0207671_10008097 | 3300025914 | Bacteria | 8975 |
| 323 | Ga0207671_10210142 | 3300025914 | Bacteria | 1522 |
| 324 | Ga0207671_10236892 | 3300025914 | Bacteria | 1433 |
| 325 | Ga0207671_10691752 | 3300025914 | Bacteria | 811 |
| 326 | Ga0207660_10049600 | 3300025917 | Bacteria | 2977 |
| 327 | Ga0207662_10035104 | 3300025918 | Bacteria | 2928 |
| 328 | Ga0207652_10110053 | 3300025921 | Bacteria | 2443 |
| 329 | Ga0207652_10421379 | 3300025921 | Bacteria | 1204 |
| 330 | Ga0207652_11250371 | 3300025921 | Bacteria | 645 |
| 331 | Ga0207646_10376628 | 3300025922 | Bacteria | 1282 |
| 332 | Ga0207681_10022760 | 3300025923 | Bacteria | 4000 |
| 333 | Ga0207694_10123528 | 3300025924 | Bacteria | 2069 |
| 334 | Ga0207694_10216706 | 3300025924 | Bacteria | 1560 |
| 335 | Ga0207650_10000022 | 3300025925 | Bacteria | 318878 |
| 336 | Ga0207650_10053748 | 3300025925 | Bacteria | 2986 |
| 337 | Ga0207650_10055116 | 3300025925 | Bacteria | 2950 |
| 338 | Ga0207659_10862569 | 3300025926 | Bacteria | 778 |
| 339 | Ga0207659_11237770 | 3300025926 | Unclassified | 641 |
| 340 | Ga0207690_10114835 | 3300025932 | Bacteria | 1945 |
| 341 | Ga0207690_10295691 | 3300025932 | Bacteria | 1265 |
| 342 | Ga0207706_10638801 | 3300025933 | Bacteria | 912 |
| 343 | Ga0207709_10166802 | 3300025935 | Bacteria | 1542 |
| 344 | Ga0207709_11330219 | 3300025935 | Bacteria | 594 |
| 345 | Ga0207670_10000531 | 3300025936 | Bacteria | 20964 |
| 346 | Ga0207670_10097514 | 3300025936 | Bacteria | 2093 |
| 347 | Ga0207670_10570512 | 3300025936 | Unclassified | 926 |
| 348 | Ga0207691_10492318 | 3300025940 | Bacteria | 1041 |
| 349 | Ga0207711_10013780 | 3300025941 | Bacteria | 6712 |
| 350 | Ga0207711_10038231 | 3300025941 | Bacteria | 4080 |
| 351 | Ga0207711_10161242 | 3300025941 | Bacteria | 2030 |
| 352 | Ga0207711_10197275 | 3300025941 | Bacteria | 1836 |
| 353 | Ga0207711_10438861 | 3300025941 | Bacteria | 1215 |
| 354 | Ga0207711_10778280 | 3300025941 | Bacteria | 891 |
| 355 | Ga0207689_10033823 | 3300025942 | Bacteria | 4246 |
| 356 | Ga0207689_10396018 | 3300025942 | Bacteria | 1151 |
| 357 | Ga0207679_11059922 | 3300025945 | Bacteria | 743 |
| 358 | Ga0207667_10950810 | 3300025949 | Bacteria | 849 |
| 359 | Ga0207651_10186778 | 3300025960 | Bacteria | 1650 |
| 360 | Ga0207651_11221960 | 3300025960 | Bacteria | 675 |
| 361 | Ga0207712_10034761 | 3300025961 | Bacteria | 3418 |
| 362 | Ga0207712_10251594 | 3300025961 | Bacteria | 1428 |
| 363 | Ga0207640_10014875 | 3300025981 | Bacteria | 4489 |
| 364 | Ga0207640_10171300 | 3300025981 | Bacteria | 1618 |
| 365 | Ga0207640_10959816 | 3300025981 | Bacteria | 750 |
| 366 | Ga0207640_11618024 | 3300025981 | Bacteria | 584 |
| 367 | Ga0207703_10038583 | 3300026035 | Bacteria | 3813 |
| 368 | Ga0207703_10094513 | 3300026035 | Bacteria | 2520 |
| 369 | Ga0207703_10933902 | 3300026035 | Bacteria | 831 |
| 370 | Ga0207639_10329795 | 3300026041 | Bacteria | 1357 |
| 371 | Ga0207708_10000087 | 3300026075 | Bacteria | 73043 |
| 372 | Ga0207708_10021945 | 3300026075 | Bacteria | 4818 |
| 373 | Ga0207708_10037723 | 3300026075 | Bacteria | 3681 |
| 374 | Ga0207708_10055963 | 3300026075 | Bacteria | 3008 |
| 375 | Ga0207708_10101639 | 3300026075 | Bacteria | 2225 |
| 376 | Ga0207708_10455313 | 3300026075 | Bacteria | 1066 |
| 377 | Ga0207708_10491910 | 3300026075 | Bacteria | 1027 |
| 378 | Ga0207708_10586557 | 3300026075 | Bacteria | 943 |
| 379 | Ga0207641_10031890 | 3300026088 | Bacteria | 4372 |
| 380 | Ga0207641_10241100 | 3300026088 | Bacteria | 1685 |
| 381 | Ga0207641_10537259 | 3300026088 | Bacteria | 1139 |
| 382 | Ga0207641_10762333 | 3300026088 | Bacteria | 956 |
| 383 | Ga0207641_10892964 | 3300026088 | Bacteria | 882 |
| 384 | Ga0207641_11129978 | 3300026088 | Bacteria | 782 |
| 385 | Ga0207648_10047355 | 3300026089 | Bacteria | 3769 |
| 386 | Ga0207648_10189579 | 3300026089 | Bacteria | 1822 |
| 387 | Ga0207648_10289355 | 3300026089 | Bacteria | 1467 |
| 388 | Ga0207648_10341127 | 3300026089 | Bacteria | 1349 |
| 389 | Ga0207648_10347211 | 3300026089 | Bacteria | 1337 |
| 390 | Ga0207676_10019565 | 3300026095 | Bacteria | 4941 |
| 391 | Ga0207676_10031460 | 3300026095 | Bacteria | 3991 |
| 392 | Ga0207676_10172210 | 3300026095 | Bacteria | 1887 |
| 393 | Ga0207676_10472944 | 3300026095 | Bacteria | 1185 |
| 394 | Ga0207676_10618205 | 3300026095 | Bacteria | 1042 |
| 395 | Ga0207676_10622772 | 3300026095 | Bacteria | 1039 |
| 396 | Ga0207676_11124742 | 3300026095 | Bacteria | 777 |
| 397 | Ga0207674_10059481 | 3300026116 | Bacteria | 3866 |
| 398 | Ga0207674_10104800 | 3300026116 | Bacteria | 2806 |
| 399 | Ga0207674_10150754 | 3300026116 | Bacteria | 2282 |
| 400 | Ga0207674_10161931 | 3300026116 | Bacteria | 2192 |
| 401 | Ga0207674_10742113 | 3300026116 | Bacteria | 948 |
| 402 | Ga0207674_10865399 | 3300026116 | Bacteria | 871 |
| 403 | Ga0207674_10995797 | 3300026116 | Unclassified | 807 |
| 404 | Ga0207674_11203984 | 3300026116 | Bacteria | 727 |
| 405 | Ga0207674_11278851 | 3300026116 | Bacteria | 703 |
| 406 | Ga0207675_100004382 | 3300026118 | Bacteria | 13642 |
| 407 | Ga0207675_100623667 | 3300026118 | Bacteria | 1083 |
| 408 | Ga0207675_100652698 | 3300026118 | Bacteria | 1058 |
| 409 | Ga0207698_10667191 | 3300026142 | Bacteria | 1032 |
| 410 | Ga0207428_10004743 | 3300027907 | Bacteria | 12855 |
| 411 | Ga0207428_10136446 | 3300027907 | Bacteria | 1875 |
| 412 | Ga0268265_10302128 | 3300028380 | Bacteria | 1442 |
| 413 | Ga0268264_10029518 | 3300028381 | Bacteria | 4492 |
| 414 | Ga0268264_10263273 | 3300028381 | Bacteria | 1607 |
| 415 | Ga0268264_10282024 | 3300028381 | Bacteria | 1557 |
| 416 | Ga0268264_10297990 | 3300028381 | Bacteria | 1517 |
| 417 | Ga0268264_10326445 | 3300028381 | Bacteria | 1453 |
| 418 | Ga0268264_10422163 | 3300028381 | Bacteria | 1286 |
| 419 | Ga0316182_1432847 | 3300030745 | Bacteria | 1719 |
| 420 | Ga0307408_100020033 | 3300031548 | Bacteria | 4509 |
| 421 | Ga0307408_100244814 | 3300031548 | Bacteria | 1476 |
| 422 | Ga0307408_100497679 | 3300031548 | Bacteria | 1066 |
| 423 | Ga0307408_100898024 | 3300031548 | Bacteria | 811 |
| 424 | Ga0307405_10057201 | 3300031731 | Bacteria | 2449 |
| 425 | Ga0307405_10357849 | 3300031731 | Bacteria | 1128 |
| 426 | Ga0307413_10085050 | 3300031824 | Bacteria | 2041 |
| 427 | Ga0307410_10061410 | 3300031852 | Bacteria | 2572 |
| 428 | Ga0307406_10012520 | 3300031901 | Bacteria | 4835 |
| 429 | Ga0307412_10008521 | 3300031911 | Bacteria | 5859 |
| 430 | Ga0307416_100021200 | 3300032002 | Bacteria | 4659 |
| 431 | Ga0307416_100122631 | 3300032002 | Bacteria | 2320 |
| 432 | Ga0307416_100317532 | 3300032002 | Bacteria | 1558 |
| 433 | Ga0307416_101328461 | 3300032002 | Bacteria | 825 |
| 434 | Ga0307414_10190039 | 3300032004 | Bacteria | 1660 |
| 435 | Ga0307414_10496321 | 3300032004 | Bacteria | 1079 |
| 436 | Ga0307411_10265594 | 3300032005 | Bacteria | 1358 |
| 437 | Ga0307411_11447660 | 3300032005 | Bacteria | 630 |
