F462717

General Info

Members Datasets Scaffolds Average Seq Length
552 232 1104 209

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10002674|Ga0105245_100026745
Length 236
Sequence MSATVEVVEAQPRPGSSRGKNEARRLRVSGRVPAVVYGAKKDTVAVSLDPKVISRILASESGHNTIFDLQVGSEKTKAMIVDWQFEPIRGSILHIDLKRIAMDEKMRVMVPIHLVGEAPGVKQQGGIMDQIIREVEIECLPGDIPSHIDADVSALEFGVVLRVKDLPHGGKLKFITPEDQGVAHVTAVKEEVVATPDAAAADXXAGPAEPEVIKKGKQETEEGAEAEKAPAGKEKK

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
220 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
221 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.01
Metatranscriptomes 3.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.8
Rhizosphere 93.48
Stem 0
Stem Tuber 0
Unclassified 10.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10002674 3300009098 Bacteria 16041
2 LJNas_1000260 3300000546 Bacteria 9129
3 Ga0058859_11229812 3300004798 Bacteria 1459
4 Ga0058863_10100073 3300004799 Unclassified 1286
5 Ga0058863_10150337 3300004799 Bacteria 3510
6 Ga0058863_11826942 3300004799 Bacteria 1583
7 Ga0058861_10094073 3300004800 Bacteria 1210
8 Ga0058861_10138085 3300004800 Bacteria 1893
9 Ga0058861_11962564 3300004800 Bacteria 1178
10 Ga0058862_10009088 3300004803 Bacteria 1153
11 Ga0058862_10222981 3300004803 Bacteria 2222
12 Ga0058862_10237322 3300004803 Bacteria 5418
13 Ga0058862_10276214 3300004803 Unclassified 917
14 Ga0058862_12744342 3300004803 Bacteria 1446
15 Ga0070658_10073242 3300005327 Bacteria 2808
16 Ga0070676_10257446 3300005328 Bacteria 1167
17 Ga0070683_100030293 3300005329 Bacteria 4910
18 Ga0070683_100176882 3300005329 Bacteria 2026
19 Ga0070690_100313474 3300005330 Bacteria 1128
20 Ga0070690_100526094 3300005330 Bacteria 888
21 Ga0070670_100001671 3300005331 Bacteria 18007
22 Ga0068869_100029513 3300005334 Bacteria 3844
23 Ga0068869_100489370 3300005334 Bacteria 1025
24 Ga0070666_10391574 3300005335 Unclassified 998
25 Ga0070680_100009435 3300005336 Bacteria 7498
26 Ga0070680_100088624 3300005336 Bacteria 2560
27 Ga0070680_100239449 3300005336 Bacteria 1533
28 Ga0070680_100257884 3300005336 Bacteria 1475
29 Ga0070680_100264625 3300005336 Bacteria 1455
30 Ga0070682_100099619 3300005337 Unclassified 1916
31 Ga0068868_100002128 3300005338 Bacteria 13662
32 Ga0068868_100026427 3300005338 Bacteria 4424
33 Ga0068868_100222794 3300005338 Unclassified 1580
34 Ga0068868_100331100 3300005338 Bacteria 1300
35 Ga0070660_100099634 3300005339 Bacteria 2301
36 Ga0070691_10183389 3300005341 Unclassified 1091
37 Ga0070687_100110088 3300005343 Bacteria 1557
38 Ga0070661_100044298 3300005344 Bacteria 3251
39 Ga0070661_100259091 3300005344 Bacteria 1344
40 Ga0070669_100831101 3300005353 Unclassified 786
41 Ga0070671_100109494 3300005355 Bacteria 2320
42 Ga0070673_100062264 3300005364 Bacteria 2964
43 Ga0070659_100065868 3300005366 Bacteria 2870
44 Ga0070709_10031450 3300005434 Bacteria 3192
45 Ga0070709_10049158 3300005434 Unclassified 2635
46 Ga0070709_10110232 3300005434 Bacteria 1849
47 Ga0070709_10168549 3300005434 Bacteria 1528
48 Ga0070709_10173214 3300005434 Bacteria 1510
49 Ga0070714_100010217 3300005435 Bacteria 7410
50 Ga0070714_100245702 3300005435 Bacteria 1653
51 Ga0070714_100294310 3300005435 Bacteria 1511
52 Ga0070714_100520318 3300005435 Bacteria 1136
53 Ga0070714_100624135 3300005435 Bacteria 1036
54 Ga0070713_100024512 3300005436 Bacteria 4700
55 Ga0070713_100028018 3300005436 Bacteria 4444
56 Ga0070713_100047430 3300005436 Bacteria 3531
57 Ga0070713_100093401 3300005436 Bacteria 2592
58 Ga0070713_100214580 3300005436 Bacteria 1744
59 Ga0070713_100218139 3300005436 Bacteria 1730
60 Ga0070713_100281506 3300005436 Unclassified 1526
61 Ga0070713_100617966 3300005436 Bacteria 1030
62 Ga0070710_10004463 3300005437 Bacteria 6623
63 Ga0070710_10020086 3300005437 Bacteria 3461
64 Ga0070711_100007062 3300005439 Bacteria 6813
65 Ga0070711_100023091 3300005439 Bacteria 4040
66 Ga0070711_100049047 3300005439 Bacteria 2890
67 Ga0070711_100085238 3300005439 Bacteria 2263
68 Ga0070708_100002407 3300005445 Bacteria 14504
69 Ga0070708_100015048 3300005445 Bacteria 6382
70 Ga0070708_100121445 3300005445 Bacteria 2410
71 Ga0070662_100071662 3300005457 Unclassified 2556
72 Ga0070662_100235861 3300005457 Bacteria 1465
73 Ga0070681_10008575 3300005458 Bacteria 10016
74 Ga0070681_10010721 3300005458 Bacteria 9058
75 Ga0070681_10031414 3300005458 Bacteria 5332
76 Ga0070681_10046181 3300005458 Bacteria 4355
77 Ga0070681_10249505 3300005458 Bacteria 1688
78 Ga0070681_10263663 3300005458 Bacteria 1635
79 Ga0070681_10296483 3300005458 Unclassified 1527
80 Ga0070681_10415132 3300005458 Bacteria 1258
81 Ga0068867_100005572 3300005459 Bacteria 8920
82 Ga0070706_100000812 3300005467 Bacteria 34622
83 Ga0070706_100000935 3300005467 Bacteria 31937
84 Ga0070706_100006968 3300005467 Bacteria 10660
85 Ga0070707_100003649 3300005468 Bacteria 14508
86 Ga0070698_100337674 3300005471 Bacteria 1438
87 Ga0070699_100525643 3300005518 Bacteria 1076
88 Ga0070679_100003769 3300005530 Bacteria 13909
89 Ga0070679_100014343 3300005530 Bacteria 7610
90 Ga0070679_100040984 3300005530 Bacteria 4609
91 Ga0070679_100101184 3300005530 Bacteria 2868
92 Ga0070684_100048946 3300005535 Bacteria 3668
93 Ga0070684_100138870 3300005535 Bacteria 2196