| 438 | Ga0307415_100000991 | 3300032126 | Bacteria | 13108 |
| 439 | Ga0307415_101012572 | 3300032126 | Bacteria | 773 |
| 440 | Ga0373949_0110781 | 3300035090 | Unclassified | 762 |
| 441 | Ga0373951_0000859 | 3300035091 | Bacteria | 8215 |
| 442 | Ga0373952_0174201 | 3300035092 | Unclassified | 617 |
| 443 | Ga0373932_0039673 | 3300035112 | Bacteria | 1352 |
| 444 | Ga0373941_0009537 | 3300035115 | Bacteria | 2449 |
| 445 | Ga0373961_0042894 | 3300035241 | Bacteria | 1313 |
| 446 | Ga0395900_0113790 | 3300037418 | Bacteria | 2777 |
| 447 | Ga0395900_0641165 | 3300037418 | Bacteria | 1000 |
| 448 | Ga0395898_0182035 | 3300037466 | Bacteria | 2008 |
| 449 | Ga0395898_0324033 | 3300037466 | Bacteria | 1470 |
| 450 | Ga0395898_0341978 | 3300037466 | Bacteria | 1427 |
| 451 | Ga0242420_017424 | 3300038996 | Unclassified | 1257 |
| 452 | Ga0439439_0082301 | 3300041406 | Bacteria | 872 |
| 453 | Ga0439455_0010795 | 3300042012 | Bacteria | 2017 |
| 454 | Ga0439458_0010139 | 3300042157 | Bacteria | 2098 |
| 455 | Ga0451576_0200984 | 3300045051 | Bacteria | 2082 |
| 456 | Ga0496100_0936359 | 3300048903 | Bacteria | 681 |
| 457 | Ga0496102_0836472 | 3300048905 | Bacteria | 843 |
| 458 | Ga0496106_0110987 | 3300048909 | Bacteria | 2135 |
| 459 | Ga0496108_0299193 | 3300048911 | Bacteria | 1401 |
| 460 | Ga0496109_0723977 | 3300048912 | Bacteria | 933 |
| 461 | Ga0496110_0640116 | 3300048913 | Bacteria | 963 |
| 462 | Ga0496112_0224532 | 3300048915 | Bacteria | 1834 |
| 463 | Ga0496112_0350508 | 3300048915 | Bacteria | 1419 |
| 464 | Ga0496112_1176635 | 3300048915 | Unclassified | 684 |
| 465 | Ga0496113_0078824 | 3300048916 | Bacteria | 2521 |
| 466 | Ga0496113_0368590 | 3300048916 | Bacteria | 1153 |
| 467 | Ga0496113_0815520 | 3300048916 | Bacteria | 741 |
| 468 | Ga0501292_025737 | 3300049515 | Bacteria | 970 |
| 469 | Ga0501296_006382 | 3300049519 | Bacteria | 1335 |
| 470 | Ga0501298_052336 | 3300049521 | Bacteria | 850 |
| 471 | Ga0501299_024595 | 3300049522 | Bacteria | 1125 |
| 472 | Ga0501302_012880 | 3300049525 | Bacteria | 634 |
| 473 | Ga0501076_0895544 | 3300049592 | Bacteria | 732 |
| 474 | Ga0501198_038421 | 3300049649 | Bacteria | 822 |
| 475 | Ga0501199_004551 | 3300049650 | Bacteria | 1368 |
| 476 | Ga0501202_002680 | 3300049652 | Bacteria | 3005 |
| 477 | Ga0501202_003498 | 3300049652 | Bacteria | 2693 |
| 478 | Ga0501207_001767 | 3300049654 | Bacteria | 2734 |
| 479 | Ga0501207_044977 | 3300049654 | Bacteria | 776 |
| 480 | Ga0501214_003880 | 3300049659 | Bacteria | 1353 |
| 481 | Ga0501216_004464 | 3300049660 | Bacteria | 2078 |
| 482 | Ga0501216_054278 | 3300049660 | Bacteria | 794 |
| 483 | Ga0501217_000158 | 3300049661 | Bacteria | 9539 |
| 484 | Ga0501217_017062 | 3300049661 | Bacteria | 1671 |
| 485 | Ga0501217_035638 | 3300049661 | Bacteria | 1245 |
| 486 | Ga0501223_003805 | 3300049663 | Bacteria | 3262 |
| 487 | Ga0501224_002160 | 3300049664 | Bacteria | 2666 |
| 488 | Ga0501224_019472 | 3300049664 | Bacteria | 1011 |
| 489 | Ga0501227_002994 | 3300049665 | Bacteria | 3690 |
| 490 | Ga0501230_001873 | 3300049667 | Bacteria | 2594 |
| 491 | Ga0501230_005418 | 3300049667 | Bacteria | 1805 |
| 492 | Ga0501233_005408 | 3300049668 | Bacteria | 2370 |
| 493 | Ga0501233_018556 | 3300049668 | Bacteria | 1464 |
| 494 | Ga0501233_106427 | 3300049668 | Bacteria | 746 |
| 495 | Ga0501233_137498 | 3300049668 | Bacteria | 672 |
| 496 | Ga0501235_018043 | 3300049669 | Bacteria | 1562 |
| 497 | Ga0501235_026164 | 3300049669 | Bacteria | 1306 |
| 498 | Ga0501236_005193 | 3300049670 | Bacteria | 1569 |
| 499 | Ga0501240_000583 | 3300049673 | Bacteria | 3062 |
| 500 | Ga0501240_010695 | 3300049673 | Bacteria | 1224 |
| 501 | Ga0501242_034083 | 3300049674 | Bacteria | 699 |
| 502 | Ga0501249_095305 | 3300049679 | Bacteria | 709 |
| 503 | Ga0501250_038684 | 3300049680 | Bacteria | 692 |
| 504 | Ga0501253_005132 | 3300049683 | Bacteria | 1697 |
| 505 | Ga0501253_077619 | 3300049683 | Bacteria | 744 |
| 506 | Ga0501256_002487 | 3300049685 | Bacteria | 1468 |
| 507 | Ga0501256_010795 | 3300049685 | Bacteria | 875 |
| 508 | Ga0501260_005970 | 3300049689 | Bacteria | 1161 |
| 509 | Ga0501261_053920 | 3300049690 | Bacteria | 666 |
| 510 | Ga0501221_033393 | 3300049704 | Bacteria | 1086 |
| 511 | Ga0501225_0001760 | 3300049705 | Bacteria | 6785 |
| 512 | Ga0501225_0207734 | 3300049705 | Bacteria | 624 |
| 513 | Ga0501229_003087 | 3300049706 | Bacteria | 1981 |
| 514 | Ga0501234_026646 | 3300049707 | Bacteria | 928 |
| 515 | Ga0501234_038579 | 3300049707 | Bacteria | 779 |
| 516 | Ga0501245_003911 | 3300049708 | Bacteria | 2036 |
| 517 | Ga0501264_009273 | 3300049761 | Bacteria | 936 |
| 518 | Ga0501268_021954 | 3300049765 | Bacteria | 1099 |
| 519 | Ga0501268_034662 | 3300049765 | Bacteria | 928 |
| 520 | Ga0501271_044193 | 3300049768 | Bacteria | 588 |
| 521 | Ga0501272_053437 | 3300049769 | Bacteria | 565 |
| 522 | Ga0501278_035790 | 3300049774 | Bacteria | 522 |
| 523 | Ga0501279_035618 | 3300049775 | Bacteria | 750 |
| 524 | Ga0501283_001293 | 3300049779 | Bacteria | 3285 |
| 525 | Ga0501035_0969542 | 3300049822 | Bacteria | 670 |
| 526 | Ga0501204_004553 | 3300049850 | Bacteria | 1497 |
| 527 | Ga0501212_003606 | 3300049851 | Bacteria | 1954 |
| 528 | Ga0501212_007050 | 3300049851 | Bacteria | 1531 |
| 529 | Ga0501226_001610 | 3300049853 | Bacteria | 2860 |
| 530 | Ga0501226_015661 | 3300049853 | Bacteria | 836 |
| 531 | nmdc:mga05p37_109434_c1 | 3300050507 | Bacteria | 3399 |
| 532 | nmdc:mga05p37_135232_c1 | 3300050507 | Bacteria | 3024 |
| 533 | nmdc:mga09592_425127_c1 | 3300050508 | Bacteria | 1147 |
| 534 | nmdc:mga0qj67_243968_c1 | 3300050509 | Bacteria | 1457 |
| 535 | nmdc:mga0qj67_509054_c1 | 3300050509 | Bacteria | 968 |
| 536 | nmdc:mga06r32_280498_c1 | 3300050510 | Bacteria | 1653 |
| 537 | nmdc:mga06r32_93810_c1 | 3300050510 | Bacteria | 2936 |
| 538 | nmdc:mga08y16_1383_c1 | 3300050511 | Bacteria | 24251 |
| 539 | nmdc:mga08y16_145834_c1 | 3300050511 | Bacteria | 2461 |
| 540 | nmdc:mga08y16_518191_c1 | 3300050511 | Bacteria | 1209 |
| 541 | nmdc:mga08y16_87892_c1 | 3300050511 | Bacteria | 3238 |
| 542 | nmdc:mga0n895_153091_c1 | 3300050512 | Bacteria | 2336 |
| 543 | nmdc:mga0n895_64074_c1 | 3300050512 | Bacteria | 3635 |
| 544 | nmdc:mga0n895_711317_c1 | 3300050512 | Bacteria | 1000 |
| 545 | nmdc:mga0n895_949064_c1 | 3300050512 | Bacteria | 843 |
| 546 | nmdc:mga0rr50_7056_c1 | 3300050513 | Bacteria | 6895 |
| 547 | nmdc:mga08x19_15088_c2 | 3300050514 | Bacteria | 2157 |
| 548 | nmdc:mga0a205_154302_c1 | 3300050515 | Bacteria | 2195 |
| 549 | nmdc:mga0a205_24062_c1 | 3300050515 | Bacteria | 5784 |
| 550 | nmdc:mga0a205_333328_c1 | 3300050515 | Bacteria | 1387 |
| 551 | Ga0501084_0527992 | 3300054114 | Bacteria | 998 |
| 552 | Ga0530510_0111388 | 3300061734 | Bacteria | 2005 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10007217 | Ga0070692_100072174 | 155 |
| 2 | 3300005406 | Ga0070703_10002431 | Ga0070703_100024313 | 155 |
| 3 | 3300005440 | Ga0070705_100008941 | Ga0070705_1000089412 | 155 |
| 4 | 3300005441 | Ga0070700_100040071 | Ga0070700_1000400712 | 155 |
| 5 | 3300005444 | Ga0070694_100002992 | Ga0070694_1000029924 | 155 |
| 6 | 3300005467 | Ga0070706_100000616 | Ga0070706_10000061623 | 155 |
| 7 | 3300005539 | Ga0068853_101074310 | Ga0068853_1010743101 | 155 |
| 8 | 3300005545 | Ga0070695_100539625 | Ga0070695_1005396252 | 155 |
| 9 | 3300005546 | Ga0070696_100058366 | Ga0070696_1000583663 | 155 |
| 10 | 3300005547 | Ga0070693_100087052 | Ga0070693_1000870522 | 155 |
| 11 | 3300005549 | Ga0070704_100086001 | Ga0070704_1000860013 | 155 |
| 12 | 3300005563 | Ga0068855_101046256 | Ga0068855_1010462561 | 155 |
| 13 | 3300005578 | Ga0068854_100436356 | Ga0068854_1004363562 | 155 |
| 14 | 3300005615 | Ga0070702_100070382 | Ga0070702_1000703823 | 155 |
| 15 | 3300005616 | Ga0068852_100734395 | Ga0068852_1007343952 | 155 |
| 16 | 3300005617 | Ga0068859_100100075 | Ga0068859_1001000752 | 155 |
| 17 | 3300005834 | Ga0068851_10001845 | Ga0068851_100018459 | 155 |
| 18 | 3300005842 | Ga0068858_100152417 | Ga0068858_1001524172 | 155 |
| 19 | 3300006844 | Ga0075428_101244868 | Ga0075428_1012448681 | 155 |
| 20 | 3300006852 | Ga0075433_10042453 | Ga0075433_100424534 | 155 |
| 21 | 3300006852 | Ga0075433_11075250 | Ga0075433_110752501 | 155 |
| 22 | 3300006871 | Ga0075434_101249867 | Ga0075434_1012498672 | 155 |
| 23 | 3300006931 | Ga0097620_100100077 | Ga0097620_1001000772 | 155 |
| 24 | 3300009093 | Ga0105240_10038496 | Ga0105240_100384965 | 155 |
| 25 | 3300009094 | Ga0111539_10201166 | Ga0111539_102011662 | 155 |
| 26 | 3300009147 | Ga0114129_10011837 | Ga0114129_1001183711 | 155 |
| 27 | 3300009545 | Ga0105237_10002641 | Ga0105237_1000264111 | 155 |
| 28 | 3300010375 | Ga0105239_10046466 | Ga0105239_100464664 | 155 |
| 29 | 3300013307 | Ga0157372_10998345 | Ga0157372_109983452 | 155 |
| 30 | 3300025321 | Ga0207656_10003437 | Ga0207656_100034376 | 155 |
| 31 | 3300025885 | Ga0207653_10001589 | Ga0207653_100015894 | 155 |
| 32 | 3300025904 | Ga0207647_10139564 | Ga0207647_101395642 | 155 |
| 33 | 3300025910 | Ga0207684_10000172 | Ga0207684_1000017286 | 155 |
| 34 | 3300025913 | Ga0207695_10554503 | Ga0207695_105545032 | 155 |
| 35 | 3300025914 | Ga0207671_10008097 | Ga0207671_100080973 | 155 |
| 36 | 3300025936 | Ga0207670_10570512 | Ga0207670_105705122 | 155 |
| 37 | 3300026035 | Ga0207703_10094513 | Ga0207703_100945132 | 155 |
| 38 | 3300026075 | Ga0207708_10101639 | Ga0207708_101016392 | 155 |
| 39 | 3300037418 | Ga0395900_0641165 | Ga0395900_0641165_298_765 | 155 |
| 40 | 3300037466 | Ga0395898_0324033 | Ga0395898_0324033_251_718 | 155 |
| 41 | 3300048916 | Ga0496113_0078824 | Ga0496113_0078824_166_633 | 155 |
| 42 | 3300049654 | Ga0501207_044977 | Ga0501207_044977_16_483 | 155 |
| 43 | 3300049668 | Ga0501233_018556 | Ga0501233_018556_732_1199 | 155 |
| 44 | 3300049774 | Ga0501278_035790 | Ga0501278_035790_25_492 | 155 |
| 45 | 3300049851 | Ga0501212_007050 | Ga0501212_007050_857_1324 | 155 |
| 46 | 3300050507 | nmdc:mga05p37_135232_c1 | nmdc:mga05p37_135232_c1_1721_2188 | 155 |
| 47 | 3300050511 | nmdc:mga08y16_87892_c1 | nmdc:mga08y16_87892_c1_269_736 | 155 |
| 48 | 3300050512 | nmdc:mga0n895_949064_c1 | nmdc:mga0n895_949064_c1_329_796 | 155 |
| 49 | 3300050515 | nmdc:mga0a205_24062_c1 | nmdc:mga0a205_24062_c1_2733_3200 | 155 |
| 50 | 3300003203 | JGI25406J46586_10018162 | JGI25406J46586_100181624 | 156 |
| 51 | 3300005293 | Ga0065715_10158954 | Ga0065715_101589542 | 156 |
| 52 | 3300005293 | Ga0065715_10460842 | Ga0065715_104608422 | 156 |
| 53 | 3300005293 | Ga0065715_10553748 | Ga0065715_105537481 | 156 |
| 54 | 3300005330 | Ga0070690_100042298 | Ga0070690_1000422983 | 156 |
| 55 | 3300005364 | Ga0070673_100546363 | Ga0070673_1005463632 | 156 |
| 56 | 3300005365 | Ga0070688_100376623 | Ga0070688_1003766232 | 156 |
| 57 | 3300005440 | Ga0070705_100018334 | Ga0070705_1000183342 | 156 |
| 58 | 3300005441 | Ga0070700_100262075 | Ga0070700_1002620752 | 156 |
| 59 | 3300005444 | Ga0070694_100245983 | Ga0070694_1002459832 | 156 |
| 60 | 3300005444 | Ga0070694_100627768 | Ga0070694_1006277682 | 156 |
| 61 | 3300005444 | Ga0070694_101498937 | Ga0070694_1014989371 | 156 |
| 62 | 3300005458 | Ga0070681_10372427 | Ga0070681_103724272 | 156 |
| 63 | 3300005530 | Ga0070679_100467210 | Ga0070679_1004672102 | 156 |
| 64 | 3300005545 | Ga0070695_100141532 | Ga0070695_1001415322 | 156 |
| 65 | 3300005549 | Ga0070704_100037403 | Ga0070704_1000374032 | 156 |
| 66 | 3300005617 | Ga0068859_100002808 | Ga0068859_1000028082 | 156 |
| 67 | 3300005617 | Ga0068859_100174930 | Ga0068859_1001749302 | 156 |
| 68 | 3300005617 | Ga0068859_100283093 | Ga0068859_1002830932 | 156 |
| 69 | 3300005842 | Ga0068858_100056291 | Ga0068858_1000562914 | 156 |
| 70 | 3300005842 | Ga0068858_100387289 | Ga0068858_1003872891 | 156 |
| 71 | 3300005842 | Ga0068858_100812126 | Ga0068858_1008121262 | 156 |
| 72 | 3300005843 | Ga0068860_100189365 | Ga0068860_1001893653 | 156 |
| 73 | 3300005985 | Ga0081539_10000407 | Ga0081539_1000040782 | 156 |
| 74 | 3300006847 | Ga0075431_100191521 | Ga0075431_1001915213 | 156 |
| 75 | 3300006847 | Ga0075431_100584819 | Ga0075431_1005848192 | 156 |
| 76 | 3300006880 | Ga0075429_100448286 | Ga0075429_1004482862 | 156 |
| 77 | 3300006931 | Ga0097620_100002808 | Ga0097620_10000280824 | 156 |
| 78 | 3300006931 | Ga0097620_100174924 | Ga0097620_1001749242 | 156 |
| 79 | 3300006931 | Ga0097620_100283083 | Ga0097620_1002830832 | 156 |
| 80 | 3300009101 | Ga0105247_10000819 | Ga0105247_100008199 | 156 |
| 81 | 3300009101 | Ga0105247_10298496 | Ga0105247_102984962 | 156 |
| 82 | 3300009147 | Ga0114129_10048031 | Ga0114129_100480316 | 156 |
| 83 | 3300009148 | Ga0105243_10528718 | Ga0105243_105287182 | 156 |
| 84 | 3300009174 | Ga0105241_10457251 | Ga0105241_104572512 | 156 |
| 85 | 3300009176 | Ga0105242_11800731 | Ga0105242_118007311 | 156 |
| 86 | 3300009177 | Ga0105248_10002339 | Ga0105248_1000233917 | 156 |
| 87 | 3300009177 | Ga0105248_10222972 | Ga0105248_102229723 | 156 |
| 88 | 3300009545 | Ga0105237_10021451 | Ga0105237_100214515 | 156 |
| 89 | 3300009545 | Ga0105237_10410788 | Ga0105237_104107882 | 156 |
| 90 | 3300009545 | Ga0105237_10412714 | Ga0105237_104127142 | 156 |
| 91 | 3300009545 | Ga0105237_10817713 | Ga0105237_108177132 | 156 |
| 92 | 3300011119 | Ga0105246_11016761 | Ga0105246_110167612 | 156 |
| 93 | 3300011119 | Ga0105246_11231776 | Ga0105246_112317762 | 156 |
| 94 | 3300013306 | Ga0163162_11149772 | Ga0163162_111497721 | 156 |
| 95 | 3300025900 | Ga0207710_10000745 | Ga0207710_100007457 | 156 |
| 96 | 3300025900 | Ga0207710_10249626 | Ga0207710_102496262 | 156 |
| 97 | 3300025904 | Ga0207647_10023247 | Ga0207647_100232474 | 156 |
| 98 | 3300025914 | Ga0207671_10210142 | Ga0207671_102101422 | 156 |
| 99 | 3300025914 | Ga0207671_10236892 | Ga0207671_102368922 | 156 |