94 Ga0070684_100367440 3300005535 Bacteria 1324
95 Ga0070684_100526694 3300005535 Bacteria 1096
96 Ga0070697_100000249 3300005536 Bacteria 43436
97 Ga0070697_100000266 3300005536 Bacteria 42492
98 Ga0070697_100036205 3300005536 Bacteria 3985
99 Ga0070697_100131111 3300005536 Bacteria 2102
100 Ga0070697_100165972 3300005536 Bacteria 1867
101 Ga0070697_100416967 3300005536 Bacteria 1166
102 Ga0068853_100101358 3300005539 Bacteria 2546
103 Ga0068853_100114209 3300005539 Bacteria 2402
104 Ga0068853_100193007 3300005539 Bacteria 1851
105 Ga0068853_100373981 3300005539 Bacteria 1330
106 Ga0068853_100556928 3300005539 Bacteria 1086
107 Ga0070696_100213395 3300005546 Bacteria 1446
108 Ga0070693_100066614 3300005547 Bacteria 2108
109 Ga0070693_100113637 3300005547 Bacteria 1670
110 Ga0070704_100389194 3300005549 Bacteria 1187
111 Ga0068855_100000151 3300005563 Bacteria 88133
112 Ga0068855_100002998 3300005563 Bacteria 20641
113 Ga0068855_100010918 3300005563 Bacteria 10963
114 Ga0068855_100087433 3300005563 Bacteria 3602
115 Ga0068855_100139164 3300005563 Bacteria 2768
116 Ga0068855_100248413 3300005563 Bacteria 1985
117 Ga0068855_100305095 3300005563 Bacteria 1762
118 Ga0068855_100447861 3300005563 Bacteria 1409
119 Ga0070664_100001009 3300005564 Bacteria 22089
120 Ga0070664_100011218 3300005564 Bacteria 7268
121 Ga0070664_100202461 3300005564 Bacteria 1772
122 Ga0068857_100000121 3300005577 Bacteria 46931
123 Ga0068857_100044114 3300005577 Bacteria 3955
124 Ga0068857_100047396 3300005577 Bacteria 3816
125 Ga0068854_100047989 3300005578 Bacteria 3045
126 Ga0068854_100076111 3300005578 Bacteria 2466
127 Ga0068854_100157755 3300005578 Bacteria 1755
128 Ga0068854_100242987 3300005578 Bacteria 1434
129 Ga0068854_100266461 3300005578 Unclassified 1374
130 Ga0068856_100000119 3300005614 Bacteria 78324
131 Ga0068856_100000735 3300005614 Bacteria 35512
132 Ga0068856_100003101 3300005614 Bacteria 16968
133 Ga0068856_100021804 3300005614 Bacteria 6226
134 Ga0068856_100041815 3300005614 Bacteria 4506
135 Ga0068856_100221480 3300005614 Unclassified 1907
136 Ga0068852_100041056 3300005616 Bacteria 3907
137 Ga0068852_100353920 3300005616 Bacteria 1434
138 Ga0068859_100000415 3300005617 Bacteria 42515
139 Ga0068859_100259423 3300005617 Bacteria 1829
140 Ga0068864_100001353 3300005618 Bacteria 20389
141 Ga0068864_100061671 3300005618 Bacteria 3248
142 Ga0068866_10001235 3300005718 Bacteria 11081
143 Ga0068851_10050612 3300005834 Bacteria 2110
144 Ga0068863_100040487 3300005841 Bacteria 4431
145 Ga0068863_100182712 3300005841 Unclassified 2013
146 Ga0068858_100001756 3300005842 Bacteria 22108
147 Ga0068858_100195213 3300005842 Bacteria 1913
148 Ga0068860_100382288 3300005843 Bacteria 1390
149 Ga0068860_100474119 3300005843 Bacteria 1247
150 Ga0068862_100534689 3300005844 Bacteria 1117
151 Ga0081540_1094023 3300005983 Bacteria 1311
152 Ga0070717_10000964 3300006028 Bacteria 19200
153 Ga0070717_10031513 3300006028 Bacteria 4266
154 Ga0070717_10059121 3300006028 Bacteria 3171
155 Ga0070717_10065419 3300006028 Bacteria 3022
156 Ga0070717_10072990 3300006028 Bacteria 2867
157 Ga0070717_10129870 3300006028 Bacteria 2166
158 Ga0070717_10337869 3300006028 Bacteria 1344
159 Ga0070717_10784023 3300006028 Unclassified 867
160 Ga0070715_10043405 3300006163 Bacteria 1896
161 Ga0070716_100012854 3300006173 Bacteria 4255
162 Ga0070716_100060757 3300006173 Bacteria 2184
163 Ga0070716_100072227 3300006173 Bacteria 2031
164 Ga0070716_100096582 3300006173 Bacteria 1801
165 Ga0070716_100145493 3300006173 Bacteria 1518
166 Ga0070712_100002208 3300006175 Bacteria 11974
167 Ga0070712_100492337 3300006175 Unclassified 1027
168 Ga0097621_100000073 3300006237 Bacteria 52012
169 Ga0097621_100001536 3300006237 Bacteria 15817
170 Ga0097621_100007315 3300006237 Bacteria 7890
171 Ga0097621_100144143 3300006237 Bacteria 2038
172 Ga0068871_100000258 3300006358 Bacteria 36543
173 Ga0068871_100000932 3300006358 Bacteria 19540
174 Ga0068871_100010744 3300006358 Bacteria 6695
175 Ga0068871_100034204 3300006358 Bacteria 4032
176 Ga0068871_100503364 3300006358 Unclassified 1092
177 Ga0075434_100231284 3300006871 Bacteria 1868
178 Ga0068865_100010820 3300006881 Bacteria 5692
179 Ga0068865_100068115 3300006881 Bacteria 2516
180 Ga0075436_100000596 3300006914 Bacteria 23701
181 Ga0075436_100001267 3300006914 Bacteria 17156
182 Ga0075436_100014908 3300006914 Bacteria 5326
183 Ga0075436_100210362 3300006914 Bacteria 1378
184 Ga0097620_100000415 3300006931 Bacteria 42515
185 Ga0097620_100259449 3300006931 Bacteria 1829
186 Ga0075435_100010410 3300007076 Bacteria 6803
187 Ga0075435_100117730 3300007076 Bacteria 2214
188 Ga0075435_100252957 3300007076 Bacteria 1500
189 Ga0105240_10011668 3300009093 Bacteria 12212
190 Ga0105240_10017007 3300009093 Bacteria 9825
191 Ga0105240_10018684 3300009093 Bacteria 9288
192 Ga0105240_10094050 3300009093 Bacteria 3657
193 Ga0105240_10198730 3300009093 Bacteria 2351
194 Ga0105240_10242738 3300009093 Bacteria 2087
195 Ga0105240_10264436 3300009093 Bacteria 1983
196 Ga0105245_10033935 3300009098 Bacteria 4523
197 Ga0105241_10001638 3300009174 Bacteria 17067
198 Ga0105241_10310908 3300009174 Bacteria 1355
199 Ga0105248_10320502 3300009177 Bacteria 1746
200 Ga0105248_10368457 3300009177 Bacteria 1617