| 100 | 3300025914 | Ga0207671_10691752 | Ga0207671_106917522 | 156 |
| 101 | 3300025921 | Ga0207652_10421379 | Ga0207652_104213792 | 156 |
| 102 | 3300025935 | Ga0207709_11330219 | Ga0207709_113302191 | 156 |
| 103 | 3300025941 | Ga0207711_10038231 | Ga0207711_100382312 | 156 |
| 104 | 3300025941 | Ga0207711_10197275 | Ga0207711_101972753 | 156 |
| 105 | 3300025981 | Ga0207640_11618024 | Ga0207640_116180241 | 156 |
| 106 | 3300026035 | Ga0207703_10038583 | Ga0207703_100385833 | 156 |
| 107 | 3300026035 | Ga0207703_10933902 | Ga0207703_109339022 | 156 |
| 108 | 3300026041 | Ga0207639_10329795 | Ga0207639_103297952 | 156 |
| 109 | 3300026075 | Ga0207708_10055963 | Ga0207708_100559632 | 156 |
| 110 | 3300026116 | Ga0207674_10995797 | Ga0207674_109957972 | 156 |
| 111 | 3300026116 | Ga0207674_11203984 | Ga0207674_112039842 | 156 |
| 112 | 3300026142 | Ga0207698_10667191 | Ga0207698_106671912 | 156 |
| 113 | 3300028381 | Ga0268264_10297990 | Ga0268264_102979902 | 156 |
| 114 | 3300031548 | Ga0307408_100020033 | Ga0307408_1000200333 | 156 |
| 115 | 3300031731 | Ga0307405_10057201 | Ga0307405_100572012 | 156 |
| 116 | 3300031824 | Ga0307413_10085050 | Ga0307413_100850502 | 156 |
| 117 | 3300031852 | Ga0307410_10061410 | Ga0307410_100614104 | 156 |
| 118 | 3300031901 | Ga0307406_10012520 | Ga0307406_100125202 | 156 |
| 119 | 3300031911 | Ga0307412_10008521 | Ga0307412_100085212 | 156 |
| 120 | 3300032002 | Ga0307416_100122631 | Ga0307416_1001226311 | 156 |
| 121 | 3300032004 | Ga0307414_10190039 | Ga0307414_101900392 | 156 |
| 122 | 3300032005 | Ga0307411_11447660 | Ga0307411_114476601 | 156 |
| 123 | 3300032126 | Ga0307415_100000991 | Ga0307415_1000009916 | 156 |
| 124 | 3300037418 | Ga0395900_0113790 | Ga0395900_0113790_2190_2660 | 156 |
| 125 | 3300037466 | Ga0395898_0182035 | Ga0395898_0182035_489_959 | 156 |
| 126 | 3300038996 | Ga0242420_017424 | Ga0242420_017424_551_1021 | 156 |
| 127 | 3300048903 | Ga0496100_0936359 | Ga0496100_0936359_65_535 | 156 |
| 128 | 3300048909 | Ga0496106_0110987 | Ga0496106_0110987_270_740 | 156 |
| 129 | 3300048916 | Ga0496113_0815520 | Ga0496113_0815520_33_503 | 156 |
| 130 | 3300049521 | Ga0501298_052336 | Ga0501298_052336_367_837 | 156 |
| 131 | 3300049650 | Ga0501199_004551 | Ga0501199_004551_846_1316 | 156 |
| 132 | 3300049652 | Ga0501202_002680 | Ga0501202_002680_859_1329 | 156 |
| 133 | 3300049654 | Ga0501207_001767 | Ga0501207_001767_1678_2148 | 156 |
| 134 | 3300049659 | Ga0501214_003880 | Ga0501214_003880_427_897 | 156 |
| 135 | 3300049660 | Ga0501216_004464 | Ga0501216_004464_1149_1619 | 156 |
| 136 | 3300049661 | Ga0501217_000158 | Ga0501217_000158_4546_5016 | 156 |
| 137 | 3300049663 | Ga0501223_003805 | Ga0501223_003805_1978_2448 | 156 |
| 138 | 3300049664 | Ga0501224_002160 | Ga0501224_002160_609_1079 | 156 |
| 139 | 3300049665 | Ga0501227_002994 | Ga0501227_002994_2023_2493 | 156 |
| 140 | 3300049667 | Ga0501230_001873 | Ga0501230_001873_1336_1806 | 156 |
| 141 | 3300049668 | Ga0501233_005408 | Ga0501233_005408_726_1196 | 156 |
| 142 | 3300049669 | Ga0501235_026164 | Ga0501235_026164_42_512 | 156 |
| 143 | 3300049670 | Ga0501236_005193 | Ga0501236_005193_202_672 | 156 |
| 144 | 3300049673 | Ga0501240_000583 | Ga0501240_000583_1338_1808 | 156 |
| 145 | 3300049674 | Ga0501242_034083 | Ga0501242_034083_62_532 | 156 |
| 146 | 3300049683 | Ga0501253_077619 | Ga0501253_077619_61_531 | 156 |
| 147 | 3300049685 | Ga0501256_002487 | Ga0501256_002487_414_884 | 156 |
| 148 | 3300049689 | Ga0501260_005970 | Ga0501260_005970_199_669 | 156 |
| 149 | 3300049705 | Ga0501225_0001760 | Ga0501225_0001760_1171_1641 | 156 |
| 150 | 3300049706 | Ga0501229_003087 | Ga0501229_003087_145_615 | 156 |
| 151 | 3300049707 | Ga0501234_026646 | Ga0501234_026646_204_674 | 156 |
| 152 | 3300049765 | Ga0501268_034662 | Ga0501268_034662_46_516 | 156 |
| 153 | 3300049775 | Ga0501279_035618 | Ga0501279_035618_121_591 | 156 |
| 154 | 3300049850 | Ga0501204_004553 | Ga0501204_004553_994_1464 | 156 |
| 155 | 3300049851 | Ga0501212_003606 | Ga0501212_003606_609_1079 | 156 |
| 156 | 3300049853 | Ga0501226_001610 | Ga0501226_001610_1402_1872 | 156 |
| 157 | 3300050507 | nmdc:mga05p37_109434_c1 | nmdc:mga05p37_109434_c1_68_556 | 156 |
| 158 | 3300050508 | nmdc:mga09592_425127_c1 | nmdc:mga09592_425127_c1_339_809 | 156 |
| 159 | 3300050509 | nmdc:mga0qj67_509054_c1 | nmdc:mga0qj67_509054_c1_241_711 | 156 |
| 160 | 3300050510 | nmdc:mga06r32_280498_c1 | nmdc:mga06r32_280498_c1_476_946 | 156 |
| 161 | 3300050510 | nmdc:mga06r32_93810_c1 | nmdc:mga06r32_93810_c1_1872_2342 | 156 |
| 162 | 3300002459 | JGI24751J29686_10000050 | JGI24751J29686_1000005013 | 157 |
| 163 | 3300003320 | rootH2_10054533 | rootH2_100545332 | 157 |
| 164 | 3300003322 | rootL2_10137033 | rootL2_101370332 | 157 |
| 165 | 3300003322 | rootL2_10138097 | rootL2_101380972 | 157 |
| 166 | 3300005288 | Ga0065714_10065325 | Ga0065714_100653258 | 157 |
| 167 | 3300005289 | Ga0065704_10097557 | Ga0065704_100975573 | 157 |
| 168 | 3300005290 | Ga0065712_10057129 | Ga0065712_100571291 | 157 |
| 169 | 3300005290 | Ga0065712_10068401 | Ga0065712_100684018 | 157 |
| 170 | 3300005290 | Ga0065712_10468174 | Ga0065712_104681741 | 157 |
| 171 | 3300005293 | Ga0065715_10001359 | Ga0065715_100013593 | 157 |
| 172 | 3300005293 | Ga0065715_10179393 | Ga0065715_101793931 | 157 |
| 173 | 3300005293 | Ga0065715_10334890 | Ga0065715_103348902 | 157 |
| 174 | 3300005293 | Ga0065715_10453322 | Ga0065715_104533221 | 157 |
| 175 | 3300005295 | Ga0065707_10000960 | Ga0065707_100009603 | 157 |
| 176 | 3300005328 | Ga0070676_10077707 | Ga0070676_100777072 | 157 |
| 177 | 3300005329 | Ga0070683_102184474 | Ga0070683_1021844741 | 157 |
| 178 | 3300005330 | Ga0070690_100386813 | Ga0070690_1003868132 | 157 |
| 179 | 3300005331 | Ga0070670_100000266 | Ga0070670_1000002669 | 157 |
| 180 | 3300005331 | Ga0070670_100792850 | Ga0070670_1007928501 | 157 |
| 181 | 3300005333 | Ga0070677_10141856 | Ga0070677_101418562 | 157 |
| 182 | 3300005334 | Ga0068869_100199513 | Ga0068869_1001995132 | 157 |
| 183 | 3300005334 | Ga0068869_100489625 | Ga0068869_1004896252 | 157 |
| 184 | 3300005334 | Ga0068869_101032494 | Ga0068869_1010324941 | 157 |
| 185 | 3300005336 | Ga0070680_100036035 | Ga0070680_1000360352 | 157 |
| 186 | 3300005337 | Ga0070682_100002088 | Ga0070682_10000208812 | 157 |
| 187 | 3300005337 | Ga0070682_100434879 | Ga0070682_1004348792 | 157 |
| 188 | 3300005339 | Ga0070660_100615307 | Ga0070660_1006153072 | 157 |
| 189 | 3300005343 | Ga0070687_100688708 | Ga0070687_1006887082 | 157 |
| 190 | 3300005343 | Ga0070687_100933278 | Ga0070687_1009332781 | 157 |
| 191 | 3300005345 | Ga0070692_10159233 | Ga0070692_101592333 | 157 |
| 192 | 3300005345 | Ga0070692_10187016 | Ga0070692_101870162 | 157 |
| 193 | 3300005353 | Ga0070669_100069297 | Ga0070669_1000692973 | 157 |
| 194 | 3300005353 | Ga0070669_101558258 | Ga0070669_1015582581 | 157 |
| 195 | 3300005354 | Ga0070675_100287224 | Ga0070675_1002872242 | 157 |
| 196 | 3300005354 | Ga0070675_100645331 | Ga0070675_1006453311 | 157 |
| 197 | 3300005364 | Ga0070673_100350173 | Ga0070673_1003501732 | 157 |
| 198 | 3300005364 | Ga0070673_100599331 | Ga0070673_1005993311 | 157 |
| 199 | 3300005365 | Ga0070688_101005584 | Ga0070688_1010055841 | 157 |
| 200 | 3300005366 | Ga0070659_100565902 | Ga0070659_1005659022 | 157 |
| 201 | 3300005434 | Ga0070709_10137638 | Ga0070709_101376382 | 157 |
| 202 | 3300005440 | Ga0070705_100228041 | Ga0070705_1002280412 | 157 |
| 203 | 3300005440 | Ga0070705_101026385 | Ga0070705_1010263851 | 157 |
| 204 | 3300005440 | Ga0070705_101556456 | Ga0070705_1015564561 | 157 |
| 205 | 3300005441 | Ga0070700_100000131 | Ga0070700_10000013142 | 157 |
| 206 | 3300005441 | Ga0070700_100024587 | Ga0070700_1000245873 | 157 |
| 207 | 3300005441 | Ga0070700_100146928 | Ga0070700_1001469282 | 157 |
| 208 | 3300005441 | Ga0070700_100375124 | Ga0070700_1003751242 | 157 |
| 209 | 3300005444 | Ga0070694_100206393 | Ga0070694_1002063932 | 157 |
| 210 | 3300005444 | Ga0070694_100213296 | Ga0070694_1002132962 | 157 |
| 211 | 3300005445 | Ga0070708_100433420 | Ga0070708_1004334201 | 157 |
| 212 | 3300005457 | Ga0070662_100795248 | Ga0070662_1007952481 | 157 |
| 213 | 3300005458 | Ga0070681_10180599 | Ga0070681_101805992 | 157 |
| 214 | 3300005458 | Ga0070681_10840704 | Ga0070681_108407041 | 157 |
| 215 | 3300005459 | Ga0068867_100072859 | Ga0068867_1000728592 | 157 |
| 216 | 3300005466 | Ga0070685_10647594 | Ga0070685_106475942 | 157 |
| 217 | 3300005467 | Ga0070706_100521910 | Ga0070706_1005219102 | 157 |
| 218 | 3300005468 | Ga0070707_100026882 | Ga0070707_1000268827 | 157 |
| 219 | 3300005471 | Ga0070698_100004211 | Ga0070698_1000042117 | 157 |
| 220 | 3300005518 | Ga0070699_100003366 | Ga0070699_10000336610 | 157 |
| 221 | 3300005518 | Ga0070699_100125455 | Ga0070699_1001254553 | 157 |
| 222 | 3300005518 | Ga0070699_101194722 | Ga0070699_1011947221 | 157 |
| 223 | 3300005530 | Ga0070679_100147963 | Ga0070679_1001479633 | 157 |
| 224 | 3300005536 | Ga0070697_100030061 | Ga0070697_1000300613 | 157 |
| 225 | 3300005539 | Ga0068853_100632526 | Ga0068853_1006325261 | 157 |
| 226 | 3300005539 | Ga0068853_101169992 | Ga0068853_1011699921 | 157 |
| 227 | 3300005543 | Ga0070672_101119969 | Ga0070672_1011199692 | 157 |
| 228 | 3300005544 | Ga0070686_100545413 | Ga0070686_1005454132 | 157 |
| 229 | 3300005545 | Ga0070695_100152925 | Ga0070695_1001529252 | 157 |
| 230 | 3300005545 | Ga0070695_100519204 | Ga0070695_1005192042 | 157 |
| 231 | 3300005546 | Ga0070696_100044574 | Ga0070696_1000445744 | 157 |
| 232 | 3300005546 | Ga0070696_100194217 | Ga0070696_1001942172 | 157 |
| 233 | 3300005546 | Ga0070696_100625555 | Ga0070696_1006255552 | 157 |
| 234 | 3300005547 | Ga0070693_100282842 | Ga0070693_1002828421 | 157 |
| 235 | 3300005549 | Ga0070704_101141525 | Ga0070704_1011415252 | 157 |
| 236 | 3300005577 | Ga0068857_100188211 | Ga0068857_1001882112 | 157 |
| 237 | 3300005577 | Ga0068857_101134524 | Ga0068857_1011345242 | 157 |
| 238 | 3300005577 | Ga0068857_102061809 | Ga0068857_1020618091 | 157 |
| 239 | 3300005614 | Ga0068856_102152281 | Ga0068856_1021522811 | 157 |
| 240 | 3300005615 | Ga0070702_100283122 | Ga0070702_1002831222 | 157 |
| 241 | 3300005615 | Ga0070702_100307977 | Ga0070702_1003079772 | 157 |
| 242 | 3300005615 | Ga0070702_100679934 | Ga0070702_1006799342 | 157 |
| 243 | 3300005617 | Ga0068859_100003853 | Ga0068859_1000038534 | 157 |
| 244 | 3300005617 | Ga0068859_100033966 | Ga0068859_1000339665 | 157 |
| 245 | 3300005617 | Ga0068859_100088357 | Ga0068859_1000883572 | 157 |
| 246 | 3300005617 | Ga0068859_100143877 | Ga0068859_1001438772 | 157 |
| 247 | 3300005617 | Ga0068859_100186915 | Ga0068859_1001869152 | 157 |
| 248 | 3300005617 | Ga0068859_100227879 | Ga0068859_1002278792 | 157 |
| 249 | 3300005617 | Ga0068859_100232810 | Ga0068859_1002328102 | 157 |
| 250 | 3300005617 | Ga0068859_100351228 | Ga0068859_1003512282 | 157 |
| 251 | 3300005617 | Ga0068859_101664290 | Ga0068859_1016642901 | 157 |
| 252 | 3300005617 | Ga0068859_101971555 | Ga0068859_1019715551 | 157 |
| 253 | 3300005618 | Ga0068864_100000619 | Ga0068864_1000006198 | 157 |
| 254 | 3300005618 | Ga0068864_100191475 | Ga0068864_1001914751 | 157 |
| 255 | 3300005618 | Ga0068864_100370217 | Ga0068864_1003702172 | 157 |
| 256 | 3300005618 | Ga0068864_100925109 | Ga0068864_1009251092 | 157 |
| 257 | 3300005618 | Ga0068864_101021776 | Ga0068864_1010217761 | 157 |
| 258 | 3300005719 | Ga0068861_100000821 | Ga0068861_10000082110 | 157 |
| 259 | 3300005840 | Ga0068870_10035986 | Ga0068870_100359863 | 157 |
| 260 | 3300005840 | Ga0068870_10354568 | Ga0068870_103545682 | 157 |
| 261 | 3300005841 | Ga0068863_100058964 | Ga0068863_1000589642 | 157 |
| 262 | 3300005841 | Ga0068863_100107284 | Ga0068863_1001072842 | 157 |
| 263 | 3300005841 | Ga0068863_100670222 | Ga0068863_1006702222 | 157 |
| 264 | 3300005842 | Ga0068858_100079286 | Ga0068858_1000792862 | 157 |
| 265 | 3300005842 | Ga0068858_100214779 | Ga0068858_1002147792 | 157 |
| 266 | 3300005842 | Ga0068858_101293496 | Ga0068858_1012934962 | 157 |
| 267 | 3300005843 | Ga0068860_100007764 | Ga0068860_10000776413 | 157 |
| 268 | 3300005843 | Ga0068860_100017714 | Ga0068860_1000177146 | 157 |
| 269 | 3300005843 | Ga0068860_100400126 | Ga0068860_1004001262 | 157 |
| 270 | 3300005843 | Ga0068860_101830061 | Ga0068860_1018300612 | 157 |
| 271 | 3300005844 | Ga0068862_100036060 | Ga0068862_1000360603 | 157 |
| 272 | 3300005844 | Ga0068862_100245127 | Ga0068862_1002451272 | 157 |
| 273 | 3300005844 | Ga0068862_101304442 | Ga0068862_1013044422 | 157 |
| 274 | 3300006173 | Ga0070716_100020148 | Ga0070716_1000201482 | 157 |
| 275 | 3300006237 | Ga0097621_100028667 | Ga0097621_1000286673 | 157 |
| 276 | 3300006237 | Ga0097621_100249091 | Ga0097621_1002490912 | 157 |
| 277 | 3300006237 | Ga0097621_100666066 | Ga0097621_1006660662 | 157 |
| 278 | 3300006358 | Ga0068871_100005373 | Ga0068871_1000053734 | 157 |
| 279 | 3300006358 | Ga0068871_100139530 | Ga0068871_1001395302 | 157 |
| 280 | 3300006844 | Ga0075428_100296721 | Ga0075428_1002967212 | 157 |
| 281 | 3300006846 | Ga0075430_100703786 | Ga0075430_1007037861 | 157 |
| 282 | 3300006914 | Ga0075436_100089397 | Ga0075436_1000893972 | 157 |
| 283 | 3300006931 | Ga0097620_100003853 | Ga0097620_1000038534 | 157 |
| 284 | 3300006931 | Ga0097620_100033964 | Ga0097620_1000339643 | 157 |
| 285 | 3300006931 | Ga0097620_100088350 | Ga0097620_1000883502 | 157 |
| 286 | 3300006931 | Ga0097620_100143881 | Ga0097620_1001438812 | 157 |
| 287 | 3300006931 | Ga0097620_100186920 | Ga0097620_1001869202 | 157 |
| 288 | 3300006931 | Ga0097620_100227887 | Ga0097620_1002278872 | 157 |
| 289 | 3300006931 | Ga0097620_100232811 | Ga0097620_1002328113 | 157 |
| 290 | 3300006931 | Ga0097620_100351224 | Ga0097620_1003512242 | 157 |