201 Ga0105237_10009832 3300009545 Bacteria 10228
202 Ga0105237_10029797 3300009545 Bacteria 5543
203 Ga0105237_10252295 3300009545 Bacteria 1766
204 Ga0105237_10269117 3300009545 Bacteria 1707
205 Ga0105237_10654438 3300009545 Bacteria 1057
206 Ga0105238_10000497 3300009551 Bacteria 41307
207 Ga0105238_10033769 3300009551 Bacteria 5206
208 Ga0105238_10139308 3300009551 Unclassified 2403
209 Ga0105238_10160998 3300009551 Bacteria 2220
210 Ga0105238_10215645 3300009551 Bacteria 1895
211 Ga0105238_10271496 3300009551 Bacteria 1676
212 Ga0105239_10028421 3300010375 Bacteria 6151
213 Ga0105239_10043824 3300010375 Bacteria 4906
214 Ga0105239_10656529 3300010375 Bacteria 1198
215 Ga0157373_10001299 3300013100 Bacteria 19063
216 Ga0157373_10054252 3300013100 Bacteria 2848
217 Ga0157373_10118856 3300013100 Bacteria 1858
218 Ga0157373_10209269 3300013100 Bacteria 1375
219 Ga0157373_10244252 3300013100 Bacteria 1269
220 Ga0157370_10041967 3300013104 Bacteria 4410
221 Ga0157370_10170336 3300013104 Bacteria 2024
222 Ga0157370_10414268 3300013104 Bacteria 1240
223 Ga0157370_10419576 3300013104 Bacteria 1231
224 Ga0157370_10914119 3300013104 Unclassified 796
225 Ga0157369_10000108 3300013105 Bacteria 117027
226 Ga0157369_10031049 3300013105 Bacteria 5888
227 Ga0157369_10046588 3300013105 Bacteria 4711
228 Ga0157369_10057572 3300013105 Bacteria 4193
229 Ga0157369_10243899 3300013105 Bacteria 1876
230 Ga0157369_11197963 3300013105 Unclassified 775
231 Ga0157374_10001477 3300013296 Bacteria 19860
232 Ga0157374_10007082 3300013296 Bacteria 9549
233 Ga0157374_10077725 3300013296 Unclassified 3141
234 Ga0157374_10168420 3300013296 Bacteria 2136
235 Ga0157374_10283942 3300013296 Unclassified 1635
236 Ga0157374_10375114 3300013296 Unclassified 1416
237 Ga0157378_10000030 3300013297 Bacteria 124811
238 Ga0157378_10000099 3300013297 Bacteria 81561
239 Ga0157378_10000473 3300013297 Bacteria 38260
240 Ga0157378_10100197 3300013297 Bacteria 2644
241 Ga0163162_10152220 3300013306 Bacteria 2431
242 Ga0163162_10588349 3300013306 Bacteria 1239
243 Ga0157372_10000218 3300013307 Bacteria 63626
244 Ga0157372_10000576 3300013307 Bacteria 40151
245 Ga0157372_10000825 3300013307 Bacteria 33540
246 Ga0157372_10003314 3300013307 Bacteria 17396
247 Ga0157372_10015799 3300013307 Bacteria 8098
248 Ga0157372_10042834 3300013307 Bacteria 5010
249 Ga0157372_10145967 3300013307 Bacteria 2728
250 Ga0157372_10183235 3300013307 Bacteria 2424
251 Ga0157372_10317938 3300013307 Bacteria 1812
252 Ga0157372_10443046 3300013307 Bacteria 1514
253 Ga0157372_10814593 3300013307 Bacteria 1084
254 Ga0157372_10979747 3300013307 Bacteria 980
255 Ga0163163_10144269 3300014325 Bacteria 2424
256 Ga0182008_10015810 3300014497 Bacteria 3930
257 Ga0157379_10436349 3300014968 Unclassified 1207
258 Ga0157376_10062689 3300014969 Bacteria 3129
259 Ga0157376_10068562 3300014969 Bacteria 3004
260 Ga0157376_10397800 3300014969 Bacteria 1331
261 Ga0182006_1011448 3300015261 Unclassified 3901
262 Ga0182007_10007457 3300015262 Bacteria 4584
263 Ga0182005_1008467 3300015265 Bacteria 3029
264 Ga0206356_10231126 3300020070 Bacteria 1477
265 Ga0206352_11157890 3300020078 Bacteria 1314
266 Ga0206350_11558836 3300020080 Bacteria 2175
267 Ga0206350_11593295 3300020080 Bacteria 1988
268 Ga0154015_1114085 3300020610 Bacteria 1494
269 Ga0224572_1002574 3300024225 Bacteria 2957
270 Ga0207656_10113828 3300025321 Bacteria 1253
271 Ga0207692_10006024 3300025898 Bacteria 4902
272 Ga0207642_10003466 3300025899 Bacteria 4980
273 Ga0207647_10036752 3300025904 Bacteria 3110
274 Ga0207647_10379998 3300025904 Unclassified 798
275 Ga0207685_10020326 3300025905 Bacteria 2205
276 Ga0207699_10004846 3300025906 Bacteria 6438
277 Ga0207699_10012963 3300025906 Bacteria 4251
278 Ga0207699_10015835 3300025906 Bacteria 3928
279 Ga0207699_10148948 3300025906 Bacteria 1546
280 Ga0207699_10171553 3300025906 Unclassified 1451
281 Ga0207645_10134728 3300025907 Bacteria 1608
282 Ga0207705_10223395 3300025909 Bacteria 1431
283 Ga0207684_10019671 3300025910 Bacteria 5775
284 Ga0207684_10034852 3300025910 Bacteria 4275
285 Ga0207684_10382721 3300025910 Unclassified 1210
286 Ga0207654_10225301 3300025911 Unclassified 1246
287 Ga0207707_10001130 3300025912 Bacteria 25296
288 Ga0207707_10003004 3300025912 Bacteria 14996
289 Ga0207707_10022302 3300025912 Bacteria 5536
290 Ga0207707_10056222 3300025912 Bacteria 3423
291 Ga0207707_10191444 3300025912 Bacteria 1784
292 Ga0207707_10222514 3300025912 Unclassified 1643
293 Ga0207707_10262867 3300025912 Bacteria 1497
294 Ga0207707_10620503 3300025912 Bacteria 913
295 Ga0207695_10028405 3300025913 Bacteria 6204
296 Ga0207695_10030294 3300025913 Bacteria 5959
297 Ga0207695_10036038 3300025913 Bacteria 5353
298 Ga0207695_10085345 3300025913 Bacteria 3186
299 Ga0207695_10115101 3300025913 Bacteria 2664
300 Ga0207671_10180194 3300025914 Bacteria 1644
301 Ga0207671_10190717 3300025914 Bacteria 1598
302 Ga0207693_10000013 3300025915 Bacteria 154365
303 Ga0207693_10140155 3300025915 Bacteria 1902
304 Ga0207693_10394618 3300025915 Bacteria 1082
305 Ga0207663_10001881 3300025916 Bacteria 9929
306 Ga0207663_10062578 3300025916 Unclassified 2366
307 Ga0207663_10076824 3300025916 Unclassified 2171
308 Ga0207663_10128363 3300025916 Bacteria 1748