| 291 | 3300006931 | Ga0097620_101664620 | Ga0097620_1016646201 | 157 |
| 292 | 3300006931 | Ga0097620_101971690 | Ga0097620_1019716901 | 157 |
| 293 | 3300009011 | Ga0105251_10115457 | Ga0105251_101154572 | 157 |
| 294 | 3300009094 | Ga0111539_10001336 | Ga0111539_1000133630 | 157 |
| 295 | 3300009094 | Ga0111539_10102446 | Ga0111539_101024464 | 157 |
| 296 | 3300009094 | Ga0111539_11299167 | Ga0111539_112991672 | 157 |
| 297 | 3300009101 | Ga0105247_10209372 | Ga0105247_102093722 | 157 |
| 298 | 3300009101 | Ga0105247_10215755 | Ga0105247_102157552 | 157 |
| 299 | 3300009101 | Ga0105247_10378885 | Ga0105247_103788852 | 157 |
| 300 | 3300009101 | Ga0105247_11075062 | Ga0105247_110750621 | 157 |
| 301 | 3300009147 | Ga0114129_10483027 | Ga0114129_104830272 | 157 |
| 302 | 3300009147 | Ga0114129_10892505 | Ga0114129_108925052 | 157 |
| 303 | 3300009148 | Ga0105243_10237538 | Ga0105243_102375382 | 157 |
| 304 | 3300009148 | Ga0105243_10448727 | Ga0105243_104487271 | 157 |
| 305 | 3300009148 | Ga0105243_10663552 | Ga0105243_106635522 | 157 |
| 306 | 3300009148 | Ga0105243_11010076 | Ga0105243_110100762 | 157 |
| 307 | 3300009174 | Ga0105241_10002866 | Ga0105241_100028662 | 157 |
| 308 | 3300009174 | Ga0105241_10065202 | Ga0105241_100652022 | 157 |
| 309 | 3300009174 | Ga0105241_10118901 | Ga0105241_101189012 | 157 |
| 310 | 3300009174 | Ga0105241_10210636 | Ga0105241_102106362 | 157 |
| 311 | 3300009174 | Ga0105241_10317456 | Ga0105241_103174562 | 157 |
| 312 | 3300009174 | Ga0105241_10527551 | Ga0105241_105275512 | 157 |
| 313 | 3300009174 | Ga0105241_10934698 | Ga0105241_109346982 | 157 |
| 314 | 3300009174 | Ga0105241_10963180 | Ga0105241_109631801 | 157 |
| 315 | 3300009174 | Ga0105241_11159709 | Ga0105241_111597091 | 157 |
| 316 | 3300009174 | Ga0105241_11643277 | Ga0105241_116432771 | 157 |
| 317 | 3300009174 | Ga0105241_12389900 | Ga0105241_123899001 | 157 |
| 318 | 3300009176 | Ga0105242_10034046 | Ga0105242_100340464 | 157 |
| 319 | 3300009177 | Ga0105248_10001571 | Ga0105248_1000157111 | 157 |
| 320 | 3300009177 | Ga0105248_10004801 | Ga0105248_1000480114 | 157 |
| 321 | 3300009177 | Ga0105248_10235525 | Ga0105248_102355252 | 157 |
| 322 | 3300009177 | Ga0105248_10691965 | Ga0105248_106919652 | 157 |
| 323 | 3300009177 | Ga0105248_11165688 | Ga0105248_111656882 | 157 |
| 324 | 3300009177 | Ga0105248_11717621 | Ga0105248_117176211 | 157 |
| 325 | 3300009545 | Ga0105237_11186061 | Ga0105237_111860612 | 157 |
| 326 | 3300009551 | Ga0105238_10008559 | Ga0105238_1000855910 | 157 |
| 327 | 3300009551 | Ga0105238_10028603 | Ga0105238_100286036 | 157 |
| 328 | 3300009551 | Ga0105238_11100177 | Ga0105238_111001772 | 157 |
| 329 | 3300009553 | Ga0105249_10045444 | Ga0105249_100454444 | 157 |
| 330 | 3300009553 | Ga0105249_10375546 | Ga0105249_103755462 | 157 |
| 331 | 3300010375 | Ga0105239_10505674 | Ga0105239_105056742 | 157 |
| 332 | 3300010375 | Ga0105239_11352954 | Ga0105239_113529541 | 157 |
| 333 | 3300011119 | Ga0105246_10557118 | Ga0105246_105571182 | 157 |
| 334 | 3300013100 | Ga0157373_10015466 | Ga0157373_100154664 | 157 |
| 335 | 3300013100 | Ga0157373_10028246 | Ga0157373_100282464 | 157 |
| 336 | 3300013100 | Ga0157373_10537929 | Ga0157373_105379292 | 157 |
| 337 | 3300013100 | Ga0157373_10897362 | Ga0157373_108973621 | 157 |
| 338 | 3300013297 | Ga0157378_10410334 | Ga0157378_104103342 | 157 |
| 339 | 3300013297 | Ga0157378_11690658 | Ga0157378_116906582 | 157 |
| 340 | 3300013306 | Ga0163162_10021630 | Ga0163162_100216304 | 157 |
| 341 | 3300013306 | Ga0163162_10312700 | Ga0163162_103127003 | 157 |
| 342 | 3300013306 | Ga0163162_11187546 | Ga0163162_111875462 | 157 |
| 343 | 3300013306 | Ga0163162_11375590 | Ga0163162_113755902 | 157 |
| 344 | 3300013307 | Ga0157372_10531695 | Ga0157372_105316952 | 157 |
| 345 | 3300013307 | Ga0157372_10560256 | Ga0157372_105602562 | 157 |
| 346 | 3300013307 | Ga0157372_11277484 | Ga0157372_112774841 | 157 |
| 347 | 3300013308 | Ga0157375_10038398 | Ga0157375_100383982 | 157 |
| 348 | 3300013308 | Ga0157375_11321447 | Ga0157375_113214471 | 157 |
| 349 | 3300013308 | Ga0157375_11672563 | Ga0157375_116725631 | 157 |
| 350 | 3300013308 | Ga0157375_12575484 | Ga0157375_125754841 | 157 |
| 351 | 3300014325 | Ga0163163_10007264 | Ga0163163_100072648 | 157 |
| 352 | 3300014325 | Ga0163163_10978892 | Ga0163163_109788922 | 157 |
| 353 | 3300014325 | Ga0163163_11384629 | Ga0163163_113846292 | 157 |
| 354 | 3300014326 | Ga0157380_10044984 | Ga0157380_100449843 | 157 |
| 355 | 3300014326 | Ga0157380_11257357 | Ga0157380_112573571 | 157 |
| 356 | 3300014326 | Ga0157380_11322197 | Ga0157380_113221972 | 157 |
| 357 | 3300014326 | Ga0157380_11401586 | Ga0157380_114015862 | 157 |
| 358 | 3300014745 | Ga0157377_10328607 | Ga0157377_103286072 | 157 |
| 359 | 3300014745 | Ga0157377_10522962 | Ga0157377_105229622 | 157 |
| 360 | 3300014745 | Ga0157377_10559238 | Ga0157377_105592381 | 157 |
| 361 | 3300014745 | Ga0157377_10613305 | Ga0157377_106133052 | 157 |
| 362 | 3300025735 | Ga0207713_1072369 | Ga0207713_10723692 | 157 |
| 363 | 3300025904 | Ga0207647_10001169 | Ga0207647_1000116922 | 157 |
| 364 | 3300025904 | Ga0207647_10290916 | Ga0207647_102909162 | 157 |
| 365 | 3300025910 | Ga0207684_10221519 | Ga0207684_102215191 | 157 |
| 366 | 3300025911 | Ga0207654_10014078 | Ga0207654_100140785 | 157 |
| 367 | 3300025911 | Ga0207654_10558637 | Ga0207654_105586371 | 157 |
| 368 | 3300025911 | Ga0207654_10721718 | Ga0207654_107217181 | 157 |
| 369 | 3300025912 | Ga0207707_10699514 | Ga0207707_106995142 | 157 |
| 370 | 3300025917 | Ga0207660_10049600 | Ga0207660_100496002 | 157 |
| 371 | 3300025921 | Ga0207652_10110053 | Ga0207652_101100532 | 157 |
| 372 | 3300025922 | Ga0207646_10376628 | Ga0207646_103766282 | 157 |
| 373 | 3300025923 | Ga0207681_10022760 | Ga0207681_100227603 | 157 |
| 374 | 3300025924 | Ga0207694_10123528 | Ga0207694_101235282 | 157 |
| 375 | 3300025924 | Ga0207694_10216706 | Ga0207694_102167062 | 157 |
| 376 | 3300025925 | Ga0207650_10000022 | Ga0207650_1000002287 | 157 |
| 377 | 3300025925 | Ga0207650_10053748 | Ga0207650_100537484 | 157 |
| 378 | 3300025926 | Ga0207659_10862569 | Ga0207659_108625691 | 157 |
| 379 | 3300025926 | Ga0207659_11237770 | Ga0207659_112377702 | 157 |
| 380 | 3300025932 | Ga0207690_10114835 | Ga0207690_101148353 | 157 |
| 381 | 3300025932 | Ga0207690_10295691 | Ga0207690_102956912 | 157 |
| 382 | 3300025933 | Ga0207706_10638801 | Ga0207706_106388012 | 157 |
| 383 | 3300025935 | Ga0207709_10166802 | Ga0207709_101668022 | 157 |
| 384 | 3300025936 | Ga0207670_10000531 | Ga0207670_1000053110 | 157 |
| 385 | 3300025940 | Ga0207691_10492318 | Ga0207691_104923182 | 157 |
| 386 | 3300025941 | Ga0207711_10013780 | Ga0207711_100137805 | 157 |
| 387 | 3300025941 | Ga0207711_10161242 | Ga0207711_101612421 | 157 |
| 388 | 3300025941 | Ga0207711_10438861 | Ga0207711_104388612 | 157 |
| 389 | 3300025941 | Ga0207711_10778280 | Ga0207711_107782801 | 157 |
| 390 | 3300025942 | Ga0207689_10033823 | Ga0207689_100338231 | 157 |
| 391 | 3300025942 | Ga0207689_10396018 | Ga0207689_103960182 | 157 |
| 392 | 3300025945 | Ga0207679_11059922 | Ga0207679_110599222 | 157 |
| 393 | 3300025949 | Ga0207667_10950810 | Ga0207667_109508102 | 157 |
| 394 | 3300025960 | Ga0207651_10186778 | Ga0207651_101867783 | 157 |
| 395 | 3300025960 | Ga0207651_11221960 | Ga0207651_112219601 | 157 |
| 396 | 3300025961 | Ga0207712_10034761 | Ga0207712_100347613 | 157 |
| 397 | 3300025961 | Ga0207712_10251594 | Ga0207712_102515942 | 157 |
| 398 | 3300025981 | Ga0207640_10171300 | Ga0207640_101713002 | 157 |
| 399 | 3300025981 | Ga0207640_10959816 | Ga0207640_109598162 | 157 |
| 400 | 3300026075 | Ga0207708_10000087 | Ga0207708_1000008744 | 157 |
| 401 | 3300026075 | Ga0207708_10021945 | Ga0207708_100219454 | 157 |
| 402 | 3300026075 | Ga0207708_10037723 | Ga0207708_100377234 | 157 |
| 403 | 3300026075 | Ga0207708_10455313 | Ga0207708_104553132 | 157 |
| 404 | 3300026075 | Ga0207708_10491910 | Ga0207708_104919102 | 157 |
| 405 | 3300026088 | Ga0207641_10031890 | Ga0207641_100318905 | 157 |
| 406 | 3300026088 | Ga0207641_10537259 | Ga0207641_105372592 | 157 |
| 407 | 3300026088 | Ga0207641_10762333 | Ga0207641_107623332 | 157 |
| 408 | 3300026088 | Ga0207641_10892964 | Ga0207641_108929642 | 157 |
| 409 | 3300026088 | Ga0207641_11129978 | Ga0207641_111299781 | 157 |
| 410 | 3300026089 | Ga0207648_10047355 | Ga0207648_100473554 | 157 |
| 411 | 3300026089 | Ga0207648_10189579 | Ga0207648_101895792 | 157 |
| 412 | 3300026089 | Ga0207648_10289355 | Ga0207648_102893552 | 157 |
| 413 | 3300026089 | Ga0207648_10341127 | Ga0207648_103411272 | 157 |
| 414 | 3300026089 | Ga0207648_10347211 | Ga0207648_103472112 | 157 |
| 415 | 3300026095 | Ga0207676_10019565 | Ga0207676_100195654 | 157 |
| 416 | 3300026095 | Ga0207676_10472944 | Ga0207676_104729442 | 157 |
| 417 | 3300026095 | Ga0207676_10618205 | Ga0207676_106182052 | 157 |
| 418 | 3300026095 | Ga0207676_10622772 | Ga0207676_106227721 | 157 |
| 419 | 3300026095 | Ga0207676_11124742 | Ga0207676_111247422 | 157 |
| 420 | 3300026116 | Ga0207674_10104800 | Ga0207674_101048002 | 157 |
| 421 | 3300026116 | Ga0207674_10161931 | Ga0207674_101619312 | 157 |
| 422 | 3300026116 | Ga0207674_10742113 | Ga0207674_107421132 | 157 |
| 423 | 3300026116 | Ga0207674_10865399 | Ga0207674_108653992 | 157 |
| 424 | 3300026116 | Ga0207674_11278851 | Ga0207674_112788512 | 157 |
| 425 | 3300026118 | Ga0207675_100004382 | Ga0207675_10000438210 | 157 |
| 426 | 3300026118 | Ga0207675_100623667 | Ga0207675_1006236671 | 157 |
| 427 | 3300026118 | Ga0207675_100652698 | Ga0207675_1006526982 | 157 |
| 428 | 3300027907 | Ga0207428_10004743 | Ga0207428_100047437 | 157 |
| 429 | 3300027907 | Ga0207428_10136446 | Ga0207428_101364462 | 157 |
| 430 | 3300028380 | Ga0268265_10302128 | Ga0268265_103021282 | 157 |
| 431 | 3300028381 | Ga0268264_10029518 | Ga0268264_100295185 | 157 |
| 432 | 3300028381 | Ga0268264_10263273 | Ga0268264_102632733 | 157 |
| 433 | 3300028381 | Ga0268264_10282024 | Ga0268264_102820242 | 157 |
| 434 | 3300028381 | Ga0268264_10326445 | Ga0268264_103264452 | 157 |
| 435 | 3300028381 | Ga0268264_10422163 | Ga0268264_104221632 | 157 |
| 436 | 3300030745 | Ga0316182_1432847 | Ga0316182_14328472 | 157 |
| 437 | 3300031548 | Ga0307408_100244814 | Ga0307408_1002448142 | 157 |
| 438 | 3300031548 | Ga0307408_100497679 | Ga0307408_1004976792 | 157 |
| 439 | 3300031548 | Ga0307408_100898024 | Ga0307408_1008980242 | 157 |
| 440 | 3300031731 | Ga0307405_10357849 | Ga0307405_103578492 | 157 |
| 441 | 3300032002 | Ga0307416_100021200 | Ga0307416_1000212004 | 157 |
| 442 | 3300032002 | Ga0307416_101328461 | Ga0307416_1013284611 | 157 |
| 443 | 3300032004 | Ga0307414_10496321 | Ga0307414_104963212 | 157 |
| 444 | 3300032005 | Ga0307411_10265594 | Ga0307411_102655942 | 157 |
| 445 | 3300032126 | Ga0307415_101012572 | Ga0307415_1010125722 | 157 |
| 446 | 3300035090 | Ga0373949_0110781 | Ga0373949_0110781_112_588 | 157 |
| 447 | 3300035091 | Ga0373951_0000859 | Ga0373951_0000859_5497_5970 | 157 |
| 448 | 3300035092 | Ga0373952_0174201 | Ga0373952_0174201_23_499 | 157 |
| 449 | 3300035112 | Ga0373932_0039673 | Ga0373932_0039673_303_776 | 157 |
| 450 | 3300035115 | Ga0373941_0009537 | Ga0373941_0009537_50_526 | 157 |
| 451 | 3300035241 | Ga0373961_0042894 | Ga0373961_0042894_546_1022 | 157 |
| 452 | 3300037466 | Ga0395898_0341978 | Ga0395898_0341978_227_700 | 157 |
| 453 | 3300041406 | Ga0439439_0082301 | Ga0439439_0082301_331_804 | 157 |
| 454 | 3300048905 | Ga0496102_0836472 | Ga0496102_0836472_16_489 | 157 |
| 455 | 3300048912 | Ga0496109_0723977 | Ga0496109_0723977_57_530 | 157 |
| 456 | 3300048913 | Ga0496110_0640116 | Ga0496110_0640116_429_902 | 157 |
| 457 | 3300048915 | Ga0496112_0224532 | Ga0496112_0224532_1271_1744 | 157 |
| 458 | 3300048915 | Ga0496112_0350508 | Ga0496112_0350508_36_509 | 157 |
| 459 | 3300048915 | Ga0496112_1176635 | Ga0496112_1176635_180_653 | 157 |
| 460 | 3300048916 | Ga0496113_0368590 | Ga0496113_0368590_543_1016 | 157 |
| 461 | 3300049515 | Ga0501292_025737 | Ga0501292_025737_411_884 | 157 |
| 462 | 3300049519 | Ga0501296_006382 | Ga0501296_006382_454_936 | 157 |
| 463 | 3300049522 | Ga0501299_024595 | Ga0501299_024595_298_771 | 157 |
| 464 | 3300049525 | Ga0501302_012880 | Ga0501302_012880_91_573 | 157 |
| 465 | 3300049592 | Ga0501076_0895544 | Ga0501076_0895544_87_560 | 157 |
| 466 | 3300049649 | Ga0501198_038421 | Ga0501198_038421_276_749 | 157 |
| 467 | 3300049652 | Ga0501202_003498 | Ga0501202_003498_1625_2107 | 157 |
| 468 | 3300049660 | Ga0501216_054278 | Ga0501216_054278_217_699 | 157 |
| 469 | 3300049661 | Ga0501217_017062 | Ga0501217_017062_794_1267 | 157 |
| 470 | 3300049661 | Ga0501217_035638 | Ga0501217_035638_552_1034 | 157 |
| 471 | 3300049664 | Ga0501224_019472 | Ga0501224_019472_282_764 | 157 |
| 472 | 3300049667 | Ga0501230_005418 | Ga0501230_005418_730_1203 | 157 |
| 473 | 3300049668 | Ga0501233_106427 | Ga0501233_106427_183_656 | 157 |
| 474 | 3300049668 | Ga0501233_137498 | Ga0501233_137498_175_648 | 157 |
| 475 | 3300049669 | Ga0501235_018043 | Ga0501235_018043_660_1142 | 157 |
| 476 | 3300049673 | Ga0501240_010695 | Ga0501240_010695_420_902 | 157 |
| 477 | 3300049679 | Ga0501249_095305 | Ga0501249_095305_15_488 | 157 |
| 478 | 3300049680 | Ga0501250_038684 | Ga0501250_038684_77_550 | 157 |
| 479 | 3300049683 | Ga0501253_005132 | Ga0501253_005132_1014_1496 | 157 |
| 480 | 3300049685 | Ga0501256_010795 | Ga0501256_010795_181_663 | 157 |
| 481 | 3300049690 | Ga0501261_053920 | Ga0501261_053920_88_570 | 157 |
| 482 | 3300049704 | Ga0501221_033393 | Ga0501221_033393_256_738 | 157 |
| 483 | 3300049705 | Ga0501225_0207734 | Ga0501225_0207734_138_611 | 157 |
| 484 | 3300049707 | Ga0501234_038579 | Ga0501234_038579_70_552 | 157 |
| 485 | 3300049708 | Ga0501245_003911 | Ga0501245_003911_1023_1496 | 157 |