309 Ga0207660_10021602 3300025917 Bacteria 4330
310 Ga0207660_10023819 3300025917 Bacteria 4138
311 Ga0207660_10223238 3300025917 Bacteria 1479
312 Ga0207662_10137824 3300025918 Bacteria 1543
313 Ga0207657_10001938 3300025919 Bacteria 22356
314 Ga0207649_10028447 3300025920 Bacteria 3291
315 Ga0207649_10318137 3300025920 Bacteria 1142
316 Ga0207652_10005098 3300025921 Bacteria 10660
317 Ga0207652_10140163 3300025921 Bacteria 2162
318 Ga0207652_10144818 3300025921 Bacteria 2126
319 Ga0207652_10178236 3300025921 Bacteria 1909
320 Ga0207652_10297473 3300025921 Bacteria 1457
321 Ga0207652_10592921 3300025921 Bacteria 994
322 Ga0207694_10000864 3300025924 Bacteria 26978
323 Ga0207694_10100328 3300025924 Bacteria 2294
324 Ga0207650_10003703 3300025925 Bacteria 10449
325 Ga0207687_10475739 3300025927 Bacteria 1039
326 Ga0207700_10031073 3300025928 Bacteria 3790
327 Ga0207700_10062895 3300025928 Bacteria 2820
328 Ga0207700_10082344 3300025928 Bacteria 2516
329 Ga0207700_10118242 3300025928 Bacteria 2144
330 Ga0207700_10151549 3300025928 Unclassified 1916
331 Ga0207700_10186157 3300025928 Bacteria 1742
332 Ga0207664_10009431 3300025929 Bacteria 6849
333 Ga0207664_10082306 3300025929 Bacteria 2621
334 Ga0207664_10228248 3300025929 Unclassified 1617
335 Ga0207664_10248199 3300025929 Bacteria 1552
336 Ga0207664_10600841 3300025929 Unclassified 988
337 Ga0207706_10115759 3300025933 Bacteria 2358
338 Ga0207704_10018144 3300025938 Bacteria 3667
339 Ga0207704_10124524 3300025938 Bacteria 1771
340 Ga0207665_10005780 3300025939 Bacteria 8227
341 Ga0207665_10014974 3300025939 Bacteria 5094
342 Ga0207665_10018744 3300025939 Bacteria 4548
343 Ga0207665_10029905 3300025939 Bacteria 3600
344 Ga0207665_10079100 3300025939 Bacteria 2260
345 Ga0207665_10194097 3300025939 Bacteria 1477
346 Ga0207665_10201079 3300025939 Unclassified 1452
347 Ga0207665_10307873 3300025939 Bacteria 1186
348 Ga0207711_10126234 3300025941 Bacteria 2289
349 Ga0207689_10042194 3300025942 Bacteria 3775
350 Ga0207689_10179246 3300025942 Bacteria 1747
351 Ga0207661_10071258 3300025944 Bacteria 2840
352 Ga0207661_10086617 3300025944 Bacteria 2600
353 Ga0207661_10105631 3300025944 Bacteria 2373
354 Ga0207679_10012736 3300025945 Bacteria 5493
355 Ga0207679_10097033 3300025945 Bacteria 2295
356 Ga0207667_10003037 3300025949 Bacteria 20829
357 Ga0207667_10034828 3300025949 Bacteria 5404
358 Ga0207667_10042110 3300025949 Bacteria 4856
359 Ga0207667_10134107 3300025949 Bacteria 2550
360 Ga0207667_10549474 3300025949 Unclassified 1168
361 Ga0207667_10968261 3300025949 Unclassified 839
362 Ga0207651_10035013 3300025960 Bacteria 3259
363 Ga0207640_10006676 3300025981 Bacteria 6340
364 Ga0207640_10045339 3300025981 Bacteria 2823
365 Ga0207640_10087466 3300025981 Bacteria 2148
366 Ga0207640_10120649 3300025981 Bacteria 1877
367 Ga0207658_10463139 3300025986 Bacteria 1124
368 Ga0207677_10012343 3300026023 Bacteria 4907
369 Ga0207677_10026128 3300026023 Bacteria 3656
370 Ga0207677_10030672 3300026023 Bacteria 3435
371 Ga0207677_10095682 3300026023 Bacteria 2171
372 Ga0207677_10223504 3300026023 Bacteria 1512
373 Ga0207703_10008197 3300026035 Bacteria 8255
374 Ga0207703_10053298 3300026035 Bacteria 3287
375 Ga0207703_10077469 3300026035 Bacteria 2760
376 Ga0207639_10176317 3300026041 Bacteria 1815
377 Ga0207639_10247881 3300026041 Bacteria 1552
378 Ga0207639_10250470 3300026041 Bacteria 1544
379 Ga0207639_10330400 3300026041 Bacteria 1356
380 Ga0207702_10000086 3300026078 Bacteria 106199
381 Ga0207702_10000764 3300026078 Bacteria 34175
382 Ga0207702_10001551 3300026078 Bacteria 22731
383 Ga0207702_10010742 3300026078 Bacteria 7646
384 Ga0207702_10287692 3300026078 Unclassified 1556
385 Ga0207641_10031491 3300026088 Bacteria 4399
386 Ga0207641_10084434 3300026088 Bacteria 2764
387 Ga0207648_10010395 3300026089 Bacteria 8822
388 Ga0207676_10007286 3300026095 Bacteria 7841
389 Ga0207676_10007435 3300026095 Bacteria 7769
390 Ga0207674_10000281 3300026116 Bacteria 64232
391 Ga0207674_10005414 3300026116 Bacteria 15175
392 Ga0207674_10061634 3300026116 Bacteria 3789
393 Ga0207698_10076890 3300026142 Bacteria 2674
394 Ga0207698_10271506 3300026142 Bacteria 1563
395 Ga0207698_10305571 3300026142 Unclassified 1483
396 Ga0268264_10382867 3300028381 Bacteria 1347
397 Ga0265338_10173279 3300028800 Bacteria 1652
398 Ga0307408_100054076 3300031548 Bacteria 2902
399 Ga0307405_10276081 3300031731 Bacteria 1263
400 Ga0307410_10000418 3300031852 Bacteria 16851
401 Ga0307406_10073100 3300031901 Bacteria 2253
402 Ga0307412_10049334 3300031911 Bacteria 2773
403 Ga0307412_10117469 3300031911 Bacteria 1910
404 Ga0307416_100016934 3300032002 Bacteria 5083
405 Ga0307416_100205167 3300032002 Bacteria 1874
406 Ga0307416_101166963 3300032002 Bacteria 875
407 Ga0307414_10256401 3300032004 Unclassified 1457
408 Ga0307411_10682981 3300032005 Unclassified 892
409 Ga0307415_100011017 3300032126 Bacteria 5151
410 Ga0373926_0039664 3300035083 Bacteria 1679
411 Ga0373926_0067590 3300035083 Unclassified 1309
412 Ga0373928_0030876 3300035084 Bacteria 1187
413 Ga0373923_0035218 3300035111 Bacteria 2036
414 Ga0373936_0018891 3300035113 Bacteria 2667
415 Ga0373936_0032100 3300035113 Bacteria 2076
416 Ga0373945_0023222 3300035116 Bacteria 2141
417 Ga0373954_0085331 3300035118 Bacteria 1512
418 Ga0373956_0240391 3300035119 Bacteria 860
419 Ga0373957_0050999 3300035120 Bacteria 1583
420 Ga0373943_0018454 3300035170 Unclassified 3206
421 Ga0373943_0122641 3300035170 Bacteria 1382
422 Ga0373946_0021304 3300035171 Bacteria 2512
423 Ga0373955_0015426 3300035172 Bacteria 3741
424 Ga0373961_0018024 3300035241 Bacteria 1839
425 Ga0373924_0021177 3300035410 Bacteria 2535
426 Ga0373931_0008193 3300035691 Bacteria 4951
427 Ga0373935_0046442 3300035692 Bacteria 2743
428 Ga0373935_0158995 3300035692 Bacteria 1539
429 Ga0373935_0441895 3300035692 Bacteria 938
430 Ga0373927_0016513 3300035695 Bacteria 4868
431 Ga0373927_0080802 3300035695 Bacteria 2106
432 Ga0373947_0010631 3300035725 Bacteria 5280
433 Ga0373947_0045460 3300035725 Bacteria 2627
434 Ga0373947_0258043 3300035725 Bacteria 1154
435 Ga0373947_0438283 3300035725 Bacteria 884
436 Ga0373937_0000433 3300036401 Bacteria 38936
437 Ga0373937_0026053 3300036401 Bacteria 5283
438 Ga0373937_0105060 3300036401 Bacteria 2624
439 Ga0373937_0114777 3300036401 Bacteria 2507
440 Ga0373937_0213299 3300036401 Bacteria 1817
441 Ga0373937_0329477 3300036401 Bacteria 1445
442 Ga0373925_0006773 3300037068 Bacteria 8398
443 Ga0373925_0007963 3300037068 Bacteria 7716
444 Ga0373925_0012397 3300037068 Bacteria 6172
445 Ga0395898_0058262 3300037466 Bacteria 3761
446 Ga0395905_0035633 3300037471 Bacteria 4672
447 Ga0395905_0046347 3300037471 Bacteria 4076
448 Ga0395905_0133913 3300037471 Bacteria 2331
449 Ga0395901_0225845 3300038443 Bacteria 1956
450 Ga0436365_1743888 3300039437 Bacteria 2143
451 Ga0436363_0405564 3300039450 Bacteria 1409
452 Ga0436363_0537075 3300039450 Unclassified 1292
453 Ga0436362_0549664 3300039453 Bacteria 5847
454 Ga0451577_0000241 3300042876 Bacteria 108191
455 Ga0453683_0018724 3300044673 Bacteria 4442
456 Ga0453683_0128550 3300044673 Bacteria 1596
457 Ga0466963_0085737 3300044694 Unclassified 2139
458 Ga0466963_0416203 3300044694 Bacteria 948
459 Ga0466964_0011637 3300044706 Bacteria 3327
460 Ga0453684_0000366 3300044712 Bacteria 186117
461 Ga0466957_0000118 3300044842 Bacteria 32834
462 Ga0466959_0002126 3300045049 Bacteria 12544
463 Ga0451576_0005686 3300045051 Bacteria 15558
464 Ga0451576_0316654 3300045051 Bacteria 1632
465 Ga0466958_0056318 3300045836 Bacteria 2388
466 Ga0466958_0345695 3300045836 Bacteria 957
467 Ga0466967_0012167 3300045976 Bacteria 6566
468 Ga0466967_0053736 3300045976 Bacteria 3541
469 Ga0466967_0183750 3300045976 Bacteria 1973
470 Ga0466967_0435076 3300045976 Unclassified 1280
471 Ga0495580_0005708 3300046472 Bacteria 10237
472 Ga0495580_0008511 3300046472 Bacteria 8156
473 Ga0495580_0008969 3300046472 Bacteria 7902
474 Ga0495580_0029919 3300046472 Bacteria 3948
475 Ga0495580_0037768 3300046472 Bacteria 3463
476 Ga0495580_0077114 3300046472 Bacteria 2324
477 Ga0495580_0360418 3300046472 Unclassified 984
478 Ga0495582_0001573 3300046473 Bacteria 12875
479 Ga0495608_0168349 3300046511 Bacteria 1390
480 Ga0495666_0021858 3300046526 Bacteria 3167
481 Ga0495665_0011363 3300046531 Bacteria 4819
482 Ga0495665_0044785 3300046531 Bacteria 2350
483 Ga0495634_0262581 3300046642 Bacteria 1053
484 Ga0495657_0056042 3300046675 Bacteria 2627
485 Ga0495623_0012281 3300046679 Bacteria 5547
486 Ga0495623_0047521 3300046679 Bacteria 2724
487 Ga0495623_0212135 3300046679 Bacteria 1108
488 Ga0495647_0067325 3300046681 Bacteria 1426
489 Ga0495658_0236409 3300046683 Bacteria 1147
490 Ga0495669_0030744 3300046684 Bacteria 2357
491 Ga0495669_0121132 3300046684 Unclassified 1226
492 Ga0495624_0073928 3300046690 Bacteria 2118
493 Ga0495624_0120064 3300046690 Bacteria 1615
494 Ga0495581_0023298 3300047315 Unclassified 3588
495 Ga0495581_0234050 3300047315 Bacteria 1074
496 Ga0495674_0094777 3300047319 Bacteria 2546
497 Ga0495675_0100472 3300047444 Bacteria 1811
498 Ga0495684_0204714 3300047471 Bacteria 1454
499 Ga0495684_0231060 3300047471 Bacteria 1353
500 Ga0495593_0081656 3300047673 Bacteria 1671
501 Ga0495602_0088644 3300048088 Bacteria 2575
502 Ga0496100_0194835 3300048903 Bacteria 1473
503 Ga0496100_0424775 3300048903 Bacteria 1015
504 Ga0496101_0303475 3300048904 Unclassified 1251
505 Ga0496102_0039044 3300048905 Bacteria 4288
506 Ga0496102_0042147 3300048905 Bacteria 4136
507 Ga0496102_0059467 3300048905 Bacteria 3495
508 Ga0496102_0099097 3300048905 Bacteria 2705
509 Ga0496102_0545261 3300048905 Unclassified 1082
510 Ga0496102_0719667 3300048905 Bacteria 921
511 Ga0496103_0307285 3300048906 Bacteria 1020
512 Ga0496104_0122972 3300048907 Bacteria 2491
513 Ga0496104_0127742 3300048907 Bacteria 2441
514 Ga0496104_0209371 3300048907 Bacteria 1862
515 Ga0496104_0211620 3300048907 Bacteria 1850
516 Ga0496104_0342001 3300048907 Bacteria 1409
517 Ga0496105_0041044 3300048908 Bacteria 3814
518 Ga0496106_0506860 3300048909 Unclassified 969
519 Ga0496108_0040522 3300048911 Bacteria 3883
520 Ga0496109_0076027 3300048912 Bacteria 3088
521 Ga0496110_0650021 3300048913 Bacteria 954
522 Ga0496111_0001040 3300048914 Bacteria 15261
523 Ga0496111_0030118 3300048914 Bacteria 3859
524 Ga0496112_0005825 3300048915 Bacteria 10725
525 Ga0496112_0030914 3300048915 Bacteria 5188
526 Ga0496112_0078153 3300048915 Unclassified 3273
527 Ga0496112_0211147 3300048915 Bacteria 1898
528 Ga0496112_0345339 3300048915 Bacteria 1431
529 Ga0496112_0547694 3300048915 Bacteria 1091
530 Ga0496113_0000615 3300048916 Bacteria 17847
531 Ga0496113_0087812 3300048916 Bacteria 2391
532 Ga0496115_0060633 3300048918 Bacteria 3049
533 Ga0496115_0106730 3300048918 Bacteria 2299
534 Ga0501292_005615 3300049515 Bacteria 1756
535 Ga0501228_014306 3300049666 Bacteria 837
536 Ga0501234_012946 3300049707 Bacteria 1309
537 Ga0501083_0026123 3300049744 Bacteria 4040
538 nmdc:mga0n895_1037_c1 3300050512 Bacteria 20212
539 nmdc:mga0n895_222092_c1 3300050512 Bacteria 1918
540 nmdc:mga0rr50_45157_c1 3300050513 Bacteria 3236
541 nmdc:mga0rr50_98016_c1 3300050513 Bacteria 2297
542 nmdc:mga08x19_1063_c1 3300050514 Bacteria 17156
543 nmdc:mga08x19_115479_c1 3300050514 Bacteria 1794
544 nmdc:mga08x19_19410_c1 3300050514 Bacteria 4171
545 nmdc:mga08x19_2769_c1 3300050514 Bacteria 10585
546 Ga0495612_0059599 3300053078 Bacteria 1579
547 Ga0587094_006088 3300059513 Bacteria 1435
548 Ga0587068_018722 3300059641 Bacteria 1117
549 Ga0587075_001834 3300059644 Bacteria 2146
550 Ga0587107_006929 3300059652 Unclassified 1260
551 Ga0587071_014757 3300060344 Unclassified 1362
552 Ga0466962_0102130 3300061719 Bacteria 1377
553 Ga0105245_10002674
554 LJNas_1000260
555 Ga0058859_11229812
556 Ga0058863_10100073
557 Ga0058863_10150337
558 Ga0058863_11826942
559 Ga0058861_10094073
560 Ga0058861_10138085
561 Ga0058861_11962564
562 Ga0058862_10009088
563 Ga0058862_10222981
564 Ga0058862_10237322
565 Ga0058862_10276214
566 Ga0058862_12744342
567 Ga0070658_10073242
568 Ga0070676_10257446
569 Ga0070683_100030293
570 Ga0070683_100176882
571 Ga0070690_100313474
572 Ga0070690_100526094
573 Ga0070670_100001671
574 Ga0068869_100029513
575 Ga0068869_100489370
576 Ga0070666_10391574
577 Ga0070680_100009435
578 Ga0070680_100088624
579 Ga0070680_100239449
580 Ga0070680_100257884
581 Ga0070680_100264625
582 Ga0070682_100099619
583 Ga0068868_100002128
584 Ga0068868_100026427
585 Ga0068868_100222794
586 Ga0068868_100331100
587 Ga0070660_100099634
588 Ga0070691_10183389
589 Ga0070687_100110088
590 Ga0070661_100044298
591 Ga0070661_100259091
592 Ga0070669_100831101
593 Ga0070671_100109494
594 Ga0070673_100062264
595 Ga0070659_100065868
596 Ga0070709_10031450
597 Ga0070709_10049158
598 Ga0070709_10110232
599 Ga0070709_10168549
600 Ga0070709_10173214
601 Ga0070714_100010217
602 Ga0070714_100245702
603 Ga0070714_100294310
604 Ga0070714_100520318
605 Ga0070714_100624135
606 Ga0070713_100024512
607 Ga0070713_100028018
608 Ga0070713_100047430
609 Ga0070713_100093401
610 Ga0070713_100214580
611 Ga0070713_100218139
612 Ga0070713_100281506
613 Ga0070713_100617966
614 Ga0070710_10004463
615 Ga0070710_10020086
616 Ga0070711_100007062
617 Ga0070711_100023091
618 Ga0070711_100049047
619 Ga0070711_100085238
620 Ga0070708_100002407
621 Ga0070708_100015048
622 Ga0070708_100121445
623 Ga0070662_100071662
624 Ga0070662_100235861
625 Ga0070681_10008575
626 Ga0070681_10010721
627 Ga0070681_10031414
628 Ga0070681_10046181
629 Ga0070681_10249505
630 Ga0070681_10263663
631 Ga0070681_10296483
632 Ga0070681_10415132
633 Ga0068867_100005572
634 Ga0070706_100000812
635 Ga0070706_100000935
636 Ga0070706_100006968
637 Ga0070707_100003649
638 Ga0070698_100337674
639 Ga0070699_100525643
640 Ga0070679_100003769
641 Ga0070679_100014343
642 Ga0070679_100040984
643 Ga0070679_100101184
644 Ga0070684_100048946
645 Ga0070684_100138870
646 Ga0070684_100367440
647 Ga0070684_100526694
648 Ga0070697_100000249
649 Ga0070697_100000266
650 Ga0070697_100036205
651 Ga0070697_100131111
652 Ga0070697_100165972
653 Ga0070697_100416967
654 Ga0068853_100101358
655 Ga0068853_100114209
656 Ga0068853_100193007
657 Ga0068853_100373981
658 Ga0068853_100556928
659 Ga0070696_100213395
660 Ga0070693_100066614
661 Ga0070693_100113637
662 Ga0070704_100389194
663 Ga0068855_100000151
664 Ga0068855_100002998
665 Ga0068855_100010918
666 Ga0068855_100087433
667 Ga0068855_100139164
668 Ga0068855_100248413
669 Ga0068855_100305095
670 Ga0068855_100447861
671 Ga0070664_100001009
672 Ga0070664_100011218
673 Ga0070664_100202461
674 Ga0068857_100000121
675 Ga0068857_100044114
676 Ga0068857_100047396
677 Ga0068854_100047989
678 Ga0068854_100076111
679 Ga0068854_100157755
680 Ga0068854_100242987
681 Ga0068854_100266461
682 Ga0068856_100000119
683 Ga0068856_100000735
684 Ga0068856_100003101
685 Ga0068856_100021804
686 Ga0068856_100041815
687 Ga0068856_100221480
688 Ga0068852_100041056
689 Ga0068852_100353920
690 Ga0068859_100000415
691 Ga0068859_100259423
692 Ga0068864_100001353
693 Ga0068864_100061671
694 Ga0068866_10001235
695 Ga0068851_10050612
696 Ga0068863_100040487
697 Ga0068863_100182712
698 Ga0068858_100001756
699 Ga0068858_100195213
700 Ga0068860_100382288
701 Ga0068860_100474119
702 Ga0068862_100534689
703 Ga0081540_1094023
704 Ga0070717_10000964
705 Ga0070717_10031513
706 Ga0070717_10059121
707 Ga0070717_10065419
708 Ga0070717_10072990
709 Ga0070717_10129870
710 Ga0070717_10337869
711 Ga0070717_10784023
712 Ga0070715_10043405
713 Ga0070716_100012854
714 Ga0070716_100060757
715 Ga0070716_100072227
716 Ga0070716_100096582
717 Ga0070716_100145493
718 Ga0070712_100002208
719 Ga0070712_100492337
720 Ga0097621_100000073
721 Ga0097621_100001536
722 Ga0097621_100007315
723 Ga0097621_100144143
724 Ga0068871_100000258
725 Ga0068871_100000932
726 Ga0068871_100010744
727 Ga0068871_100034204
728 Ga0068871_100503364
729 Ga0075434_100231284
730 Ga0068865_100010820
731 Ga0068865_100068115
732 Ga0075436_100000596
733 Ga0075436_100001267
734 Ga0075436_100014908
735 Ga0075436_100210362
736 Ga0097620_100000415
737 Ga0097620_100259449
738 Ga0075435_100010410
739 Ga0075435_100117730
740 Ga0075435_100252957
741 Ga0105240_10011668
742 Ga0105240_10017007
743 Ga0105240_10018684
744 Ga0105240_10094050
745 Ga0105240_10198730
746 Ga0105240_10242738
747 Ga0105240_10264436
748 Ga0105245_10033935
749 Ga0105241_10001638
750 Ga0105241_10310908
751 Ga0105248_10320502
752 Ga0105248_10368457
753 Ga0105237_10009832
754 Ga0105237_10029797
755 Ga0105237_10252295
756 Ga0105237_10269117
757 Ga0105237_10654438
758 Ga0105238_10000497
759 Ga0105238_10033769
760 Ga0105238_10139308
761 Ga0105238_10160998
762 Ga0105238_10215645
763 Ga0105238_10271496
764 Ga0105239_10028421
765 Ga0105239_10043824
766 Ga0105239_10656529
767 Ga0157373_10001299
768 Ga0157373_10054252
769 Ga0157373_10118856
770 Ga0157373_10209269
771 Ga0157373_10244252
772 Ga0157370_10041967
773 Ga0157370_10170336
774 Ga0157370_10414268
775 Ga0157370_10419576
776 Ga0157370_10914119
777 Ga0157369_10000108
778 Ga0157369_10031049
779 Ga0157369_10046588
780 Ga0157369_10057572
781 Ga0157369_10243899
782 Ga0157369_11197963
783 Ga0157374_10001477
784 Ga0157374_10007082
785 Ga0157374_10077725
786 Ga0157374_10168420
787 Ga0157374_10283942
788 Ga0157374_10375114
789 Ga0157378_10000030
790 Ga0157378_10000099
791 Ga0157378_10000473
792 Ga0157378_10100197
793 Ga0163162_10152220
794 Ga0163162_10588349
795 Ga0157372_10000218
796 Ga0157372_10000576
797 Ga0157372_10000825
798 Ga0157372_10003314
799 Ga0157372_10015799
800 Ga0157372_10042834
801 Ga0157372_10145967
802 Ga0157372_10183235
803 Ga0157372_10317938
804 Ga0157372_10443046
805 Ga0157372_10814593
806 Ga0157372_10979747
807 Ga0163163_10144269
808 Ga0182008_10015810
809 Ga0157379_10436349
810 Ga0157376_10062689
811 Ga0157376_10068562
812 Ga0157376_10397800
813 Ga0182006_1011448
814 Ga0182007_10007457
815 Ga0182005_1008467
816 Ga0206356_10231126
817 Ga0206352_11157890
818 Ga0206350_11558836
819 Ga0206350_11593295
820 Ga0154015_1114085
821 Ga0224572_1002574
822 Ga0207656_10113828
823 Ga0207692_10006024
824 Ga0207642_10003466
825 Ga0207647_10036752
826 Ga0207647_10379998
827 Ga0207685_10020326
828 Ga0207699_10004846
829 Ga0207699_10012963
830 Ga0207699_10015835
831 Ga0207699_10148948
832 Ga0207699_10171553
833 Ga0207645_10134728
834 Ga0207705_10223395
835 Ga0207684_10019671
836 Ga0207684_10034852
837 Ga0207684_10382721
838 Ga0207654_10225301
839 Ga0207707_10001130
840 Ga0207707_10003004
841 Ga0207707_10022302
842 Ga0207707_10056222
843 Ga0207707_10191444
844 Ga0207707_10222514
845 Ga0207707_10262867
846 Ga0207707_10620503
847 Ga0207695_10028405
848 Ga0207695_10030294
849 Ga0207695_10036038
850 Ga0207695_10085345
851 Ga0207695_10115101
852 Ga0207671_10180194
853 Ga0207671_10190717
854 Ga0207693_10000013
855 Ga0207693_10140155
856 Ga0207693_10394618
857 Ga0207663_10001881
858 Ga0207663_10062578
859 Ga0207663_10076824
860 Ga0207663_10128363
861 Ga0207660_10021602
862 Ga0207660_10023819
863 Ga0207660_10223238
864 Ga0207662_10137824
865 Ga0207657_10001938
866 Ga0207649_10028447
867 Ga0207649_10318137
868 Ga0207652_10005098
869 Ga0207652_10140163
870 Ga0207652_10144818
871 Ga0207652_10178236
872 Ga0207652_10297473
873 Ga0207652_10592921
874 Ga0207694_10000864
875 Ga0207694_10100328
876 Ga0207650_10003703
877 Ga0207687_10475739
878 Ga0207700_10031073
879 Ga0207700_10062895
880 Ga0207700_10082344
881 Ga0207700_10118242
882 Ga0207700_10151549
883 Ga0207700_10186157
884 Ga0207664_10009431
885 Ga0207664_10082306
886 Ga0207664_10228248
887 Ga0207664_10248199
888 Ga0207664_10600841
889 Ga0207706_10115759
890 Ga0207704_10018144
891 Ga0207704_10124524
892 Ga0207665_10005780
893 Ga0207665_10014974
894 Ga0207665_10018744
895 Ga0207665_10029905
896 Ga0207665_10079100
897 Ga0207665_10194097
898 Ga0207665_10201079
899 Ga0207665_10307873
900 Ga0207711_10126234
901 Ga0207689_10042194
902 Ga0207689_10179246
903 Ga0207661_10071258
904 Ga0207661_10086617
905 Ga0207661_10105631
906 Ga0207679_10012736
907 Ga0207679_10097033
908 Ga0207667_10003037
909 Ga0207667_10034828
910 Ga0207667_10042110
911 Ga0207667_10134107
912 Ga0207667_10549474
913 Ga0207667_10968261
914 Ga0207651_10035013
915 Ga0207640_10006676
916 Ga0207640_10045339
917 Ga0207640_10087466
918 Ga0207640_10120649
919 Ga0207658_10463139
920 Ga0207677_10012343
921 Ga0207677_10026128
922 Ga0207677_10030672
923 Ga0207677_10095682
924 Ga0207677_10223504
925 Ga0207703_10008197
926 Ga0207703_10053298
927 Ga0207703_10077469
928 Ga0207639_10176317
929 Ga0207639_10247881
930 Ga0207639_10250470
931 Ga0207639_10330400
932 Ga0207702_10000086
933 Ga0207702_10000764
934 Ga0207702_10001551
935 Ga0207702_10010742
936 Ga0207702_10287692
937 Ga0207641_10031491
938 Ga0207641_10084434
939 Ga0207648_10010395
940 Ga0207676_10007286
941 Ga0207676_10007435
942 Ga0207674_10000281
943 Ga0207674_10005414
944 Ga0207674_10061634
945 Ga0207698_10076890
946 Ga0207698_10271506
947 Ga0207698_10305571
948 Ga0268264_10382867
949 Ga0265338_10173279
950 Ga0307408_100054076
951 Ga0307405_10276081
952 Ga0307410_10000418
953 Ga0307406_10073100
954 Ga0307412_10049334
955 Ga0307412_10117469
956 Ga0307416_100016934
957 Ga0307416_100205167
958 Ga0307416_101166963
959 Ga0307414_10256401
960 Ga0307411_10682981
961 Ga0307415_100011017
962 Ga0373926_0039664
963 Ga0373926_0067590
964 Ga0373928_0030876
965 Ga0373923_0035218
966 Ga0373936_0018891
967 Ga0373936_0032100
968 Ga0373945_0023222
969 Ga0373954_0085331
970 Ga0373956_0240391
971 Ga0373957_0050999
972 Ga0373943_0018454
973 Ga0373943_0122641
974 Ga0373946_0021304
975 Ga0373955_0015426
976 Ga0373961_0018024
977 Ga0373924_0021177
978 Ga0373931_0008193
979 Ga0373935_0046442
980 Ga0373935_0158995
981 Ga0373935_0441895
982 Ga0373927_0016513
983 Ga0373927_0080802
984 Ga0373947_0010631
985 Ga0373947_0045460
986 Ga0373947_0258043
987 Ga0373947_0438283
988 Ga0373937_0000433
989 Ga0373937_0026053
990 Ga0373937_0105060
991 Ga0373937_0114777
992 Ga0373937_0213299
993 Ga0373937_0329477
994 Ga0373925_0006773
995 Ga0373925_0007963
996 Ga0373925_0012397
997 Ga0395898_0058262
998 Ga0395905_0035633
999 Ga0395905_0046347
1000 Ga0395905_0133913
1001 Ga0395901_0225845
1002 Ga0436365_1743888
1003 Ga0436363_0405564
1004 Ga0436363_0537075
1005 Ga0436362_0549664
1006 Ga0451577_0000241
1007 Ga0453683_0018724
1008 Ga0453683_0128550
1009 Ga0466963_0085737
1010 Ga0466963_0416203
1011 Ga0466964_0011637
1012 Ga0453684_0000366
1013 Ga0466957_0000118
1014 Ga0466959_0002126
1015 Ga0451576_0005686
1016 Ga0451576_0316654
1017 Ga0466958_0056318
1018 Ga0466958_0345695
1019 Ga0466967_0012167
1020 Ga0466967_0053736
1021 Ga0466967_0183750
1022 Ga0466967_0435076
1023 Ga0495580_0005708
1024 Ga0495580_0008511
1025 Ga0495580_0008969
1026 Ga0495580_0029919
1027 Ga0495580_0037768
1028 Ga0495580_0077114
1029 Ga0495580_0360418
1030 Ga0495582_0001573
1031 Ga0495608_0168349
1032 Ga0495666_0021858
1033 Ga0495665_0011363
1034 Ga0495665_0044785
1035 Ga0495634_0262581
1036 Ga0495657_0056042
1037 Ga0495623_0012281
1038 Ga0495623_0047521
1039 Ga0495623_0212135
1040 Ga0495647_0067325
1041 Ga0495658_0236409
1042 Ga0495669_0030744
1043 Ga0495669_0121132
1044 Ga0495624_0073928
1045 Ga0495624_0120064
1046 Ga0495581_0023298
1047 Ga0495581_0234050
1048 Ga0495674_0094777
1049 Ga0495675_0100472
1050 Ga0495684_0204714
1051 Ga0495684_0231060
1052 Ga0495593_0081656
1053 Ga0495602_0088644
1054 Ga0496100_0194835
1055 Ga0496100_0424775
1056 Ga0496101_0303475
1057 Ga0496102_0039044
1058 Ga0496102_0042147
1059 Ga0496102_0059467
1060 Ga0496102_0099097
1061 Ga0496102_0545261
1062 Ga0496102_0719667
1063 Ga0496103_0307285
1064 Ga0496104_0122972
1065 Ga0496104_0127742
1066 Ga0496104_0209371
1067 Ga0496104_0211620
1068 Ga0496104_0342001
1069 Ga0496105_0041044
1070 Ga0496106_0506860
1071 Ga0496108_0040522
1072 Ga0496109_0076027
1073 Ga0496110_0650021
1074 Ga0496111_0001040
1075 Ga0496111_0030118
1076 Ga0496112_0005825
1077 Ga0496112_0030914
1078 Ga0496112_0078153
1079 Ga0496112_0211147
1080 Ga0496112_0345339
1081 Ga0496112_0547694
1082 Ga0496113_0000615
1083 Ga0496113_0087812
1084 Ga0496115_0060633
1085 Ga0496115_0106730
1086 Ga0501292_005615
1087 Ga0501228_014306
1088 Ga0501234_012946
1089 Ga0501083_0026123
1090 nmdc:mga0n895_1037_c1
1091 nmdc:mga0n895_222092_c1
1092 nmdc:mga0rr50_45157_c1
1093 nmdc:mga0rr50_98016_c1
1094 nmdc:mga08x19_1063_c1
1095 nmdc:mga08x19_115479_c1
1096 nmdc:mga08x19_19410_c1
1097 nmdc:mga08x19_2769_c1
1098 Ga0495612_0059599
1099 Ga0587094_006088
1100 Ga0587068_018722
1101 Ga0587075_001834
1102 Ga0587107_006929
1103 Ga0587071_014757
1104 Ga0466962_0102130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

105

189

0.97

PF01386

Ribosomal_L25p

Ribosomal L25p family

8

97

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xym-assembly1.cif.gz_V large subunit of mycobacterium smegmatis 0.9267 8 187
5zeb-assembly1.cif.gz_W m. smegmatis p/p state 70s ribosome structure 0.9255 8 191
8fr8-assembly1.cif.gz_2 structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.9189 8 187
8cvm-assembly1.cif.gz_u cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9166 9 189
5nrg-assembly1.cif.gz_S the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with rb02 0.9161 10 182
ID Description Score Start End Superfamily
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9732 101 182 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9502 101 182 2.170.120.20
af_P9WHB5_101_189_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9356 104 191 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9226 8 100 2.40.240.10
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9223 104 188 2.170.120.20
ID Description Score Start End GO Terms
AF-A0A351FF11-F1-model_v4 Large ribosomal subunit protein bL25 beta domain-containing protein 0.9562 112 188 GO:0006412
GO:0008097
GO:0022625
AF-A0A3D3DUP3-F1-model_v4 50S ribosomal protein L25 0.953 100 189 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A3N5ZHV3-F1-model_v4 50S ribosomal protein L25/general stress protein Ctc 0.9453 8 179 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A3D1ATL1-F1-model_v4 Large ribosomal subunit protein bL25 (General stress protein CTC) 0.9429 9 197 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A3P1SBJ6-F1-model_v4 50S ribosomal protein L25 0.9392 8 101 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map