| 486 | 3300049761 | Ga0501264_009273 | Ga0501264_009273_83_565 | 157 |
| 487 | 3300049765 | Ga0501268_021954 | Ga0501268_021954_450_932 | 157 |
| 488 | 3300049768 | Ga0501271_044193 | Ga0501271_044193_26_508 | 157 |
| 489 | 3300049769 | Ga0501272_053437 | Ga0501272_053437_25_498 | 157 |
| 490 | 3300049779 | Ga0501283_001293 | Ga0501283_001293_2023_2505 | 157 |
| 491 | 3300049822 | Ga0501035_0969542 | Ga0501035_0969542_124_597 | 157 |
| 492 | 3300049853 | Ga0501226_015661 | Ga0501226_015661_298_771 | 157 |
| 493 | 3300050509 | nmdc:mga0qj67_243968_c1 | nmdc:mga0qj67_243968_c1_124_597 | 157 |
| 494 | 3300050511 | nmdc:mga08y16_1383_c1 | nmdc:mga08y16_1383_c1_8748_9221 | 157 |
| 495 | 3300050511 | nmdc:mga08y16_145834_c1 | nmdc:mga08y16_145834_c1_568_1041 | 157 |
| 496 | 3300050511 | nmdc:mga08y16_518191_c1 | nmdc:mga08y16_518191_c1_711_1187 | 157 |
| 497 | 3300050512 | nmdc:mga0n895_153091_c1 | nmdc:mga0n895_153091_c1_1818_2291 | 157 |
| 498 | 3300050514 | nmdc:mga08x19_15088_c2 | nmdc:mga08x19_15088_c2_1228_1701 | 157 |
| 499 | 3300050515 | nmdc:mga0a205_154302_c1 | nmdc:mga0a205_154302_c1_354_827 | 157 |
| 500 | 3300054114 | Ga0501084_0527992 | Ga0501084_0527992_215_688 | 157 |
| 501 | 3300061734 | Ga0530510_0111388 | Ga0530510_0111388_698_1171 | 157 |
| 502 | 3300000532 | CNAas_1000114 | CNAas_10001143 | 158 |
| 503 | 3300005290 | Ga0065712_10426402 | Ga0065712_104264021 | 158 |
| 504 | 3300005331 | Ga0070670_100052467 | Ga0070670_1000524673 | 158 |
| 505 | 3300005331 | Ga0070670_100209459 | Ga0070670_1002094592 | 158 |
| 506 | 3300005364 | Ga0070673_100076005 | Ga0070673_1000760052 | 158 |
| 507 | 3300005365 | Ga0070688_100006390 | Ga0070688_1000063906 | 158 |
| 508 | 3300005366 | Ga0070659_101667296 | Ga0070659_1016672961 | 158 |
| 509 | 3300005444 | Ga0070694_100018810 | Ga0070694_1000188103 | 158 |
| 510 | 3300005444 | Ga0070694_100054519 | Ga0070694_1000545193 | 158 |
| 511 | 3300005546 | Ga0070696_100006184 | Ga0070696_1000061845 | 158 |
| 512 | 3300005547 | Ga0070693_100218843 | Ga0070693_1002188432 | 158 |
| 513 | 3300005547 | Ga0070693_100622633 | Ga0070693_1006226331 | 158 |
| 514 | 3300005564 | Ga0070664_100485095 | Ga0070664_1004850952 | 158 |
| 515 | 3300005577 | Ga0068857_100075869 | Ga0068857_1000758693 | 158 |
| 516 | 3300005577 | Ga0068857_100489946 | Ga0068857_1004899462 | 158 |
| 517 | 3300005618 | Ga0068864_100041446 | Ga0068864_1000414464 | 158 |
| 518 | 3300005844 | Ga0068862_100696433 | Ga0068862_1006964332 | 158 |
| 519 | 3300006852 | Ga0075433_10544534 | Ga0075433_105445342 | 158 |
| 520 | 3300006871 | Ga0075434_100079771 | Ga0075434_1000797713 | 158 |
| 521 | 3300006871 | Ga0075434_100346220 | Ga0075434_1003462202 | 158 |
| 522 | 3300007076 | Ga0075435_100087691 | Ga0075435_1000876912 | 158 |
| 523 | 3300007076 | Ga0075435_100679946 | Ga0075435_1006799462 | 158 |
| 524 | 3300009098 | Ga0105245_10847457 | Ga0105245_108474571 | 158 |
| 525 | 3300009147 | Ga0114129_10313111 | Ga0114129_103131112 | 158 |
| 526 | 3300009148 | Ga0105243_10637151 | Ga0105243_106371511 | 158 |
| 527 | 3300009174 | Ga0105241_10137222 | Ga0105241_101372222 | 158 |
| 528 | 3300009176 | Ga0105242_10117665 | Ga0105242_101176653 | 158 |
| 529 | 3300009553 | Ga0105249_10043905 | Ga0105249_100439052 | 158 |
| 530 | 3300013306 | Ga0163162_10043322 | Ga0163162_100433223 | 158 |
| 531 | 3300013308 | Ga0157375_11324298 | Ga0157375_113242982 | 158 |
| 532 | 3300014325 | Ga0163163_10018206 | Ga0163163_100182066 | 158 |
| 533 | 3300025918 | Ga0207662_10035104 | Ga0207662_100351042 | 158 |
| 534 | 3300025921 | Ga0207652_11250371 | Ga0207652_112503712 | 158 |
| 535 | 3300025925 | Ga0207650_10055116 | Ga0207650_100551162 | 158 |
| 536 | 3300025936 | Ga0207670_10097514 | Ga0207670_100975142 | 158 |
| 537 | 3300025981 | Ga0207640_10014875 | Ga0207640_100148752 | 158 |
| 538 | 3300026075 | Ga0207708_10586557 | Ga0207708_105865572 | 158 |
| 539 | 3300026088 | Ga0207641_10241100 | Ga0207641_102411001 | 158 |
| 540 | 3300026095 | Ga0207676_10031460 | Ga0207676_100314602 | 158 |
| 541 | 3300026095 | Ga0207676_10172210 | Ga0207676_101722103 | 158 |
| 542 | 3300026116 | Ga0207674_10059481 | Ga0207674_100594812 | 158 |
| 543 | 3300026116 | Ga0207674_10150754 | Ga0207674_101507542 | 158 |
| 544 | 3300032002 | Ga0307416_100317532 | Ga0307416_1003175322 | 158 |
| 545 | 3300042012 | Ga0439455_0010795 | Ga0439455_0010795_265_759 | 158 |
| 546 | 3300042157 | Ga0439458_0010139 | Ga0439458_0010139_425_919 | 158 |
| 547 | 3300045051 | Ga0451576_0200984 | Ga0451576_0200984_409_894 | 158 |
| 548 | 3300048911 | Ga0496108_0299193 | Ga0496108_0299193_679_1158 | 158 |
| 549 | 3300050512 | nmdc:mga0n895_64074_c1 | nmdc:mga0n895_64074_c1_2415_2900 | 158 |
| 550 | 3300050512 | nmdc:mga0n895_711317_c1 | nmdc:mga0n895_711317_c1_389_883 | 158 |
| 551 | 3300050513 | nmdc:mga0rr50_7056_c1 | nmdc:mga0rr50_7056_c1_2811_3305 | 158 |
| 552 | 3300050515 | nmdc:mga0a205_333328_c1 | nmdc:mga0a205_333328_c1_250_735 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dfr-assembly1.cif.gz_A | crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate | 0.9345 | 3 | 158 |
| 5ecx-assembly1.cif.gz_B | klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6-(pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4-diamine | 0.9249 | 2 | 156 |
| 7reg-assembly1.cif.gz_A | dfra1 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) | 0.9216 | 2 | 156 |
| 7rgj-assembly1.cif.gz_A | dfra1 complexed with nadph and 5-(3-(7-(4-(aminomethyl)phenyl)benzo[d][1,3]dioxol-5-yl)but-1-yn-1-yl)-6-ethylpyrimidine-2,4-diamine (ucp1223) | 0.9195 | 2 | 156 |
| 3dfr-assembly1.cif.gz_A | crystal structures of escherichia coli and lactobacillus casei dihydrofolate reductase refined at 1.7 angstroms resolution. i. general features and binding of methotrexate | 0.9176 | 3 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9249 | 2 | 156 | 3.40.430.10 |
| 3ix9B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9208 | 2 | 158 | 3.40.430.10 |
| 3ix9B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9096 | 2 | 158 | 3.40.430.10 |
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9025 | 2 | 156 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9021 | 1 | 155 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8QDB3-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9939 | 34 | 155 |
GO:0004146
GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A059WUG3-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9895 | 1 | 156 |
GO:0004146
GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A7W1LYM9-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9843 | 2 | 158 |
GO:0004146
GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A2V8RKV1-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9842 | 1 | 157 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A059WN40-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9837 | 2 | 158 |
GO:0004146
GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar